Skip navigation links
A B C D E F G H I J K L M N O P Q R S T U V W X Y Z 

A

A_ALLELE - Static variable in class net.maizegenetics.dna.snp.NucleotideAlignmentConstants
 
A_DIPLOID_ALLELE - Static variable in class net.maizegenetics.dna.snp.NucleotideAlignmentConstants
 
AboutBox - Class in net.maizegenetics.tassel
 
AboutBox(parent) - Constructor for class net.maizegenetics.tassel.AboutBox
 
absoluteDistance(mat) - Method in class net.maizegenetics.taxa.distance.DistanceMatrix
compute absolute distance to second distance matrix
ABSTOL - Variable in interface net.maizegenetics.taxa.tree.BranchLimits
maximum tolerated error when determining branch lengths
AbstractAdditiveSite - Class in net.maizegenetics.analysis.modelfitter
This class holds data for a variant site to provide an object to hold data used and returned by a stepwise model fitter. That makes it convenient to use in a parallel stream for processing.
AbstractAdditiveSite(site, chromosomeName, pos, id, selectionCriterion) - Constructor for class net.maizegenetics.analysis.modelfitter.AbstractAdditiveSite
 
AbstractAvailableListModel - Class in net.maizegenetics.gui
 
AbstractAvailableListModel(realSize) - Constructor for class net.maizegenetics.gui.AbstractAvailableListModel
 
AbstractByte2D - Class in net.maizegenetics.dna.snp.byte2d
 
AbstractByte2D(scoreType, numTaxa, numSites) - Constructor for class net.maizegenetics.dna.snp.byte2d.AbstractByte2D
 
AbstractDisplayPlugin - Class in net.maizegenetics.analysis.chart
This plugin abstract plugin provides mechanisms for setting a savefile and for saving a variety of images. This would be useful to plugin that create images and may want to automatically send them to a file.
AbstractDisplayPlugin(parentFrame, isInteractive) - Constructor for class net.maizegenetics.analysis.chart.AbstractDisplayPlugin
 
AbstractDisplayPlugin.Outformat - Enum in net.maizegenetics.analysis.chart
 
AbstractFixedEffectLM - Class in net.maizegenetics.analysis.association
 
AbstractFixedEffectLM(dataset, parentPlugin) - Constructor for class net.maizegenetics.analysis.association.AbstractFixedEffectLM
 
AbstractForwardRegression - Class in net.maizegenetics.analysis.modelfitter
 
AbstractForwardRegression(data) - Constructor for class net.maizegenetics.analysis.modelfitter.AbstractForwardRegression
 
AbstractForwardRegression(serialFilename, pheno) - Constructor for class net.maizegenetics.analysis.modelfitter.AbstractForwardRegression
 
AbstractGenotypeTableMask - Class in net.maizegenetics.gui
 
AbstractGenotypeTableMask(align, name, color, type) - Constructor for class net.maizegenetics.gui.AbstractGenotypeTableMask
 
AbstractMaskMatrix - Class in net.maizegenetics.dna.snp
 
AbstractPETags - Class in net.maizegenetics.dna.tag
Basic methods for working with PE Tags, including sorting and search.
AbstractPETagsOnPhysicalMap - Class in net.maizegenetics.dna.map
Basic method of working with alignment of PE tags
AbstractPETagsOnPhysicalMap.PETagType - Enum in net.maizegenetics.dna.map
 
AbstractPlugin - Class in net.maizegenetics.plugindef
 
AbstractPlugin() - Constructor for class net.maizegenetics.plugindef.AbstractPlugin
Creates a new instance of AbstractPlugin
AbstractPlugin(parentFrame, isInteractive) - Constructor for class net.maizegenetics.plugindef.AbstractPlugin
Creates a new instance of AbstractPlugin
AbstractPluginAction - Class in net.maizegenetics.plugindef
 
AbstractPluginAction(plugin, name, icon) - Constructor for class net.maizegenetics.plugindef.AbstractPluginAction
Creates a new instance of AbstractPluginAction
AbstractTableReport - Class in net.maizegenetics.util
 
AbstractTag - Class in net.maizegenetics.dna.tag
Created by edbuckler on 7/26/14.
AbstractTag(length, reference, name) - Constructor for class net.maizegenetics.dna.tag.AbstractTag
 
AbstractTags - Class in net.maizegenetics.dna.tag
Basic methods for working with Tags, including sorting and search.
AbstractTagsByTaxa - Class in net.maizegenetics.dna.tag
Basic method implementation of Tags by Taxa, including methods for reading and writing files
AbstractTagsHDF5 - Class in net.maizegenetics.dna.tag
Basic implementations of HDF5 tags. This is designed to annotate tags with a bunch of attributes, to solve the memory issues
AbstractTagsOnPhysicalMap - Class in net.maizegenetics.dna.map
Abstract TagsOnPhysicalMap object. Abstract alignment is implemented by two types of TOPM classes class TagsOnPhysicalMap and class TagsOnPhysMapHDF5. TagsOnPhysicalMap is fully loaded into memory when read, and it can only support one mapping position (the files are either binary or text). TagsOnPhysMapHDF5 can support a large number of mapping position, and only a portion of the data is loaded into memory. In most cases, TagsOnPhysMapHDF5 should be preferred going forward.
AbstractTagsOnPhysicalMap() - Constructor for class net.maizegenetics.dna.map.AbstractTagsOnPhysicalMap
 
accept(f) - Method in class net.maizegenetics.util.BasicFileFilter
 
acceptsValue(value) - Method in class net.maizegenetics.plugindef.PluginParameter
 
acceptsValue(input) - Method in class net.maizegenetics.plugindef.PluginParameter
 
AccumulateR2(id, chr, start, end, r2Total, r2Count) - Constructor for class net.maizegenetics.analysis.data.MeanR2FromLDPlugin.AccumulateR2
 
accumulator() - Method in class net.maizegenetics.dna.map.PositionList.PositionListCollector
 
accumulator() - Method in class net.maizegenetics.taxa.TaxaList.TaxaListCollector
 
accumulator() - Method in class net.maizegenetics.util.BitSet.BitSetListCollector
 
actionPerformed(e) - Method in class net.maizegenetics.analysis.filter.FilterTraitsDialog
 
actionPerformed(e) - Method in class net.maizegenetics.analysis.numericaltransform.TransformDataDialog
 
actionPerformed(e) - Method in class net.maizegenetics.gui.PrintHeapAction
 
actionPerformed(e) - Method in class net.maizegenetics.tassel.AboutBox
 
actionPerformed(e) - Method in class net.maizegenetics.tassel.TASSELMainFrame
 
add(e) - Method in class net.maizegenetics.analysis.avro.GenericArrayPositions
 
add(index, element) - Method in class net.maizegenetics.analysis.avro.GenericArrayPositions
 
add(e) - Method in class net.maizegenetics.analysis.avro.GenericArrayTaxa
 
add(index, element) - Method in class net.maizegenetics.analysis.avro.GenericArrayTaxa
 
add(hap) - Method in class net.maizegenetics.analysis.clustering.HaplotypeCluster
 
add(data, c) - Method in class net.maizegenetics.analysis.gbs.neobio.Trie
Adds a new child to this node. The new node will be implicitly instantiated with the data argument, and the edge from this node to the new node will be labelled by the character argument. If this node already have an edge labelled with this character, an exception is raised. Otherwise, the new node created and returned.
add(element) - Method in class net.maizegenetics.dna.map.PositionListBuilder
Adds element to the PositionList.
add(e) - Method in class net.maizegenetics.dna.snp.FilterList
 
add(index, element) - Method in class net.maizegenetics.dna.snp.FilterList
 
add(index) - Method in class net.maizegenetics.gui.SelectFromAvailableDialog.SelectedListModel
 
add(taxon) - Method in class net.maizegenetics.taxa.TaxaListBuilder
 
add(taxon) - Method in class net.maizegenetics.taxa.TaxaListBuilder
 
add(shortForm, longForm) - Method in class net.maizegenetics.util.ArgsEngine
Configures the engine by adding options.
add(shortForm, longForm, valued) - Method in class net.maizegenetics.util.ArgsEngine
Configures the engine by adding options.
add(row) - Method in class net.maizegenetics.util.TableReportBuilder
 
add(e) - Method in class net.maizegenetics.util.UndirectedGraph.UndirectedSet
 
addAlignment(topm) - Method in class net.maizegenetics.dna.map.TagGWASMap
 
addAll(c) - Method in class net.maizegenetics.analysis.avro.GenericArrayPositions
 
addAll(index, c) - Method in class net.maizegenetics.analysis.avro.GenericArrayPositions
 
addAll(c) - Method in class net.maizegenetics.analysis.avro.GenericArrayTaxa
 
addAll(index, c) - Method in class net.maizegenetics.analysis.avro.GenericArrayTaxa
 
addAll(cluster) - Method in class net.maizegenetics.analysis.clustering.HaplotypeCluster
This function does not prevent Haplotypes from being duplicated. To avoid duplicates use addAllUnique.
addAll(collection) - Method in class net.maizegenetics.dna.map.PositionListBuilder
Adds each element of elements to the PositionList.
addAll(builder) - Method in class net.maizegenetics.dna.map.PositionListBuilder
 
addAll(c) - Method in class net.maizegenetics.dna.snp.FilterList
 
addAll(index, c) - Method in class net.maizegenetics.dna.snp.FilterList
 
addAll(taxa) - Method in class net.maizegenetics.taxa.TaxaListBuilder
 
addAll(a) - Method in class net.maizegenetics.taxa.TaxaListBuilder
 
addAll(taxa) - Method in class net.maizegenetics.taxa.TaxaListBuilder
 
addAll(taxa) - Method in class net.maizegenetics.taxa.TaxaListBuilder
 
addAll(taxa) - Method in class net.maizegenetics.taxa.TaxaListBuilder
 
addAll(builder) - Method in class net.maizegenetics.taxa.TaxaListBuilder
 
addAll(c) - Method in class net.maizegenetics.util.UndirectedGraph.UndirectedSet
 
addAllBarcodes(barcodes) - Method in class net.maizegenetics.analysis.gbs.v2.BarcodeTrie
Add a collection of barcodes to the trie.
addAllBarcodesNoOverhang(barcodes) - Method in class net.maizegenetics.analysis.gbs.v2.BarcodeTrie
Add a collection of barcodes with OUT overhangs to the trie.
addAlleleProbability(alleleProbabilityBuilder) - Method in class net.maizegenetics.dna.snp.GenotypeTableBuilder
 
addAllUnique(cluster) - Method in class net.maizegenetics.analysis.clustering.HaplotypeCluster
Adds Haplotypes from cluster that are not already contained in this cluster
addAnno(key, value) - Method in class net.maizegenetics.dna.map.GeneralPosition.Builder
Add non-standard annotation, boolean and String are converted to String with toString, Number are stored as Number
addAnno(keyValue) - Method in class net.maizegenetics.dna.map.GeneralPosition.Builder
Add non-standard annotation with key-value separated by '='
addAnno(key, value) - Method in class net.maizegenetics.taxa.Taxon.Builder
Add non-standard annotation
addAnno(key, value) - Method in class net.maizegenetics.taxa.Taxon.Builder
Add non-standard annotation
addAnnotation(key, value) - Method in class net.maizegenetics.dna.map.GenomeFeatureBuilder
 
addAnnotation(key, value) - Method in class net.maizegenetics.dna.snp.GenotypeTableBuilder
 
addAnnotation(key, value) - Method in class net.maizegenetics.dna.snp.GenotypeTableBuilder
 
addAnnotation(key, value) - Method in class net.maizegenetics.util.GeneralAnnotationStorage.Builder
 
addAnnotation(key, value) - Method in class net.maizegenetics.util.GeneralAnnotationStorage.Builder
 
addAnnotations(existing) - Method in class net.maizegenetics.util.GeneralAnnotationStorage.Builder
 
addBarcode(barcode) - Method in class net.maizegenetics.analysis.gbs.v2.BarcodeTrie
Adds a Barcode to the trie
addBarcodeNoOverhang(barcode) - Method in class net.maizegenetics.analysis.gbs.v2.BarcodeTrie
Adds a Barcode to the trie
addByteDepths(depth1, depth2) - Static method in class net.maizegenetics.dna.snp.score.AlleleDepthUtil
Returns the depth combined depths in byte format. Converts both to integers, adds, and reconverts back.
addChild(c) - Method in interface net.maizegenetics.taxa.tree.Node
add new child node
addChild(n) - Method in class net.maizegenetics.taxa.tree.SimpleNode
add new child node
addDataSet(theDataSet, defaultNode) - Method in class net.maizegenetics.tassel.DataTreePanel
 
addDataSet(theDataSet, defaultNode) - Method in class net.maizegenetics.tassel.TASSELMainFrame
 
addDatum(dataParent, theDatum) - Method in class net.maizegenetics.tassel.DataTreePanel
 
addDatum(theDatum) - Method in class net.maizegenetics.tassel.DataTreePanel
 
AddDistanceMatrixPlugin - Class in net.maizegenetics.analysis.distance
 
AddDistanceMatrixPlugin(parentFrame, isInteractive) - Constructor for class net.maizegenetics.analysis.distance.AddDistanceMatrixPlugin
 
addDistribution(label, theSP, poolMinor) - Method in class net.maizegenetics.analysis.popgen.PolymorphismDistribution
 
AddDomPermutationTestSpliterator - Class in net.maizegenetics.analysis.modelfitter
This class calculates p-values for a test of a single SNP with a list of permuted data sets. myPermutedData is a list of double[] arrays, each of which is a data set to be tested. This class extends a parent class which tests an additive only model to test an additive + dominance model instead.
AddDomPermutationTestSpliterator(permutedData, siteList, baseModel) - Constructor for class net.maizegenetics.analysis.modelfitter.AddDomPermutationTestSpliterator
 
addDosage(dosageBuilder) - Method in class net.maizegenetics.dna.snp.GenotypeTableBuilder
 
addEdge(u, v) - Method in class net.maizegenetics.util.GraphBuilder
Adds an edge to the graph with weight 1.
addEdge(u, v, wt) - Method in class net.maizegenetics.util.GraphBuilder
Adds an edge to the graph
addEffect(me) - Method in class net.maizegenetics.stats.linearmodels.LinearModelForStepwiseRegression
 
addElements(rowElements) - Method in class net.maizegenetics.util.TableReportBuilder
 
addEndelmanDistance(matrices, listener) - Static method in class net.maizegenetics.analysis.distance.EndelmanDistanceMatrix
 
addFactors(factors) - Method in class net.maizegenetics.analysis.association.MLMPlugin
 
addFactors(names) - Method in class net.maizegenetics.analysis.association.MLMPlugin
 
addFactors(factors) - Method in class net.maizegenetics.analysis.association.WeightedMLMPlugin
 
addFactors(names) - Method in class net.maizegenetics.analysis.association.WeightedMLMPlugin
 
addFeature(feature) - Method in class net.maizegenetics.dna.map.GenomeFeatureMapBuilder
Adds a GenomeFeature to the map. If the feature's unique ID has already been loaded, it throws an UnsupportedOperationException
addFeatureToRangemap(masterMap, feature) - Static method in class net.maizegenetics.dna.map.GenomeFeatureMapBuilder
Add a GenomeFeature to a RangeMap, stacking it on top of any existing features instead of overwriting them (how RangeMap behaves natively)
addForkFlagsIfNeeded(args) - Static method in class net.maizegenetics.pipeline.TasselPipeline
 
addFromFlatFile(filename) - Method in class net.maizegenetics.dna.map.GenomeFeatureMapBuilder
Load in data from a flat, tab-delimited text file. The first row should be a header identifying what attribute is in each column, and each subsequent row should correspond to a single feature. Columns that don't apply to a given feature should use "NA" or left empty. Common attributes (columns) are listed below. Although only the "id" attribute is required, a feature is pretty useless without some sort of positional information (chromosome, start/stop, etc.). "id": Unique identifier for this feature. Repeated identifiers throw an error (Also accepts "name".) Required. "chrom": Which chromosome it occurs on (Also accepts "chr" or "chromosome") "start": Start position on the chromosome "stop": Stop position on the chromosome (Also accepts "end") "position": Postion on chromosome (in place of "start" and "stop" for features that are a single nucleotide) "parent_id": What other named feature this descends from (eg, Gene -> Transcript -> Exon). If none given, this will default to the chromosome (or the genome if chromosome isn't supplied) This method does not build the map, so you can string multiple calls together (if, for example, you have different annotations in different files).
addFromGffFile(filename) - Method in class net.maizegenetics.dna.map.GenomeFeatureMapBuilder
Load in data from a GFF (Gene Feature Format) file. Since GFF files have only a loose standard for the 9th column, this involves several ad-hoc heuristics about what things to look for. As such, it is not the preferred way to read in annotations. (That is JSON or tab-delimited format.) This method does not build the map, so you can string multiple calls together (if, for example, you have different annotations in different files)
addFromJsonFile(filename) - Method in class net.maizegenetics.dna.map.GenomeFeatureMapBuilder
Load in data from a JSON-formatted file. JSON format is defined at http://www.json.org/, and consists of structured key-value pairs. For genome features, the key is the name of an attribute and the value is (obviously) its value. (For example: "chromosome":1). Note that if you have more than one feature per file (the normal case), all but the last closing brace ('}') should be followed by a comma, and the whole group should be within square braces ('[...]' That is, the first character of the file should be '[' and the last should be ']'). This makes it a properly-formatted JSON array. Common attributes (keys) are listed below. Although only the "id" attribute is required, a feature is pretty useless without some sort of positional information (chromosome, start/stop, etc.). "id": Unique identifier for this feature. Repeated identifiers throw an error. (Also accepts "name".) Required. "chrom": Which chromosome it occurs on (Also accepts "chr" or "chromosome") "start": Start position on the chromosome "stop": Stop position on the chromosome (Also accepts "end") "position": Postion on chromosome (in place of "start" and "stop" for features that are a single nucleotide) "parent_id": What other named feature this descends from (eg, Gene -> Transcript -> Exon). If none given, this will default to the chromosome (or the genome if chromosome isn't supplied) This method does not build the map, so you can string multiple calls together (if, for example, you have different annotations in different files).
addGCTADistance(matrices, listener) - Static method in class net.maizegenetics.analysis.distance.GCTADistanceMatrix
 
addGzSuffixIfNeeded(filename, suffix) - Static method in class net.maizegenetics.util.Utils
 
addHaplotypesToReport(clusters, pos) - Method in class net.maizegenetics.analysis.imputation.BiparentalHaplotypeFinder
 
addIncludedTraits(traitsToInclude) - Method in class net.maizegenetics.analysis.filter.FilterTraitsPlugin
 
additionTaxaFile() - Method in class net.maizegenetics.analysis.gbs.ModifyTBTHDF5Plugin
 
additionTaxaFile(value) - Method in class net.maizegenetics.analysis.gbs.ModifyTBTHDF5Plugin
 
AdditiveModelForwardRegression - Class in net.maizegenetics.analysis.modelfitter
 
AdditiveModelForwardRegression(data, maxThreads) - Constructor for class net.maizegenetics.analysis.modelfitter.AdditiveModelForwardRegression
 
AdditiveModelForwardRegression(serialFilename, pheno, maxThreads) - Constructor for class net.maizegenetics.analysis.modelfitter.AdditiveModelForwardRegression
 
AdditiveModelForwardRegression(data) - Constructor for class net.maizegenetics.analysis.modelfitter.AdditiveModelForwardRegression
 
AdditiveModelForwardRegression(serialFilename, pheno) - Constructor for class net.maizegenetics.analysis.modelfitter.AdditiveModelForwardRegression
 
additiveOnlyModel() - Method in class net.maizegenetics.analysis.association.EqtlAssociationPlugin
Should an additive only model be fit? If true, an additive model will be fit. If false, an additive + dominance model will be fit. Default = false.
additiveOnlyModel(value) - Method in class net.maizegenetics.analysis.association.EqtlAssociationPlugin
Set Additive Only Model. Should an additive only model be fit? If true, an additive model will be fit. If false, an additive + dominance model will be fit. Default = false.
AdditiveResidualForwardRegression - Class in net.maizegenetics.analysis.modelfitter
 
AdditiveResidualForwardRegression(data) - Constructor for class net.maizegenetics.analysis.modelfitter.AdditiveResidualForwardRegression
 
AdditiveSite - Interface in net.maizegenetics.analysis.modelfitter
 
AdditiveSite.CRITERION - Enum in net.maizegenetics.analysis.modelfitter
 
AdditiveSiteStorePlugin - Class in net.maizegenetics.analysis.modelfitter
 
AdditiveSiteStorePlugin() - Constructor for class net.maizegenetics.analysis.modelfitter.AdditiveSiteStorePlugin
 
AdditiveSiteStorePlugin(parentFrame, isInteractive) - Constructor for class net.maizegenetics.analysis.modelfitter.AdditiveSiteStorePlugin
 
addListener(listener) - Method in class net.maizegenetics.plugindef.AbstractPlugin
Adds listener to this plugin.
addListener(listener) - Method in interface net.maizegenetics.plugindef.Plugin
Adds listener to this plugin.
addMappingApproach(name) - Method in interface net.maizegenetics.dna.tag.RepGenDataWriter
Adds a mapping approach strategy to the mappingApproach table
addMappingApproach(name) - Method in class net.maizegenetics.dna.tag.RepGenSQLite
 
addMonetdbVariantData(ref, altsOrig, mline, isVCF, tabPos) - Static method in class net.maizegenetics.analysis.gobii.GOBII_IFLUtils
 
addNode(n) - Method in class net.maizegenetics.util.GraphBuilder
Adds a single node
addOrMerge(taxon) - Method in class net.maizegenetics.taxa.TaxaListBuilder
 
addOrReplaceFeature(feature) - Method in class net.maizegenetics.dna.map.GenomeFeatureMapBuilder
Adds a GenomeFeature to the map, regardless of whether or not it's already been added. This method throws no warnings if you'll overwrite existing data, so use it with caution.
addPipelineSegment(plugins) - Method in class net.maizegenetics.progress.ProgressPanel
 
addPlugin(plugin, description) - Method in class net.maizegenetics.pipeline.TasselPipelineStepsDialog
 
addPlugin(plugin) - Method in class net.maizegenetics.progress.ProgressPanel
 
addPlugin(plugin, cancelButton, cancelPlugin) - Method in class net.maizegenetics.progress.ProgressPanel
 
AddPlusDomModelEffect - Class in net.maizegenetics.analysis.modelfitter
A ModelEffect that takes an AdditiveSite as an argument and uses the additiveCovariate from that object to compute a covariate representing dominance. In general, the AdditiveSite will be supplied as the id, although that is not a requirement. The dominance values are calculated as 1 - abs(x - 1) where x is the addivitive value. The values of x are expected to be 0, 1, 2, where 0 and 1 are homozygous genotypes and 1 is the het.
AddPlusDomModelEffect(id, addSite) - Constructor for class net.maizegenetics.analysis.modelfitter.AddPlusDomModelEffect
 
AddPlusDomModelEffect(id, additiveCovariate) - Constructor for class net.maizegenetics.analysis.modelfitter.AddPlusDomModelEffect
 
addPosToTagMapPlugin() - Method in class net.maizegenetics.analysis.gbs.pana.PanAUsageExample
 
addReadCount(tag, length, count) - Method in class net.maizegenetics.dna.tag.TagCountMutable
 
addReadCount(tag, length, count) - Method in class net.maizegenetics.dna.tag.UTagCountMutable
 
addReadCounts(tagCountsToAdd) - Method in class net.maizegenetics.dna.tag.TagCountMutable
This adds a series of TagCounts to the list, preserving the count that each read has. Designed to make it easy to combine TagCounts from multiple barcodes, lanes or flowcells.
addReadCounts(tagsToAdd, defaultCount) - Method in class net.maizegenetics.dna.tag.TagCountMutable
 
addReadsToTagTaxon(tagIndex, taxaIndex, addValue) - Method in class net.maizegenetics.dna.tag.AbstractTagsByTaxa
 
addReadsToTagTaxon(tagIndex, taxaIndex, addValue) - Method in interface net.maizegenetics.dna.tag.TagsByTaxa
Method for incrementing the read depth for the specified tag and taxon.
AddReferenceAlleleToHDF5Plugin - Class in net.maizegenetics.analysis.data
 
AddReferenceAlleleToHDF5Plugin() - Constructor for class net.maizegenetics.analysis.data.AddReferenceAlleleToHDF5Plugin
 
AddReferenceAlleleToHDF5Plugin(parentFrame, isInteractive) - Constructor for class net.maizegenetics.analysis.data.AddReferenceAlleleToHDF5Plugin
 
addReferenceGenome(refGenome) - Method in interface net.maizegenetics.dna.tag.RepGenDataWriter
Adds a mapping approach strategy to the mappingApproach table
addReferenceGenome(name) - Method in class net.maizegenetics.dna.tag.RepGenSQLite
 
addReferenceProbability(referenceProbabilityBuilder) - Method in class net.maizegenetics.dna.snp.GenotypeTableBuilder
 
AddReferenceToGenotypePlugin - Class in net.maizegenetics.analysis.data
 
AddReferenceToGenotypePlugin(parentFrame, isInteractive) - Constructor for class net.maizegenetics.analysis.data.AddReferenceToGenotypePlugin
 
addRefTag(refTag, nLongsPerTag, nullTag) - Method in class net.maizegenetics.dna.map.TagLocus
 
addSibling(data, c) - Method in class net.maizegenetics.analysis.gbs.neobio.Trie
Adds a sibling to this node. The new node will be implicitly instantiated with the data argument, and the edge from this node to the new node will be labelled by the character argument. If this node already have a sibling with this character, an exception is raised. Otherwise, the new node is created and returned.
addSite(pos, genos) - Method in class net.maizegenetics.dna.snp.GenotypeTableBuilder
 
addSiteBlock(startSite, blkPositionList, blockGenotypes, blockDepths) - Method in class net.maizegenetics.dna.snp.GenotypeTableBuilder
Add TasselHDF5 Block of positions (generally 1<<16 positions). @note This is synchronized, which certainly slows things down but it is needed to prevent the same taxa dataset from being accessed at once. This can probably be rethought with parallelization at this stage across datasets
addSmallValue() - Method in class net.maizegenetics.analysis.numericaltransform.AvgPhenotypeByTaxaPlugin
Add Small Value
addSmallValue(value) - Method in class net.maizegenetics.analysis.numericaltransform.AvgPhenotypeByTaxaPlugin
Set Add Small Value. Add Small Value
addSmallValue() - Method in class net.maizegenetics.analysis.numericaltransform.BoxCoxTransformationPlugin
Add Small Value
addSmallValue(value) - Method in class net.maizegenetics.analysis.numericaltransform.BoxCoxTransformationPlugin
Set Add Small Value. Add Small Value
addSuffixIfNeeded(filename, suffix) - Static method in class net.maizegenetics.util.Utils
Adds suffix (i.e. .txt) to end of filename if it's not already there.
addSuffixIfNeeded(filename, defaultSuffix, possible) - Static method in class net.maizegenetics.util.Utils
Adds default suffix if not already one of the possible suffixes.
addTag(tagTOPMIndex, theTOPM, theTBT, includeRefGenome, fuzzyStartPositions) - Method in class net.maizegenetics.dna.map.TagLocus
 
addTaxa(addTaxaNames) - Method in interface net.maizegenetics.dna.tag.TagsByTaxa
Add taxa to the TagsByTaxa matrix, they will all be set to distribution value of zero.
addTaxa(addTaxaNames) - Method in class net.maizegenetics.dna.tag.TagsByTaxaByte
 
addTaxa(addTaxaNames) - Method in class net.maizegenetics.dna.tag.TagsByTaxaByteFileMap
 
addTaxa(addTaxaNames) - Method in class net.maizegenetics.dna.tag.TagsByTaxaByteFileMapSeq
 
addTaxa(addTaxaNames) - Method in class net.maizegenetics.dna.tag.TagsByTaxaByteHDF5TagGroups
 
addTaxa(addTaxaNames) - Method in class net.maizegenetics.dna.tag.TagsByTaxaByteHDF5TaxaGroups
 
addTaxa(addTaxaNames) - Method in class net.maizegenetics.dna.tag.TagsByTaxaShort
 
addTaxon(taxon, values) - Method in class net.maizegenetics.dna.snp.byte2d.Byte2DBuilder
Add taxon and set values for all sites for that taxon.
addTaxon(taxon, genos) - Method in class net.maizegenetics.dna.snp.GenotypeTableBuilder
 
addTaxon(taxon, genos, depth) - Method in class net.maizegenetics.dna.snp.GenotypeTableBuilder
 
addTaxon(taxon, depths, genos) - Method in class net.maizegenetics.dna.snp.GenotypeTableBuilder
 
addTaxon(taxon, breakPoints) - Method in class net.maizegenetics.dna.snp.ProjectionBuilder
 
addTaxon(taxon, breakPoints) - Method in class net.maizegenetics.dna.snp.ProjectionBuilder
 
addTaxon(taxon, breakPoints) - Method in class net.maizegenetics.dna.snp.ProjectionBuilder
 
addTaxon(taxon, values, type) - Method in class net.maizegenetics.dna.snp.score.AlleleDepthBuilder
 
addTaxon(taxon, values) - Method in class net.maizegenetics.dna.snp.score.AlleleDepthBuilder
 
addTaxon(taxon, values, type) - Method in class net.maizegenetics.dna.snp.score.AlleleProbabilityBuilder
 
addTaxon(taxon, values, type) - Method in class net.maizegenetics.dna.snp.score.AlleleProbabilityBuilder
 
addTaxon(taxon, values) - Method in class net.maizegenetics.dna.snp.score.DosageBuilder
 
addTaxon(taxon, depths) - Method in class net.maizegenetics.dna.snp.score.HDF5AlleleDepthBuilder
Add taxon and set values for all sites and alleles for that taxon. First dimension of depths is number of alleles (6 for Nucleotide) and second dimension is sites.
addTaxon(taxon, depths) - Method in class net.maizegenetics.dna.snp.score.HDF5AlleleDepthBuilder
Add taxon and set values for all sites and alleles for that taxon. First dimension of depths is number of alleles (6 for Nucleotide) and second dimension is sites.
addTaxon(taxon, values) - Method in class net.maizegenetics.dna.snp.score.ReferenceProbabilityBuilder
 
addTaxon(taxonName, values) - Method in class net.maizegenetics.dna.tag.TagsByTaxaByteHDF5TaxaGroups
 
addTaxon(taxonName) - Method in class net.maizegenetics.dna.tag.TagsByTaxaByteHDF5TaxaGroups
 
addTaxon(taxon) - Method in class net.maizegenetics.taxa.distance.DistanceMatrixBuilder
 
addTaxon(h5w, taxon) - Static method in class net.maizegenetics.util.HDF5Utils
Adds a taxon to the taxon module
addToAnovaReport(intervalList) - Method in class net.maizegenetics.analysis.modelfitter.StepwiseAdditiveModelFitter
 
addToMarkerEffectReport(CI) - Method in class net.maizegenetics.analysis.modelfitter.StepwiseAddDomModelFitter
 
addToMarkerEffectReport(CI) - Method in class net.maizegenetics.analysis.modelfitter.StepwiseAdditiveModelFitter
 
addToReadCountForTaxa(readIndex, taxaIndex, addValue) - Method in class net.maizegenetics.dna.tag.ReadsByTaxa
 
addToStepsReport(siteNumber, theModel, action, siteSSdf, errorSSdf, F, p) - Method in class net.maizegenetics.analysis.modelfitter.StepwiseAdditiveModelFitter
 
addTypeChangeMap(typeMap) - Method in class net.maizegenetics.analysis.filter.FilterTraitsPlugin
 
addVariant(site, p, iteration, step) - Method in class net.maizegenetics.analysis.modelfitter.AbstractForwardRegression
 
addVariant(tagIndex, offset, base) - Method in class net.maizegenetics.dna.map.TagsOnPhysicalMap
 
addVariant(tagIndex, offset, base) - Method in class net.maizegenetics.dna.map.TagsOnPhysicalMapV3
 
addVariant(tagIndex, offset, base) - Method in class net.maizegenetics.dna.map.TagsOnPhysMapHDF5
 
addVariant(tagIndex, offset, base) - Method in interface net.maizegenetics.dna.map.TOPMInterface
Adds Variant definition.
adjustCoordinates(cigarString, startCoordinate) - Static method in class net.maizegenetics.dna.tag.SAMUtils
Uses a CIGAR code and the start coordinate of a BWA alignment to find the corresponding end coordinate. Adjusts start coordinate if beginning of alignment was soft clipped.
adjustedProbability - Variable in class net.maizegenetics.analysis.imputation.TransitionProbability
 
adjustmentMatrix - Variable in class net.maizegenetics.analysis.association.CompressedDoubleMatrix
 
AdjustPhasingPlugin - Class in net.maizegenetics.analysis.data
 
AdjustPhasingPlugin(parentFrame, isInteractive) - Constructor for class net.maizegenetics.analysis.data.AdjustPhasingPlugin
 
adjustPosition(position) - Method in class net.maizegenetics.gui.AlignmentTableModel
 
adjustPositionToCenter() - Method in class net.maizegenetics.gui.AlignmentTableModel
 
adjustPositionToSite(site) - Method in class net.maizegenetics.gui.AlignmentTableModel
 
advanceToTagDist(tag) - Method in class net.maizegenetics.dna.tag.TagsByTaxaByteFileMapSeq
 
AGPMap - Class in net.maizegenetics.analysis.imputation
 
AGPMap() - Constructor for class net.maizegenetics.analysis.imputation.AGPMap
 
AGPMap(mapfile) - Constructor for class net.maizegenetics.analysis.imputation.AGPMap
 
AGPMap(mapfile, useAgpV2) - Constructor for class net.maizegenetics.analysis.imputation.AGPMap
 
aic(RSS, N, modelDf) - Static method in class net.maizegenetics.analysis.modelfitter.StepwiseAdditiveModelFitter
 
AIC(l, k) - Static method in class net.maizegenetics.stats.statistics.PenalizedLikelihood
Akaike (AIC) correction (Akaike 1974)
AICC(l, k, n) - Static method in class net.maizegenetics.stats.statistics.PenalizedLikelihood
Second-order Akaike (AICC) correction (Hurvich and Tsai 1989)
algorithmVariation() - Method in class net.maizegenetics.analysis.distance.KinshipPlugin
Algorithm Variation
algorithmVariation(value) - Method in class net.maizegenetics.analysis.distance.KinshipPlugin
Set Algorithm Variation. Algorithm Variation
alignment - Variable in class net.maizegenetics.analysis.gbs.neobio.PairwiseAlignmentAlgorithm
Stores the product of the last pairwise alignment performed. It contains a string representation of a highest scoring alignment between the two sequences and its score. It is set after a successful execution of the computePairwiseAlignment method that subclasses must implement. It is set to null if new sequences are loaded or a new scoring scheme is set.
ALIGNMENT_RETAIN_RARE_ALLELES - Static variable in class net.maizegenetics.prefs.TasselPrefs
 
ALIGNMENT_RETAIN_RARE_ALLELES_DEFAULT - Static variable in class net.maizegenetics.prefs.TasselPrefs
 
ALIGNMENT_TOP - Static variable in class net.maizegenetics.prefs.TasselPrefs
 
AlignmentBlock - Class in net.maizegenetics.analysis.gbs.neobio
This class is used by the class CrochemoreLandauZivUkelson algorithm to store the information of an alignment block. All fields are public (but final) in order to simplify the access to the data.
AlignmentBlock(factor1, factor2) - Constructor for class net.maizegenetics.analysis.gbs.neobio.AlignmentBlock
Creates a new root block. A root block does not have source_path and ancestor arrays. Moreover, its dist_column and output_border arrays are set to zero, and the direction array is set to contain an STOP_DIRECTION.
AlignmentBlock(factor1, factor2, size) - Constructor for class net.maizegenetics.analysis.gbs.neobio.AlignmentBlock
Creates a new alignment block, with all arrays created with the specified size.
AlignmentInfo - Class in net.maizegenetics.analysis.gbs.repgen
This class is used by RepGenAlignerPlugin to store alignment info to db table tagAlignments. It is also used when pulling alignments from the DB. The tag2chrom and tag2pos fields are used to determine if the tag2 of this alignment class is a reference tag. If tag2chrom is null and tag2pos = -1, the tag alignment info is a non-ref tag. If these fields are populated with good values, the tag2 alignment info is for a reference tag. The "alignmentPos" field indicates the position within tag2 where the tag1 alignment starts. This position is adjusted for any clipping of tag1 that occurred during alignment.
AlignmentInfo(tag2, chromosome, position, alignmentpos, ref_strand, ref_genome, score) - Constructor for class net.maizegenetics.analysis.gbs.repgen.AlignmentInfo
 
alignmentPos() - Method in class net.maizegenetics.analysis.gbs.repgen.AlignmentInfo
 
AlignmentTableCellRenderer - Class in net.maizegenetics.gui
 
AlignmentTableCellRenderer(model, alignment, masks) - Constructor for class net.maizegenetics.gui.AlignmentTableCellRenderer
 
AlignmentTableCellRenderer.RENDERING_TYPE - Enum in net.maizegenetics.gui
 
AlignmentTableModel - Class in net.maizegenetics.gui
 
AlignmentTableModel(alignment, horizontalPageSize) - Constructor for class net.maizegenetics.gui.AlignmentTableModel
 
AlignmentTableModel(alignment) - Constructor for class net.maizegenetics.gui.AlignmentTableModel
 
AlignmentTableModel.COLUMN_NAME_TYPE - Enum in net.maizegenetics.gui
 
alignmentWithBowtie2() - Method in class net.maizegenetics.analysis.gbs.pana.PanAUsageExample
 
allAnnotationKeys(baseTaxaList) - Static method in class net.maizegenetics.taxa.TaxaListIOUtils
Provides the set of all annotation key found in any of taxa
allData - Variable in class net.maizegenetics.analysis.association.AbstractFixedEffectLM
 
allele(aT, val) - Method in class net.maizegenetics.dna.map.GeneralPosition.Builder
Set allele annotation by Allele type (default=Alignment.UNKNOWN_ALLELE)
allele(alleleType, site) - Method in interface net.maizegenetics.dna.map.PositionList
Return the (haploid) reference allele at given site.
Allele - Interface in net.maizegenetics.dna.snp
Defines Allele present at a genomic Position
allele() - Method in interface net.maizegenetics.dna.snp.Allele
 
allele() - Method in class net.maizegenetics.dna.snp.SimpleAllele
 
ALLELE_CNT - Static variable in class net.maizegenetics.dna.snp.HapMapHDF5Constants
 
ALLELE_CNT - Static variable in class net.maizegenetics.util.Tassel5HDF5Constants
 
ALLELE_DEPTH_TYPES - Static variable in class net.maizegenetics.dna.snp.score.AlleleDepth
 
ALLELE_FREQ_ORD - Static variable in class net.maizegenetics.dna.snp.HapMapHDF5Constants
 
ALLELE_FREQ_ORD - Static variable in class net.maizegenetics.util.Tassel5HDF5Constants
 
ALLELE_PROBABILITY_TYPES - Static variable in class net.maizegenetics.dna.snp.score.AlleleProbability
 
ALLELE_STATES - Static variable in class net.maizegenetics.dna.snp.HapMapHDF5Constants
 
alleleA - Variable in class net.maizegenetics.analysis.imputation.PopulationData
 
alleleAsString() - Method in interface net.maizegenetics.dna.snp.Allele
 
alleleAsString() - Method in class net.maizegenetics.dna.snp.SimpleAllele
 
alleleC - Variable in class net.maizegenetics.analysis.imputation.PopulationData
 
alleleDefinitions() - Method in class net.maizegenetics.dna.snp.CombineGenotypeTable
 
alleleDefinitions(site) - Method in class net.maizegenetics.dna.snp.CombineGenotypeTable
 
alleleDefinitions() - Method in class net.maizegenetics.dna.snp.CoreGenotypeTable
 
alleleDefinitions(site) - Method in class net.maizegenetics.dna.snp.CoreGenotypeTable
 
alleleDefinitions() - Method in interface net.maizegenetics.dna.snp.genotypecall.GenotypeCallTable
Returns allele values as strings for all sites. The first dimension of the array indexes the sites. The second dimension indexes the allele values for given site. The indices for the allele values are used as the codes to store data. These codes (indices) are returned by the genotype() methods. If only one array of allele values is returned, that is the encoding for all sites.
alleleDefinitions(site) - Method in interface net.maizegenetics.dna.snp.genotypecall.GenotypeCallTable
Same as getAlleleEncodings() for only one site.
alleleDefinitions() - Method in interface net.maizegenetics.dna.snp.GenotypeTable
Returns allele values as strings for all sites. The first dimension of the array indexes the sites. The second dimension indexes the allele values for given site. The indices for the allele values are used as the codes to store data. These codes (indices) are returned by the genotype() methods. If only one array of allele values is returned, that is the encoding for all sites.
alleleDefinitions(site) - Method in interface net.maizegenetics.dna.snp.GenotypeTable
Same as alleleDefinitions() for only one site.
alleleDefinitions() - Method in class net.maizegenetics.dna.snp.MergedGenotypeTable
 
alleleDefinitions(site) - Method in class net.maizegenetics.dna.snp.MergedGenotypeTable
 
alleleDefinitions() - Method in class net.maizegenetics.dna.snp.TOPMGenotypeTable
 
alleleDefinitions(site) - Method in class net.maizegenetics.dna.snp.TOPMGenotypeTable
 
AlleleDepth - Class in net.maizegenetics.dna.snp.score
 
AlleleDepthBuilder - Class in net.maizegenetics.dna.snp.score
 
AlleleDepthBuilder(numSites) - Constructor for class net.maizegenetics.dna.snp.score.AlleleDepthBuilder
 
alleleDepths() - Method in class net.maizegenetics.analysis.phg.ParseGVCF.GVCFLine
 
AlleleDepthUtil - Class in net.maizegenetics.dna.snp.score
Depth compression utility. Depths are scored in byte (256 states). 0 to 127 are used for exact depth values. -128 to -1 are used for log approximations (1.0746^(-x)). This permits depths upto 10,482 to be stored with exact precision for low values, and <3% error for high depths.
alleleEncodings(alleleEncodings) - Method in class net.maizegenetics.dna.snp.genotypecall.GenotypeCallTableBuilder
 
alleleForAllSites(alleleType) - Method in interface net.maizegenetics.dna.map.PositionList
Returns sequence alleles. One haploid allele for each site.
AlleleFreqCache - Class in net.maizegenetics.dna.snp.genotypecall
Cache for allele frequency statistics. Allele frequency can be expensive to recalculate at large scale, so these class efficiently loops through blocks of sites and caches the statistics on them.
AlleleFreqCache(genotype, maxNumAlleles) - Constructor for class net.maizegenetics.dna.snp.genotypecall.AlleleFreqCache
 
alleleFrequencyFileter(rbt, minBorderMaf, maxBorderMaf) - Method in class net.maizegenetics.analysis.gbs.Clusters
 
allelePresenceForAllSites(taxon) - Method in interface net.maizegenetics.dna.snp.bit.BitStorage
Returns sequence of true/false values indicating whether taxon at each site matches a specific allele.
allelePresenceForAllSites(taxon) - Method in class net.maizegenetics.dna.snp.bit.DynamicBitStorage
 
allelePresenceForAllSites(taxon, allele) - Method in class net.maizegenetics.dna.snp.CombineGenotypeTable
 
allelePresenceForAllSites(taxon, allele) - Method in class net.maizegenetics.dna.snp.CoreGenotypeTable
 
allelePresenceForAllSites(taxon, allele) - Method in interface net.maizegenetics.dna.snp.GenotypeTable
Returns sequence of true/false values indicating whether taxon at each site matches a specific allele (based on frequency). Allele number of value 0 would be the major allele. Allele number of value 1 would be the minor allele. Allele number of value 2 would be the third most frequent allele value and so on.
allelePresenceForAllSites(taxon, allele) - Method in class net.maizegenetics.dna.snp.MergedGenotypeTable
 
allelePresenceForAllSites(taxon, allele) - Method in class net.maizegenetics.dna.snp.TOPMGenotypeTable
 
allelePresenceForAllTaxa(site) - Method in interface net.maizegenetics.dna.snp.bit.BitStorage
Returns sequence of true/false values indicating whether site at each taxon matches a specific allele.
allelePresenceForAllTaxa(site) - Method in class net.maizegenetics.dna.snp.bit.DynamicBitStorage
 
allelePresenceForAllTaxa(site, allele) - Method in class net.maizegenetics.dna.snp.CombineGenotypeTable
 
allelePresenceForAllTaxa(site, allele) - Method in class net.maizegenetics.dna.snp.CoreGenotypeTable
 
allelePresenceForAllTaxa(site, allele) - Method in interface net.maizegenetics.dna.snp.GenotypeTable
Returns sequence of true/false values indicating whether site at each taxon matches a specific allele.
allelePresenceForAllTaxa(site, allele) - Method in class net.maizegenetics.dna.snp.MergedGenotypeTable
 
allelePresenceForAllTaxa(site, allele) - Method in class net.maizegenetics.dna.snp.TOPMGenotypeTable
 
allelePresenceForSitesBlock(taxon, startBlock, endBlock) - Method in interface net.maizegenetics.dna.snp.bit.BitStorage
Returns sequence of true/false values indicating whether taxon at sites (in given blocks, 64 sites per block including start block but excluding end block) matches a specific allele.
allelePresenceForSitesBlock(taxon, startBlock, endBlock) - Method in class net.maizegenetics.dna.snp.bit.DynamicBitStorage
 
allelePresenceForSitesBlock(taxon, allele, startBlock, endBlock) - Method in class net.maizegenetics.dna.snp.CombineGenotypeTable
 
allelePresenceForSitesBlock(taxon, allele, startBlock, endBlock) - Method in class net.maizegenetics.dna.snp.CoreGenotypeTable
 
allelePresenceForSitesBlock(taxon, allele, startBlock, endBlock) - Method in interface net.maizegenetics.dna.snp.GenotypeTable
Returns sequence of true/false values indicating whether taxon at sites (in given blocks, 64 sites per block including start block but excluding end block) matches a specific allele.
allelePresenceForSitesBlock(taxon, allele, startBlock, endBlock) - Method in class net.maizegenetics.dna.snp.MergedGenotypeTable
 
allelePresenceForSitesBlock(taxon, allele, startBlock, endBlock) - Method in class net.maizegenetics.dna.snp.TOPMGenotypeTable
 
alleleProbability() - Method in class net.maizegenetics.dna.snp.CombineGenotypeTable
 
alleleProbability(taxon, site, type) - Method in class net.maizegenetics.dna.snp.CombineGenotypeTable
 
alleleProbability() - Method in class net.maizegenetics.dna.snp.CoreGenotypeTable
 
alleleProbability(taxon, site, type) - Method in class net.maizegenetics.dna.snp.CoreGenotypeTable
 
alleleProbability() - Method in interface net.maizegenetics.dna.snp.GenotypeTable
Returns allele probability object (null if not present)
alleleProbability(taxon, site, type) - Method in interface net.maizegenetics.dna.snp.GenotypeTable
 
alleleProbability() - Method in class net.maizegenetics.dna.snp.MergedGenotypeTable
 
alleleProbability(taxon, site, type) - Method in class net.maizegenetics.dna.snp.MergedGenotypeTable
 
AlleleProbability - Class in net.maizegenetics.dna.snp.score
 
AlleleProbability(numTaxa, numSites) - Constructor for class net.maizegenetics.dna.snp.score.AlleleProbability
 
alleleProbability() - Method in class net.maizegenetics.dna.snp.TOPMGenotypeTable
 
alleleProbability(taxon, site, type) - Method in class net.maizegenetics.dna.snp.TOPMGenotypeTable
 
AlleleProbabilityBuilder - Class in net.maizegenetics.dna.snp.score
 
AlleleProbabilityFELM - Class in net.maizegenetics.analysis.association
 
AlleleProbabilityFELM(data, parentPlugin) - Constructor for class net.maizegenetics.analysis.association.AlleleProbabilityFELM
 
alleleProbsOfType(type, site) - Method in class net.maizegenetics.phenotype.GenotypePhenotype
 
alleleReport() - Method in class net.maizegenetics.analysis.association.AbstractFixedEffectLM
 
alleleReport() - Method in interface net.maizegenetics.analysis.association.FixedEffectLM
 
alleleReportBuilder - Variable in class net.maizegenetics.analysis.association.AbstractFixedEffectLM
 
alleleReportColumnNames() - Method in class net.maizegenetics.analysis.association.AbstractFixedEffectLM
 
alleleReportColumnNames() - Method in class net.maizegenetics.analysis.association.ReferenceProbabilityFELM
 
alleleReportFilename - Variable in class net.maizegenetics.analysis.association.AbstractFixedEffectLM
 
alleleReportFilename() - Method in class net.maizegenetics.analysis.association.FixedEffectLMPlugin
The name of the file to which these results will be saved.
alleleReportFilename(value) - Method in class net.maizegenetics.analysis.association.FixedEffectLMPlugin
Set Genotype Effect File. The name of the file to which these results will be saved.
alleleReportFilepath(savefile) - Method in class net.maizegenetics.analysis.association.AbstractFixedEffectLM
 
alleleReportFilepath(savefile) - Method in interface net.maizegenetics.analysis.association.FixedEffectLM
 
alleles - Variable in class net.maizegenetics.analysis.modelfitter.SNP
 
alleles(alleleType, startSite, endSite) - Method in interface net.maizegenetics.dna.map.PositionList
Returns reference sequence alleles in specified range. End site not included. One haploid allele for each site.
alleles(site) - Method in class net.maizegenetics.dna.snp.CombineGenotypeTable
 
alleles(site) - Method in class net.maizegenetics.dna.snp.CoreGenotypeTable
 
alleles(site) - Method in interface net.maizegenetics.dna.snp.genotypecall.GenotypeCallTable
Returns all alleles at given site in order of frequency. Gap is included as state. Heterozygous count one for each allele value. Homozygous counts two for the allele value.
alleles(site) - Method in interface net.maizegenetics.dna.snp.GenotypeTable
Returns all alleles at given site in order of frequency. Gap is included as state. Heterozygous count one for each allele value. Homozygous counts two for the allele value.
ALLELES - Static variable in class net.maizegenetics.dna.snp.HapMapHDF5Constants
 
alleles(site) - Method in class net.maizegenetics.dna.snp.MergedGenotypeTable
 
alleles(site) - Method in class net.maizegenetics.dna.snp.TOPMGenotypeTable
 
allelesBySortType(scope, site) - Method in class net.maizegenetics.dna.snp.CombineGenotypeTable
 
allelesBySortType(scope, site) - Method in class net.maizegenetics.dna.snp.CoreGenotypeTable
 
allelesBySortType(scope, site) - Method in interface net.maizegenetics.dna.snp.GenotypeTable
Returns all alleles at given site in order defined by scope.
allelesBySortType(scope, site) - Method in class net.maizegenetics.dna.snp.MergedGenotypeTable
 
allelesBySortType(scope, site) - Method in class net.maizegenetics.dna.snp.TOPMGenotypeTable
 
allelesSortedByFrequency(site) - Method in class net.maizegenetics.dna.snp.CombineGenotypeTable
 
allelesSortedByFrequency(site) - Method in class net.maizegenetics.dna.snp.CoreGenotypeTable
 
allelesSortedByFrequency(site) - Method in interface net.maizegenetics.dna.snp.genotypecall.GenotypeCallTable
Return sorted list of alleles from highest frequency to lowest at given site in alignment. Resulting double dimension array holds alleles (bytes) in result[0]. And the counts are in result[1]. Counts haploid values twice and diploid values once. Higher ploids are not supported.
allelesSortedByFrequency(site) - Method in interface net.maizegenetics.dna.snp.GenotypeTable
Return sorted list of alleles from highest frequency to lowest at given site in genotype table. Resulting double dimension array holds alleles (bytes) in result[0]. And the counts are in result[1]. Counts haploid values twice and diploid values once. Higher ploids are not supported.
allelesSortedByFrequency(site) - Method in class net.maizegenetics.dna.snp.MergedGenotypeTable
 
allelesSortedByFrequency(site) - Method in class net.maizegenetics.dna.snp.TOPMGenotypeTable
 
allelesSortedByFrequencyAndCountsNucleotide(index, data) - Static method in class net.maizegenetics.dna.snp.genotypecall.AlleleFreqCache
 
allelesSortedByFrequencyNucleotide(data) - Static method in class net.maizegenetics.dna.snp.genotypecall.AlleleFreqCache
 
allIntValues() - Method in class net.maizegenetics.phenotype.CategoricalAttribute
 
allLabels() - Method in class net.maizegenetics.phenotype.CategoricalAttribute
 
allOfTheResidualPhenotypes - Variable in class net.maizegenetics.analysis.modelfitter.StepwiseAdditiveModelFitter
 
allTaxa() - Method in class net.maizegenetics.phenotype.TaxaAttribute
 
allTaxaAsList() - Method in class net.maizegenetics.phenotype.TaxaAttribute
 
allValues() - Method in class net.maizegenetics.phenotype.CategoricalAttribute
 
allValues() - Method in class net.maizegenetics.phenotype.NumericAttribute
 
allValues() - Method in interface net.maizegenetics.phenotype.PhenotypeAttribute
The return value will typically be a primitive array whose type depends on the sub class
allValues() - Method in class net.maizegenetics.phenotype.TaxaAttribute
 
alpha() - Method in class net.maizegenetics.analysis.imputation.BackwardForwardAlgorithm
 
alpha() - Method in class net.maizegenetics.analysis.imputation.BackwardForwardVariableStateNumber
 
altAllele - Variable in class net.maizegenetics.plugindef.GenerateRCode.PositionVectors
 
alternateAllele(site) - Method in class net.maizegenetics.dna.snp.CombineGenotypeTable
 
alternateAllele(site) - Method in class net.maizegenetics.dna.snp.CoreGenotypeTable
 
alternateAllele(site) - Method in interface net.maizegenetics.dna.snp.GenotypeTable
Return (haploid) alternate allele value at given site.
alternateAllele(site) - Method in class net.maizegenetics.dna.snp.MergedGenotypeTable
 
alternateAllele(site) - Method in class net.maizegenetics.dna.snp.TOPMGenotypeTable
 
alternates() - Method in class net.maizegenetics.analysis.phg.ParseGVCF.GVCFLine
 
AltitudeKey - Static variable in class net.maizegenetics.taxa.Taxon
Standard key for altitude the taxon was sampled
aMatrix() - Method in class net.maizegenetics.analysis.distance.HMatrixPlugin
Pedigree Matrix
aMatrix(value) - Method in class net.maizegenetics.analysis.distance.HMatrixPlugin
Set Pedigree Matrix. Pedigree Matrix
AMatrixPlugin - Class in net.maizegenetics.analysis.distance
 
AMatrixPlugin(parentFrame, isInteractive) - Constructor for class net.maizegenetics.analysis.distance.AMatrixPlugin
 
analyzeByColumn - Variable in class net.maizegenetics.analysis.association.MLMPlugin
 
analyzeByColumn - Variable in class net.maizegenetics.analysis.association.WeightedMLMPlugin
 
analyzeSite() - Method in class net.maizegenetics.analysis.association.AbstractFixedEffectLM
 
analyzeSite() - Method in class net.maizegenetics.analysis.association.AlleleProbabilityFELM
 
analyzeSite() - Method in class net.maizegenetics.analysis.association.DiscreteSitesFELM
 
analyzeSite() - Method in class net.maizegenetics.analysis.association.ReferenceProbabilityFELM
 
ANC_ALLELES - Static variable in class net.maizegenetics.util.Tassel5HDF5Constants
 
ancestor - Variable in class net.maizegenetics.analysis.gbs.neobio.AlignmentBlock
An array of pointers to prefix blocks of this block.
ancestor - Variable in class net.maizegenetics.analysis.gbs.neobio.Factor
A pointer to this factor's ancestor, which represents a prefix of this factor's text.
and(other) - Method in interface net.maizegenetics.util.BitSet
AND
and(other) - Method in class net.maizegenetics.util.OpenBitSet
see intersect
and(other) - Method in class net.maizegenetics.util.UnmodifiableBitSet
 
andNot(other) - Method in interface net.maizegenetics.util.BitSet
see andNot
andNot(other) - Method in class net.maizegenetics.util.OpenBitSet
see andNot
andNot(other) - Method in class net.maizegenetics.util.UnmodifiableBitSet
 
andNotCount(a, b) - Static method in class net.maizegenetics.util.OpenBitSet
Returns the popcount or cardinality of "a and not b" or "intersection(a, not(b))". Neither set is modified.
annotateBestMappingImport(indexDirS, predictDirS, priorityAligner) - Method in class net.maizegenetics.analysis.gbs.AnnotateTOPM
Import prediction result to TOPM, contain hard coding on map index
annotateBestMappingPredict(modelFileS, tagCountFileS, inputDirS, indexDirS, outputDirS) - Method in class net.maizegenetics.analysis.gbs.AnnotateTOPM
Command line version to predict if hypotheses are correct using weka RandomForest. Make sure weka is installed (in ClassPath) in local machine Contain hard coding
annotateHDF5File(writer) - Static method in class net.maizegenetics.dna.snp.GenotypeTableBuilder
Annotates the HDF5 Genotype file with allele frequency information. Can only be called on unlocked HDF5 files. Currently, placed in the GenotypeTableBuilder as it still above genotypes, taxa, and sites.
annotateHDF5FileWithRefAllele(writer, refAlleles) - Static method in class net.maizegenetics.dna.snp.GenotypeTableBuilder
Annotates the HDF5 Genotype file with the reference allele and reference genome version. Can only be called on unlocked HDF5 files.
AnnotateTOPM - Class in net.maizegenetics.analysis.gbs
Methods to annotate TOPM file, including adding mapping info from aligners, adding PE tag position and genetic position, model prediction for the best position
AnnotateTOPM(topm) - Constructor for class net.maizegenetics.analysis.gbs.AnnotateTOPM
Constructor from a TOPM file
AnnotateTOPM.EvidenceType - Enum in net.maizegenetics.analysis.gbs
 
AnnotateTOPMwSAMPlugin - Class in net.maizegenetics.analysis.gbs
This class reads in SAM mapping results tests them against an anchor map and creates a updated HDF5 TOPM file. TODO: Add mapping information from Bowtie2 Add mapping information from BWA Add mapping information from BLAST? Run genetic to compare hypotheses Call resort
AnnotateTOPMwSAMPlugin() - Constructor for class net.maizegenetics.analysis.gbs.AnnotateTOPMwSAMPlugin
 
AnnotateTOPMwSAMPlugin(parentFrame) - Constructor for class net.maizegenetics.analysis.gbs.AnnotateTOPMwSAMPlugin
 
annotateWithBLAST(blastM8FileS, maxMappingNum) - Method in class net.maizegenetics.analysis.gbs.AnnotateTOPM
Annotate the TOPM with BLAST
annotateWithBlastFromDir(blastDirS, maxMappingNum) - Method in class net.maizegenetics.analysis.gbs.AnnotateTOPM
Annotate the TOPM with BLAST from a directory, where slices of blast result are stored
annotateWithBowtie2(samFileS, maxMappingNum) - Method in class net.maizegenetics.analysis.gbs.AnnotateTOPM
Annotate the TOPM file using Bowtie2
annotateWithBWA(samFileS, maxMappingNum) - Method in class net.maizegenetics.analysis.gbs.AnnotateTOPM
Annotate the TOPM with BWA
annotateWithBWAMEM(samFileS, maxMappingNum) - Method in class net.maizegenetics.analysis.gbs.AnnotateTOPM
Annotate the TOPM file using bwa-mem
annotateWithGMGW(TOGMFileS, maxMappingNum) - Method in class net.maizegenetics.analysis.gbs.AnnotateTOPM
Annotate the TOPM with whole genome genetic mapping
annotateWithPE(PETOPMFileS, maxMappingNum) - Method in class net.maizegenetics.analysis.gbs.AnnotateTOPM
Annotate the TOPM with PE, using bowtie2 sam file
annotation - Variable in class net.maizegenetics.plugindef.GenerateRCode.TableReportVectors
 
annotation(annotation) - Method in class net.maizegenetics.taxa.distance.DistanceMatrixBuilder
 
ANNOTATION_DATA_SET_DESCRIPTION - Static variable in interface net.maizegenetics.dna.snp.GenotypeTable
 
ANNOTATION_DATA_SET_NAME - Static variable in interface net.maizegenetics.dna.snp.GenotypeTable
Annotations
ANNOTATION_SCHEMA - Static variable in class net.maizegenetics.analysis.avro.AvroConstants
 
annotations() - Method in class net.maizegenetics.dna.map.GenomeFeature
Returns a (shallow) copy of the Hashmap that keeps all annotations for this feature. Since the hashmap just stores Strings, a shallow copy is still safe to modify b/c it won't be reflected in the original.
annotations - Variable in class net.maizegenetics.dna.pd.SiteAnnotation
 
annotations() - Method in interface net.maizegenetics.dna.snp.Allele
 
annotations() - Method in class net.maizegenetics.dna.snp.CombineGenotypeTable
 
annotations() - Method in class net.maizegenetics.dna.snp.CoreGenotypeTable
 
annotations() - Method in interface net.maizegenetics.dna.snp.GenotypeTable
Annotations of this Genotype Table. Null if there are none.
annotations() - Method in class net.maizegenetics.dna.snp.MergedGenotypeTable
 
annotations() - Method in class net.maizegenetics.dna.snp.SimpleAllele
 
annotations() - Method in class net.maizegenetics.dna.snp.TOPMGenotypeTable
 
annotations() - Method in class net.maizegenetics.taxa.distance.DistanceMatrix
 
ANONYMOUS - Static variable in class net.maizegenetics.taxa.Taxon
 
anovaReportFilename() - Method in class net.maizegenetics.analysis.association.FixedEffectLMPlugin
Name of file to which ANOVA report will be saved
anovaReportFilename(value) - Method in class net.maizegenetics.analysis.association.FixedEffectLMPlugin
Set ANOVA File. Name of file to which ANOVA report will be saved
appendAddDom(append) - Method in class net.maizegenetics.analysis.association.AbstractFixedEffectLM
 
appendAddDom(append) - Method in interface net.maizegenetics.analysis.association.FixedEffectLM
 
appendAddDom() - Method in class net.maizegenetics.analysis.association.FixedEffectLMPlugin
If true, additive and dominance effect estimates will be added to the stats report for bi-allelic sites only. The effect will only be estimated when the data source is genotype (not a probability). The additive effect will always be non-negative.
appendAddDom(value) - Method in class net.maizegenetics.analysis.association.FixedEffectLMPlugin
Set Append Effect Estimates to Stats. If true, additive and dominance effect estimates will be added to the stats report for bi-allelic sites only. The effect will only be estimated when the data source is genotype (not a probability). The additive effect will always be non-negative.
appendAddDomEffects - Variable in class net.maizegenetics.analysis.association.AbstractFixedEffectLM
 
appendAnovaResults(sflm) - Method in class net.maizegenetics.analysis.modelfitter.StepwiseOLSModelFitter
 
appendAnovaResultsWithCI(sflm) - Method in class net.maizegenetics.analysis.modelfitter.StepwiseOLSModelFitter
 
appendSiteEffectEstimates(sflm) - Method in class net.maizegenetics.analysis.modelfitter.StepwiseOLSModelFitter
 
appendSiteEffectEstimatesWithCI(sflm) - Method in class net.maizegenetics.analysis.modelfitter.StepwiseOLSModelFitter
 
applicationConfiguration - Static variable in class net.maizegenetics.analysis.gbs.ProductionPipelineMain
 
applyBoxCox(pheno, addSmallVal, randomSeed, startLambda, endLambda, stepLambda) - Method in class net.maizegenetics.analysis.numericaltransform.BoxCoxTransformation
 
ApproxFastChiSquareDistribution - Class in net.maizegenetics.stats.statistics
chi-square distribution (distribution of sum of squares of n uniform random variables) (Parameter: n; mean: n; variance: 2*n) The chi-square distribution is a special case of the Gamma distribution (shape parameter = n/2.0, scale = 2.0).
ApproxFastChiSquareDistribution(maxX, maxN) - Constructor for class net.maizegenetics.stats.statistics.ApproxFastChiSquareDistribution
 
APPROXIMATE_MATCH_TAG - Static variable in class net.maizegenetics.analysis.gbs.neobio.PairwiseAlignmentAlgorithm
Tag character that signals an approximate match in the score tag line of an alignment.
ArchaeopteryxPlugin - Class in net.maizegenetics.analysis.tree
 
ArchaeopteryxPlugin(parentFrame, isInteractive) - Constructor for class net.maizegenetics.analysis.tree.ArchaeopteryxPlugin
 
archiveDirectory() - Method in class net.maizegenetics.analysis.gbs.ProductionPipeline
Archive directory where to move processed files
archiveDirectory(value) - Method in class net.maizegenetics.analysis.gbs.ProductionPipeline
Set Archive Directory. Archive directory where to move processed files
areAttributeAndTypeListsCompatible(attributes, types) - Static method in class net.maizegenetics.phenotype.CorePhenotype
 
areEncodingsEqual(encodings) - Static method in class net.maizegenetics.dna.snp.GenotypeTableUtils
 
areGenotypeValuesDiscrete() - Method in class net.maizegenetics.phenotype.GenotypePhenotype
 
areReadsUnique() - Method in interface net.maizegenetics.dna.tag.Reads
Reports whether this list of reads includes duplicates True is there are no read duplicates, false otherwise. Collapses read files are likely to be unique While a virtual digest of a genome with contain some duplicates
areReadsUnique() - Method in class net.maizegenetics.dna.tag.ReadsByTaxa
 
areSameTag(site1, site2, a) - Static method in class net.maizegenetics.analysis.imputation.NucleotideImputationUtils
 
areTagsEqual(index1, index2) - Method in class net.maizegenetics.dna.tag.AbstractTags
 
areTagsUnique() - Method in class net.maizegenetics.dna.map.PETagsOnPhysicalMapV3
 
areTagsUnique() - Method in class net.maizegenetics.dna.tag.AbstractTags
 
areTagsUnique() - Method in class net.maizegenetics.dna.tag.AbstractTagsByTaxa
 
areTagsUnique() - Method in class net.maizegenetics.dna.tag.TagCounts
 
areTagsUnique() - Method in interface net.maizegenetics.dna.tag.Tags
Reports whether this list of reads includes duplicates True is there are no read duplicates, false otherwise. Collapses read files are likely to be unique While a virtual digest of a genome with contain some duplicates
areTaxaReplicated - Variable in class net.maizegenetics.analysis.association.AbstractFixedEffectLM
 
areTaxaReplicated() - Method in class net.maizegenetics.phenotype.CorePhenotype
 
areTaxaReplicated() - Method in class net.maizegenetics.phenotype.FilterPhenotype
 
areTaxaReplicated() - Method in class net.maizegenetics.phenotype.GenotypePhenotype
 
areTaxaReplicated() - Method in interface net.maizegenetics.phenotype.Phenotype
 
ArgsEngine - Class in net.maizegenetics.util
A reusable solution for Command Line Arguments Parsing in Java.
arrangeMajorMinorBtwAlignments(unimpAlign, bt, donorOffset, donorLength, goodMask, swapMjMnMask, isSwapMajorMinor) - Static method in class net.maizegenetics.analysis.imputation.FILLINDonorGenotypeUtils
Major and minor allele get swapped between GenotypeTables. This method flips these, and sets the bad sites to missing
arraycopy(row, src, startColumn) - Method in interface net.maizegenetics.util.SuperByteMatrix
Sets values at given row and starting column.
arraycopy(row, src, startColumn) - Method in class net.maizegenetics.util.SuperByteMatrixMultiple
 
arraycopy(row, src, startColumn) - Method in class net.maizegenetics.util.SuperByteMatrixSingle
 
arraycopy(row, src, startColumn) - Method in class net.maizegenetics.util.SuperByteMatrixSingleValue
 
arraycopy(row, src, startColumn) - Method in class net.maizegenetics.util.SuperByteMatrixTranspose
 
asBigDecimal(name) - Method in interface net.maizegenetics.util.db.DBTuple
 
asBigDecimal(index) - Method in interface net.maizegenetics.util.db.DBTuple
 
asBigDecimal(name) - Method in class net.maizegenetics.util.db.DefaultDBTuple
 
asBigDecimal(index) - Method in class net.maizegenetics.util.db.DefaultDBTuple
 
asBoolean(name) - Method in interface net.maizegenetics.util.db.DBTuple
 
asBoolean(index) - Method in interface net.maizegenetics.util.db.DBTuple
 
asBoolean(name) - Method in class net.maizegenetics.util.db.DefaultDBTuple
 
asBoolean(index) - Method in class net.maizegenetics.util.db.DefaultDBTuple
 
asByte(name) - Method in interface net.maizegenetics.util.db.DBTuple
 
asByte(index) - Method in interface net.maizegenetics.util.db.DBTuple
 
asByte(name) - Method in class net.maizegenetics.util.db.DefaultDBTuple
 
asByte(index) - Method in class net.maizegenetics.util.db.DefaultDBTuple
 
asChar(name) - Method in interface net.maizegenetics.util.db.DBTuple
 
asChar(index) - Method in interface net.maizegenetics.util.db.DBTuple
 
asChar(name) - Method in class net.maizegenetics.util.db.DefaultDBTuple
 
asChar(index) - Method in class net.maizegenetics.util.db.DefaultDBTuple
 
asCorePhenotype() - Method in class net.maizegenetics.phenotype.CorePhenotype
 
asCorePhenotype() - Method in class net.maizegenetics.phenotype.FilterPhenotype
 
asCorePhenotype() - Method in interface net.maizegenetics.phenotype.Phenotype
 
asDouble(name) - Method in interface net.maizegenetics.util.db.DBTuple
 
asDouble(index) - Method in interface net.maizegenetics.util.db.DBTuple
 
asDouble(name) - Method in class net.maizegenetics.util.db.DefaultDBTuple
 
asDouble(index) - Method in class net.maizegenetics.util.db.DefaultDBTuple
 
asFloat(name) - Method in interface net.maizegenetics.util.db.DBTuple
 
asFloat(index) - Method in interface net.maizegenetics.util.db.DBTuple
 
asFloat(name) - Method in class net.maizegenetics.util.db.DefaultDBTuple
 
asFloat(index) - Method in class net.maizegenetics.util.db.DefaultDBTuple
 
asInt(name) - Method in interface net.maizegenetics.util.db.DBTuple
 
asInt(index) - Method in interface net.maizegenetics.util.db.DBTuple
 
asInt(name) - Method in class net.maizegenetics.util.db.DefaultDBTuple
 
asInt(index) - Method in class net.maizegenetics.util.db.DefaultDBTuple
 
asLong(name) - Method in interface net.maizegenetics.util.db.DBTuple
 
asLong(index) - Method in interface net.maizegenetics.util.db.DBTuple
 
asLong(name) - Method in class net.maizegenetics.util.db.DefaultDBTuple
 
asLong(index) - Method in class net.maizegenetics.util.db.DefaultDBTuple
 
assembleDistMatrix(block, dim, r, c, lc) - Method in class net.maizegenetics.analysis.gbs.neobio.CrochemoreLandauZivUkelson
Assembles the DIST matrix of a block by retrieving the DIST columns of its prefix blocks. In fact, it also stores pointers to the owner block for each column retrieved. These pointers are later used during the trace back procedure that builds an optimal alignment from the information computed in the block table. This method is general enough to suit both global and local alignment versions of the algorithm.
assembleInputBorder(dim, r, c, lr) - Method in class net.maizegenetics.analysis.gbs.neobio.CrochemoreLandauZivUkelson
Assembles the input border of a block by retrieving the values at the output borders of the left and top blocks. This method is general enough to suit both global and local alignment versions of the algorithm. Note that it can be used to assemble the input border of any block but the root one (it will cause an ArrayIndexOutOfBoundsException.
asShort(name) - Method in interface net.maizegenetics.util.db.DBTuple
 
asShort(index) - Method in interface net.maizegenetics.util.db.DBTuple
 
asShort(name) - Method in class net.maizegenetics.util.db.DefaultDBTuple
 
asShort(index) - Method in class net.maizegenetics.util.db.DefaultDBTuple
 
assignHaplotyes() - Method in class net.maizegenetics.analysis.imputation.BiparentalHaplotypeFinder
 
assignHaplotypes() - Method in class net.maizegenetics.analysis.imputation.UseParentHaplotypes
 
assignName(name) - Method in class net.maizegenetics.phenotype.PhenotypeBuilder
 
association(kinship, genotype, phenotype, genoPheno, minClassSize, biallelicOnly, appendAddDom, saveToFile, outputFile, maxP) - Static method in class net.maizegenetics.plugindef.GenerateRCode
 
AssociationConstants - Class in net.maizegenetics.analysis.association
 
AssociationUtils - Class in net.maizegenetics.analysis.association
 
asTasselDistanceMatrix(m, taxa) - Static method in class net.maizegenetics.plugindef.GenerateRCode
Convert an R matrix to a DistanceMatrix object
attribute(attrnum) - Method in class net.maizegenetics.phenotype.CorePhenotype
 
attribute(attrnum) - Method in class net.maizegenetics.phenotype.FilterPhenotype
 
attribute(attrnum) - Method in interface net.maizegenetics.phenotype.Phenotype
 
attributeIndexForName(name) - Method in class net.maizegenetics.phenotype.CorePhenotype
 
attributeIndexForName(name) - Method in class net.maizegenetics.phenotype.FilterPhenotype
 
attributeIndexForName(name) - Method in interface net.maizegenetics.phenotype.Phenotype
 
attributeIndicesOfType(type) - Method in class net.maizegenetics.phenotype.CorePhenotype
 
attributeIndicesOfType(type) - Method in class net.maizegenetics.phenotype.FilterPhenotype
 
attributeIndicesOfType(type) - Method in interface net.maizegenetics.phenotype.Phenotype
 
attributeLabelForIndex(index) - Method in class net.maizegenetics.phenotype.CategoricalAttribute
 
attributeListCopy() - Method in class net.maizegenetics.phenotype.CorePhenotype
 
attributeListCopy() - Method in class net.maizegenetics.phenotype.FilterPhenotype
 
attributeListCopy() - Method in interface net.maizegenetics.phenotype.Phenotype
 
attributeListOfType(type) - Method in class net.maizegenetics.phenotype.CorePhenotype
 
attributeListOfType(type) - Method in class net.maizegenetics.phenotype.FilterPhenotype
 
attributeListOfType(type) - Method in interface net.maizegenetics.phenotype.Phenotype
 
attributeName(attrnum) - Method in class net.maizegenetics.phenotype.CorePhenotype
 
attributeName(attrnum) - Method in class net.maizegenetics.phenotype.FilterPhenotype
 
attributeName(attrnum) - Method in interface net.maizegenetics.phenotype.Phenotype
 
AttributeNode - Interface in net.maizegenetics.taxa.tree
interface for a node (includes branch) in a binary/non-binary rooted/unrooted tree. Unlike its superclass this node can have an arbitrary number of named attributes associated with it.
attributes() - Method in class net.maizegenetics.dna.snp.FilterSite
 
attributes() - Method in class net.maizegenetics.dna.snp.FilterTaxa
 
attributeStream() - Method in class net.maizegenetics.phenotype.CorePhenotype
 
attributeStream() - Method in class net.maizegenetics.phenotype.FilterPhenotype
 
attributeStream() - Method in interface net.maizegenetics.phenotype.Phenotype
 
attributeType(attrnum) - Method in class net.maizegenetics.phenotype.CorePhenotype
 
attributeType(attrnum) - Method in class net.maizegenetics.phenotype.FilterPhenotype
 
attributeType(attrnum) - Method in interface net.maizegenetics.phenotype.Phenotype
 
automaticMajorMAF() - Method in class net.maizegenetics.analysis.imputation.LDKNNiImputationHetV2Plugin
Set to Major genotype if no imputation result and MAF is below threshold
automaticMajorMAF(value) - Method in class net.maizegenetics.analysis.imputation.LDKNNiImputationHetV2Plugin
Set Automatic MajorGenotype if MAF. Set to Major genotype if no imputation result and MAF is below threshold
automaticMajorMAF() - Method in class net.maizegenetics.analysis.imputation.LDKNNiImputationHetV3Plugin
Set to Major genotype if no imputation result and MAF is below threshold
automaticMajorMAF(value) - Method in class net.maizegenetics.analysis.imputation.LDKNNiImputationHetV3Plugin
Set Automatic MajorGenotype if MAF. Set to Major genotype if no imputation result and MAF is below threshold
averagePheno(pheno, addSmallValue, randomSeed) - Method in class net.maizegenetics.analysis.numericaltransform.AvgPhenotype
 
aveSeqErrorRate() - Method in class net.maizegenetics.analysis.gbs.DiscoverySNPCallerPlugin
Average sequencing error rate per base (used to decide between heterozygous and homozygous calls)
aveSeqErrorRate(value) - Method in class net.maizegenetics.analysis.gbs.DiscoverySNPCallerPlugin
Set Ave Seq Error Rate. Average sequencing error rate per base (used to decide between heterozygous and homozygous calls)
aveSeqErrorRate() - Method in class net.maizegenetics.analysis.gbs.ProductionSNPCallerPlugin
Average sequencing error rate per base (used to decide between heterozygous and homozygous calls)
aveSeqErrorRate(value) - Method in class net.maizegenetics.analysis.gbs.ProductionSNPCallerPlugin
Set Ave Seq Error Rate. Average sequencing error rate per base (used to decide between heterozygous and homozygous calls)
aveSeqErrorRate() - Method in class net.maizegenetics.analysis.gbs.repgen.RGBSProductionSNPCallerPlugin
Average sequencing error rate per base (used to decide between heterozygous and homozygous calls)
aveSeqErrorRate(value) - Method in class net.maizegenetics.analysis.gbs.repgen.RGBSProductionSNPCallerPlugin
Set Ave Seq Error Rate. Average sequencing error rate per base (used to decide between heterozygous and homozygous calls)
aveSeqErrorRate() - Method in class net.maizegenetics.analysis.gbs.v2.ProductionSNPCallerPluginV2
Average sequencing error rate per base (used to decide between heterozygous and homozygous calls)
aveSeqErrorRate(value) - Method in class net.maizegenetics.analysis.gbs.v2.ProductionSNPCallerPluginV2
Set Ave Seq Error Rate. Average sequencing error rate per base (used to decide between heterozygous and homozygous calls)
AvgPhenotype - Class in net.maizegenetics.analysis.numericaltransform
 
AvgPhenotypeByTaxaPlugin - Class in net.maizegenetics.analysis.numericaltransform
 
AvgPhenotypeByTaxaPlugin(parentFrame, isInteractive) - Constructor for class net.maizegenetics.analysis.numericaltransform.AvgPhenotypeByTaxaPlugin
 
avgSegmentLength - Variable in class net.maizegenetics.analysis.imputation.TransitionProbability
 
avgSeqErrorRate() - Method in class net.maizegenetics.analysis.data.MergeRenameDeleteTaxaPlugin
Average sequencing error rate per base (used to decide between heterozygous and homozygous calls when merging taxa)
avgSeqErrorRate(value) - Method in class net.maizegenetics.analysis.data.MergeRenameDeleteTaxaPlugin
Set Avg Seq Error Rate. Average sequencing error rate per base (used to decide between heterozygous and homozygous calls when merging taxa)
AvroConstants - Class in net.maizegenetics.analysis.avro
 
AvroConstants.CHROMOSOME_INDICES - Enum in net.maizegenetics.analysis.avro
 
AvroConstants.GENOTYPE_TABLE_COMPONENTS - Enum in net.maizegenetics.analysis.avro
 
AvroConstants.POSITION_INDICES - Enum in net.maizegenetics.analysis.avro
 
AvroConstants.TAXON_INDICES - Enum in net.maizegenetics.analysis.avro
 

B

b4rConfigFile() - Method in class net.maizegenetics.analysis.gobii.GWAS_IFLPlugin
DB config file containing connection information to the B4r database
b4rConfigFile(value) - Method in class net.maizegenetics.analysis.gobii.GWAS_IFLPlugin
Set B4R Config File. DB config file containing connection information to the B4r database
b4RDBName() - Method in class net.maizegenetics.analysis.b4r.GetPhenotypeFromB4RPlugin
B4R Database Name
b4RDBName(value) - Method in class net.maizegenetics.analysis.b4r.GetPhenotypeFromB4RPlugin
Set B4R Database Name. B4R Database Name
b4RHost() - Method in class net.maizegenetics.analysis.b4r.GetPhenotypeFromB4RPlugin
B4R Host Name
b4RHost(value) - Method in class net.maizegenetics.analysis.b4r.GetPhenotypeFromB4RPlugin
Set B4R Host Name. B4R Host Name
b4RPassword() - Method in class net.maizegenetics.analysis.b4r.GetPhenotypeFromB4RPlugin
Password
b4RPassword(value) - Method in class net.maizegenetics.analysis.b4r.GetPhenotypeFromB4RPlugin
Set B4R Password. Password
B4RPhenotypeUtils - Class in net.maizegenetics.analysis.b4r
 
b4RUser() - Method in class net.maizegenetics.analysis.b4r.GetPhenotypeFromB4RPlugin
B4R User Name
b4RUser(value) - Method in class net.maizegenetics.analysis.b4r.GetPhenotypeFromB4RPlugin
Set B4R User. B4R User Name
BackwardForwardAlgorithm - Class in net.maizegenetics.analysis.imputation
 
BackwardForwardAlgorithm() - Constructor for class net.maizegenetics.analysis.imputation.BackwardForwardAlgorithm
The BackwardForward algorithm is used to calculate the probability of each state at each position.
BackwardForwardVariableStateNumber - Class in net.maizegenetics.analysis.imputation
 
BackwardForwardVariableStateNumber() - Constructor for class net.maizegenetics.analysis.imputation.BackwardForwardVariableStateNumber
The BackwardForward algorithm is used to calculate the probability of each state at each position.
backwardStep() - Method in class net.maizegenetics.analysis.modelfitter.StepwiseOLSModelFitter
 
backwardStep() - Method in class net.maizegenetics.stats.linearmodels.LinearModelForStepwiseRegression
 
BarChartPanel - Class in net.maizegenetics.analysis.chart
todo Need to make conconcated alignment report sequence haplotypes into table
BarChartPanel(theTable) - Constructor for class net.maizegenetics.analysis.chart.BarChartPanel
 
BarChartPanel(theTable, seriesCat, seriesY1, seriesY2, isBoxWhisker, isBar, errBar) - Constructor for class net.maizegenetics.analysis.chart.BarChartPanel
 
Barcode - Class in net.maizegenetics.analysis.gbs
Container class for storing information on GBS barcodes.
Barcode(barcodeS, overhangSunsort, taxa, globalTaxaIndex, flowcell, lane) - Constructor for class net.maizegenetics.analysis.gbs.Barcode
Constructor creating a barcode
Barcode(barcodeS, overhangSunsort, taxa, globalTaxaIndex, tissue, globalTissueIndex, flowcell, lane) - Constructor for class net.maizegenetics.analysis.gbs.Barcode
Constructor creating a barcode
barcodeField - Static variable in class net.maizegenetics.analysis.gbs.v2.GBSUtils
 
barcodeField - Static variable in class net.maizegenetics.util.ConvertOldFastqToModernFormatPlugin
 
BarcodeTrie - Class in net.maizegenetics.analysis.gbs.v2
This is an implementation of a trie (prefix tree) in Java. Supports opeations like searching a string, searching a prefix, searching by prefix etc.
BarcodeTrie() - Constructor for class net.maizegenetics.analysis.gbs.v2.BarcodeTrie
Constructor
base() - Method in class net.maizegenetics.analysis.numericaltransform.TransformDataDialog
 
base() - Method in class net.maizegenetics.dna.snp.score.MaskAlleleDepth
 
base() - Method in class net.maizegenetics.dna.snp.score.MaskAlleleProbability
 
baseCompleMap - Static variable in class net.maizegenetics.dna.read.ReadUtils
 
baseDf() - Method in class net.maizegenetics.stats.linearmodels.SolveByOrthogonalizing
 
BaseEncoder - Class in net.maizegenetics.dna
Utility class for encoding tags into longs.
baseErrorSSdf - Variable in class net.maizegenetics.analysis.association.AbstractFixedEffectLM
 
baseModel() - Method in class net.maizegenetics.analysis.association.AbstractFixedEffectLM
 
baseModel - Variable in class net.maizegenetics.analysis.modelfitter.ForwardStepAdditiveSpliterator
 
baseModel(phenotypeBeingTested) - Method in class net.maizegenetics.analysis.modelfitter.StepwiseAdditiveModelFitter
 
baseModeldf - Variable in class net.maizegenetics.analysis.modelfitter.ForwardStepAdditiveSpliterator
 
bases - Static variable in class net.maizegenetics.dna.BaseEncoder
defines the base order
BasicChartPanel - Class in net.maizegenetics.analysis.chart
Title:
BasicChartPanel() - Constructor for class net.maizegenetics.analysis.chart.BasicChartPanel
 
BasicFileFilter - Class in net.maizegenetics.util
Title:
BasicFileFilter(extension) - Constructor for class net.maizegenetics.util.BasicFileFilter
 
BasicGenotypeMergeRule - Class in net.maizegenetics.dna.snp.genotypecall
Defines the methods for merging the calls from two taxa. The merge rules need to be defined at the level of genotypic calls and for read depth. In general if depth is available, it will be used to merge.
BasicGenotypeMergeRule(errorRate) - Constructor for class net.maizegenetics.dna.snp.genotypecall.BasicGenotypeMergeRule
 
BasicGraphFrame - Class in net.maizegenetics.analysis.chart
Title:
BasicGraphFrame(cdp, theTable) - Constructor for class net.maizegenetics.analysis.chart.BasicGraphFrame
 
BasicLevel - Class in net.maizegenetics.stats.linearmodels
Created using IntelliJ IDEA. Author: Peter Bradbury Date: Dec 29, 2004 Time: 9:41:55 AM
BasicLevel(levelValues) - Constructor for class net.maizegenetics.stats.linearmodels.BasicLevel
 
BasicLevel(levels) - Constructor for class net.maizegenetics.stats.linearmodels.BasicLevel
 
BasicLevel(c) - Constructor for class net.maizegenetics.stats.linearmodels.BasicLevel
 
basicLoggingInfo() - Static method in class net.maizegenetics.tassel.TasselLogging
 
BasicScoringScheme - Class in net.maizegenetics.analysis.gbs.neobio
This class implements a basic scoring scheme. At least three parameters must be provided to the constructor: the reward for a match (a substitution of equal characters), the penalty for a mismatch (a substitution of different characters) and the cost of a gap (an insertion or deletion of a character). Note that it only supports an additive gap cost function.
BasicScoringScheme(match_reward, mismatch_penalty, gap_cost) - Constructor for class net.maizegenetics.analysis.gbs.neobio.BasicScoringScheme
Creates a new instance of a basic scoring scheme with the specified values of match reward, mismatch penalty and gap cost. The case of characters is significant when subsequently computing their score.
BasicScoringScheme(match_reward, mismatch_penalty, gap_cost, case_sensitive) - Constructor for class net.maizegenetics.analysis.gbs.neobio.BasicScoringScheme
Creates a new instance of basic scoring scheme with the specified values of match reward, mismatch penalty and gap cost. If case_sensitive is true, the case of characters is significant when subsequently computing their score; otherwise the case is ignored.
BasicShuffler - Class in net.maizegenetics.stats.linearmodels
 
batchSize(value) - Method in class net.maizegenetics.analysis.gbs.repgen.RepGenLoadSeqToDBPlugin
Set number of Fastq files processed simultaneously
batchSize() - Method in class net.maizegenetics.analysis.gbs.repgen.RGBSProductionSNPCallerPlugin
Batch size for processing fastq files
batchSize(value) - Method in class net.maizegenetics.analysis.gbs.repgen.RGBSProductionSNPCallerPlugin
Set number of Fastq files processed simultaneously
batchSize(value) - Method in class net.maizegenetics.analysis.gbs.v2.GBSSeqToTagDBPlugin
Set number of Fastq files processed simultaneously
batchSize() - Method in class net.maizegenetics.analysis.gbs.v2.ProductionSNPCallerPluginV2
Batch size for processing fastq files
batchSize(value) - Method in class net.maizegenetics.analysis.gbs.v2.ProductionSNPCallerPluginV2
Set number of Fastq files processed simultaneously
batchSize() - Method in class net.maizegenetics.analysis.rna.RNADeMultiplexProductionPlugin
Number of flow cells being processed simultaneously
batchSize(value) - Method in class net.maizegenetics.analysis.rna.RNADeMultiplexProductionPlugin
Set Batch size of fastq files. Number of flow cells being processed simultaneously
bc() - Method in class net.maizegenetics.analysis.imputation.FSFHapImputationPlugin
use the single backcross algorithm
bc(value) - Method in class net.maizegenetics.analysis.imputation.FSFHapImputationPlugin
Set Bc. use the single backcross algorithm
bdm - Variable in class net.maizegenetics.matrixalgebra.decomposition.BlasEigenvalueDecomposition
 
bedFile() - Method in class net.maizegenetics.analysis.distance.VCAPScanPlugin
Bed File
bedFile(value) - Method in class net.maizegenetics.analysis.distance.VCAPScanPlugin
Set Bed File. Bed File
bedFile() - Method in class net.maizegenetics.analysis.filter.FilterSiteBuilderPlugin
Filter based on BED file.
bedFile(value) - Method in class net.maizegenetics.analysis.filter.FilterSiteBuilderPlugin
Set Bed File. Filter based on BED file.
bedFile() - Method in class net.maizegenetics.dna.snp.FilterSite
 
BedFileRange(chr, startPos, endPos, name) - Constructor for class net.maizegenetics.dna.snp.io.ReadBedfile.BedFileRange
 
BEST_CHR - Static variable in class net.maizegenetics.dna.tag.GBSHDF5Constants
 
BEST_DCOP - Static variable in class net.maizegenetics.dna.tag.GBSHDF5Constants
 
BEST_DIVERGENCE - Static variable in class net.maizegenetics.dna.tag.GBSHDF5Constants
 
BEST_ENDPOS - Static variable in class net.maizegenetics.dna.tag.GBSHDF5Constants
 
BEST_EVIDENCE - Static variable in class net.maizegenetics.dna.tag.GBSHDF5Constants
 
BEST_MAPINDEX - Static variable in class net.maizegenetics.dna.tag.GBSHDF5Constants
 
BEST_MAPP - Static variable in class net.maizegenetics.dna.tag.GBSHDF5Constants
 
BEST_STARTPOS - Static variable in class net.maizegenetics.dna.tag.GBSHDF5Constants
 
BEST_STRAND - Static variable in class net.maizegenetics.dna.tag.GBSHDF5Constants
 
bestChr - Variable in class net.maizegenetics.dna.map.AbstractTagsOnPhysicalMap
 
bestDonorsAcrossEntireRegion(targetToDonorDistances, minTestSites, maxDonorHypotheses) - Static method in class net.maizegenetics.analysis.imputation.FILLINImputationUtils
Produces a sort list of most prevalent donorHypotheses across the donorAlign. It looks at all focus blocks and weight blocks by rank
bestStartPos - Variable in class net.maizegenetics.dna.map.AbstractTagsOnPhysicalMap
 
bestStrand - Variable in class net.maizegenetics.dna.map.AbstractTagsOnPhysicalMap
 
bestTerm(baseModel, interval) - Method in class net.maizegenetics.analysis.modelfitter.StepwiseAddDomModelFitter
 
bestTerm(baseModel, interval) - Method in class net.maizegenetics.analysis.modelfitter.StepwiseAdditiveModelFitter
 
beta() - Method in class net.maizegenetics.analysis.imputation.BackwardForwardAlgorithm
 
beta() - Method in class net.maizegenetics.analysis.imputation.BackwardForwardVariableStateNumber
 
beta - Variable in class net.maizegenetics.stats.EMMA.EMMAforDoubleMatrix
 
biallelicOnly - Variable in class net.maizegenetics.analysis.association.AbstractFixedEffectLM
 
biallelicOnly(biallelic) - Method in class net.maizegenetics.analysis.association.AbstractFixedEffectLM
 
biallelicOnly(biallelic) - Method in interface net.maizegenetics.analysis.association.FixedEffectLM
 
biallelicOnly() - Method in class net.maizegenetics.analysis.association.FixedEffectLMPlugin
Only test sites that are bi-allelic. The alternative is to test sites with two or more alleles.
biallelicOnly(value) - Method in class net.maizegenetics.analysis.association.FixedEffectLMPlugin
Set Bi-Allelic Sites Only. Only test sites that are bi-allelic. The alternative is to test sites with two or more alleles.
bic(RSS, N, modelDf) - Static method in class net.maizegenetics.analysis.modelfitter.StepwiseAdditiveModelFitter
 
BIC(l, k, n) - Static method in class net.maizegenetics.stats.statistics.PenalizedLikelihood
BIC correction (Schwarz 1978)
BinaryToTextPlugin - Class in net.maizegenetics.analysis.gbs
 
BinaryToTextPlugin(parentFrame, isInteractive) - Constructor for class net.maizegenetics.analysis.gbs.BinaryToTextPlugin
 
BinaryToTextPlugin.FILE_TYPES - Enum in net.maizegenetics.analysis.gbs
 
BiparentalHaplotypeFinder - Class in net.maizegenetics.analysis.imputation
 
BiparentalHaplotypeFinder(popdata) - Constructor for class net.maizegenetics.analysis.imputation.BiparentalHaplotypeFinder
 
bits2words(numBits) - Static method in class net.maizegenetics.util.BitUtil
returns the number of 64 bit words it would take to hold numBits
BitSet - Interface in net.maizegenetics.util
 
BitSet.BitSetListCollector - Class in net.maizegenetics.util
 
BitSetListCollector(numBits) - Constructor for class net.maizegenetics.util.BitSet.BitSetListCollector
 
bitsetToString(bitset) - Static method in class net.maizegenetics.dna.tag.TagsByTaxaUtils
Prints bitsets in human-readable format for debugging purposes.
bitsetToStringArray(bitset) - Static method in class net.maizegenetics.dna.tag.TagsByTaxaUtils
Stores bitsets in human-readable format.
BitStorage - Interface in net.maizegenetics.dna.snp.bit
Interface provides genotypes in a binary fashion to be used in rapid computation. See the package descriptions net.maizegenetics.dna.snp.bit for more information on how bits encoding is used throughout TASSEL.
bitStorage(allele) - Method in class net.maizegenetics.dna.snp.CombineGenotypeTable
 
bitStorage(allele) - Method in class net.maizegenetics.dna.snp.CoreGenotypeTable
 
bitStorage(allele) - Method in interface net.maizegenetics.dna.snp.GenotypeTable
Returns BitStorage for this Genotype
bitStorage(allele) - Method in class net.maizegenetics.dna.snp.MergedGenotypeTable
 
bitStorage(allele) - Method in class net.maizegenetics.dna.snp.TOPMGenotypeTable
 
BitUtil - Class in net.maizegenetics.util
A variety of high efficiency bit twiddling routines.
BlasDoubleMatrix - Class in net.maizegenetics.matrixalgebra.Matrix
 
BlasDoubleMatrix() - Constructor for class net.maizegenetics.matrixalgebra.Matrix.BlasDoubleMatrix
 
BlasDoubleMatrix(values) - Constructor for class net.maizegenetics.matrixalgebra.Matrix.BlasDoubleMatrix
 
BlasDoubleMatrix(values) - Constructor for class net.maizegenetics.matrixalgebra.Matrix.BlasDoubleMatrix
 
BlasDoubleMatrix(nrows, ncols) - Constructor for class net.maizegenetics.matrixalgebra.Matrix.BlasDoubleMatrix
 
BlasEigenvalueDecomposition - Class in net.maizegenetics.matrixalgebra.decomposition
 
BlasEigenvalueDecomposition(dm) - Constructor for class net.maizegenetics.matrixalgebra.decomposition.BlasEigenvalueDecomposition
 
BlasSingularValueDecomposition - Class in net.maizegenetics.matrixalgebra.decomposition
 
BlasSingularValueDecomposition(bdm, jobz) - Constructor for class net.maizegenetics.matrixalgebra.decomposition.BlasSingularValueDecomposition
 
BlasSingularValueDecomposition(bdm) - Constructor for class net.maizegenetics.matrixalgebra.decomposition.BlasSingularValueDecomposition
 
blastFile() - Method in class net.maizegenetics.analysis.gbs.repgen.RampSeqAlignFromBlastTags
Tab delimited Blast file output with NO header line, that contains only the data from columns for chrom, start postion, end position. This data should be filtered to contain only entries whose identiy value was 98% or greater.
blastFile(value) - Method in class net.maizegenetics.analysis.gbs.repgen.RampSeqAlignFromBlastTags
Set Blast File. Tab delimited Blast file output with NO header line, that contains only the data from columns for chrom, start position, end position. This data should be filtered to contain only entries whose identify value was 98% or greater.
BLOCK_SIZE - Static variable in class net.maizegenetics.dna.snp.HapMapHDF5Constants
 
BLOCK_SIZE - Static variable in class net.maizegenetics.util.Tassel5HDF5Constants
 
block_table - Variable in class net.maizegenetics.analysis.gbs.neobio.CrochemoreLandauZivUkelson
The block table, which is a matrix of alignment blocks where each block represents the alignment between one factor of each sequence.
blockingBedFile() - Method in class net.maizegenetics.analysis.distance.VCAPScanPlugin
For Bed_File method, this specifies optional bed file to define blocking window for each block in the main bed file.
blockingBedFile(value) - Method in class net.maizegenetics.analysis.distance.VCAPScanPlugin
Set Blocking Bed File. For Bed_File method, this specifies optional bed file to define blocking window for each block in the main bed file.
blockingWindowSize() - Method in class net.maizegenetics.analysis.distance.VCAPScanPlugin
Blocking window size
blockingWindowSize(value) - Method in class net.maizegenetics.analysis.distance.VCAPScanPlugin
Set Blocking Window Size. Blocking window size
blues() - Method in class net.maizegenetics.analysis.association.PhenotypeLM
 
bluesReportFilename() - Method in class net.maizegenetics.analysis.association.FixedEffectLMPlugin
Name of file to which BLUEs values will be saved
bluesReportFilename(value) - Method in class net.maizegenetics.analysis.association.FixedEffectLMPlugin
Set BLUEs File. Name of file to which BLUEs values will be saved
blup - Variable in class net.maizegenetics.stats.EMMA.EMMAforDoubleMatrix
 
BMS_DB - Static variable in class net.maizegenetics.prefs.TasselPrefs
 
BMS_DB_DEFAULT - Static variable in class net.maizegenetics.prefs.TasselPrefs
 
BMS_HOST - Static variable in class net.maizegenetics.prefs.TasselPrefs
 
BMS_HOST_DEFAULT - Static variable in class net.maizegenetics.prefs.TasselPrefs
 
BMS_USER - Static variable in class net.maizegenetics.prefs.TasselPrefs
 
BMS_USER_DEFAULT - Static variable in class net.maizegenetics.prefs.TasselPrefs
 
BMSConnection - Class in net.maizegenetics.analysis.gobii
 
bmsDBName() - Method in class net.maizegenetics.analysis.gobii.GOBIIPlugin
Database Name
bmsDBName(value) - Method in class net.maizegenetics.analysis.gobii.GOBIIPlugin
Set Database Name. Database Name
bmsHost() - Method in class net.maizegenetics.analysis.gobii.GOBIIPlugin
BMS Host Name
bmsHost(value) - Method in class net.maizegenetics.analysis.gobii.GOBIIPlugin
Set BMS Host Name. BMS Host Name
bmsPassword(value) - Method in class net.maizegenetics.analysis.gobii.GOBIIPlugin
Set BMS Password. Password
bmsUser() - Method in class net.maizegenetics.analysis.gobii.GOBIIPlugin
User Name
bmsUser(value) - Method in class net.maizegenetics.analysis.gobii.GOBIIPlugin
Set BMS User. User Name
BoxCoxTransformation - Class in net.maizegenetics.analysis.numericaltransform
 
BoxCoxTransformationPlugin - Class in net.maizegenetics.analysis.numericaltransform
 
BoxCoxTransformationPlugin(parentFrame, isInteractive) - Constructor for class net.maizegenetics.analysis.numericaltransform.BoxCoxTransformationPlugin
 
BPECAVGR2_DESC - Static variable in class net.maizegenetics.dna.snp.HapMapHDF5Constants
 
BPECERROR_DESC - Static variable in class net.maizegenetics.dna.snp.HapMapHDF5Constants
 
BPLDMean34 - Static variable in class net.maizegenetics.dna.snp.HapMapHDF5Constants
 
BPLDMeanMax - Static variable in class net.maizegenetics.dna.snp.HapMapHDF5Constants
 
BPmaxMaxLD - Static variable in class net.maizegenetics.dna.snp.HapMapHDF5Constants
 
BPminMaxLD - Static variable in class net.maizegenetics.dna.snp.HapMapHDF5Constants
 
BPPopCnt - Static variable in class net.maizegenetics.dna.snp.HapMapHDF5Constants
 
BranchLimits - Interface in net.maizegenetics.taxa.tree
limits for branch lengths
breakFile() - Method in class net.maizegenetics.analysis.gobii.HapBreakpoints_IFLFilePlugin
Full path to file containing breakpoint blocks for projection alignment
breakFile(value) - Method in class net.maizegenetics.analysis.gobii.HapBreakpoints_IFLFilePlugin
Set Breakpoint File. Full path to file containing breakpoint blocks for projection alignment
breakpointOutFile() - Method in class net.maizegenetics.analysis.imputation.ImputeProgenyStatesPlugin
The name of the output file for writing the breakpoints. If the file exists, it will be overwritten.
breakpointOutFile(value) - Method in class net.maizegenetics.analysis.imputation.ImputeProgenyStatesPlugin
Set Breakpoint Output File. The name of the output file for writing the breakpoints. If the file exists, it will be overwritten.
brkptComment1 - Static variable in class net.maizegenetics.analysis.imputation.WritePopulationAlignmentPlugin
 
brkptComment2 - Static variable in class net.maizegenetics.analysis.imputation.WritePopulationAlignmentPlugin
 
brkptComment3 - Static variable in class net.maizegenetics.analysis.imputation.WritePopulationAlignmentPlugin
 
build() - Method in class net.maizegenetics.analysis.filter.FilterSiteBuilderPlugin
 
build() - Method in class net.maizegenetics.analysis.filter.FilterTaxaBuilderPlugin
 
build() - Method in class net.maizegenetics.analysis.popgen.LDResult.Builder
 
build() - Method in class net.maizegenetics.analysis.rna.FindMatchByWordHash.Builder
 
build() - Method in class net.maizegenetics.dna.map.GeneralPosition.Builder
 
build() - Method in class net.maizegenetics.dna.map.GenomeFeatureBuilder
Public accessor method to get a new GenomeFeatureBuilder based off an existing GenomeFeature TODO: Get this matching other getInstance methods better; doesn't seem to fit, so commented out for now //@param feature //@return
build() - Method in class net.maizegenetics.dna.map.GenomeFeatureMapBuilder
 
build() - Method in class net.maizegenetics.dna.map.PositionListBuilder
Returns a newly-created ImmutableList based on the myPositions of the Builder.
build(genotypes) - Method in class net.maizegenetics.dna.map.PositionListBuilder
 
build() - Method in class net.maizegenetics.dna.snp.byte2d.Byte2DBuilder
 
build() - Method in class net.maizegenetics.dna.snp.genotypecall.GenotypeCallTableBuilder
 
build() - Method in class net.maizegenetics.dna.snp.GenotypeTableBuilder
Finishes building the GenotypeTable. For HDF5 files it locks the taxa and genotype modules so that cannot be modified again.
build() - Method in class net.maizegenetics.dna.snp.io.BuilderFromHapMap
 
build(hapmapFileBGZip) - Static method in class net.maizegenetics.dna.snp.io.BuilderFromHapMapLIX
 
build(hapmapFileBGZip, indexFilename) - Static method in class net.maizegenetics.dna.snp.io.BuilderFromHapMapLIX
 
build() - Method in class net.maizegenetics.dna.snp.io.BuilderFromPLINK
 
build() - Method in class net.maizegenetics.dna.snp.io.BuilderFromVCF
 
build() - Method in class net.maizegenetics.dna.snp.io.BuilderFromVCFUsingHTSJDK
 
build() - Method in class net.maizegenetics.dna.snp.io.LineIndexBuilder
 
build() - Method in class net.maizegenetics.dna.snp.MaskMatrixBuilder
 
build() - Method in class net.maizegenetics.dna.snp.ProjectionBuilder
 
build() - Method in class net.maizegenetics.dna.snp.score.AlleleDepthBuilder
 
build() - Method in class net.maizegenetics.dna.snp.score.AlleleProbabilityBuilder
 
build() - Method in class net.maizegenetics.dna.snp.score.DosageBuilder
 
build() - Method in class net.maizegenetics.dna.snp.score.HDF5AlleleDepthBuilder
 
build() - Method in class net.maizegenetics.dna.snp.score.ReferenceProbabilityBuilder
 
build() - Method in class net.maizegenetics.dna.snp.TranslateIndexBuilder
 
build() - Method in class net.maizegenetics.dna.tag.TagBuilder
 
build() - Method in class net.maizegenetics.phenotype.GenotypePhenotypeBuilder
 
build() - Method in class net.maizegenetics.phenotype.PhenotypeBuilder
 
build() - Method in class net.maizegenetics.plugindef.PluginParameter.Builder
 
build() - Method in class net.maizegenetics.taxa.distance.DistanceMatrixBuilder
 
build() - Method in class net.maizegenetics.taxa.TaxaListBuilder
 
build() - Method in class net.maizegenetics.taxa.Taxon.Builder
 
build() - Method in class net.maizegenetics.util.ColumnMatrix.Builder
 
build() - Method in class net.maizegenetics.util.GeneralAnnotationStorage.Builder
 
build() - Method in class net.maizegenetics.util.GraphBuilder
 
build() - Method in class net.maizegenetics.util.TableReportBuilder
 
buildAndSortInMemory() - Method in class net.maizegenetics.dna.snp.io.BuilderFromVCF
 
Builder(site1, site2) - Constructor for class net.maizegenetics.analysis.popgen.LDResult.Builder
 
Builder(tagSet) - Constructor for class net.maizegenetics.analysis.rna.FindMatchByWordHash.Builder
 
Builder(chr, position) - Constructor for class net.maizegenetics.dna.map.GeneralPosition.Builder
Constructor requires a Position before annotation of the position
Builder(chr, position, annotationBuilder) - Constructor for class net.maizegenetics.dna.map.GeneralPosition.Builder
 
Builder(aCorePosition) - Constructor for class net.maizegenetics.dna.map.GeneralPosition.Builder
Constructor from an existing position
builder(chromosomeNumber, positionWithinChromosome) - Static method in interface net.maizegenetics.dna.map.Position
Create Position Builder given chromosome number and position.
builder(chromosomeName, positionWithinChromosome) - Static method in interface net.maizegenetics.dna.map.Position
Create Position Builder given chromosome name and position.
Builder(cmdLineName, defaultValue, type) - Constructor for class net.maizegenetics.plugindef.PluginParameter.Builder
 
Builder(aTaxon) - Constructor for class net.maizegenetics.taxa.Taxon.Builder
Constructor for Builder, requires a Taxon object
Builder(aTaxonName) - Constructor for class net.maizegenetics.taxa.Taxon.Builder
Constructor for Builder, requires a Taxon name
Builder(numRows, numColumns) - Constructor for class net.maizegenetics.util.ColumnMatrix.Builder
 
BuilderFromGenotypeHDF5 - Class in net.maizegenetics.dna.snp.io
Provides Builder and methods to build HDF5 files. The methods for merging files work, but they are far from optimal. It appears that they are taking twice the memory that they should. Ed has looked for the memory leak with a profiler but cannot find it yet. Todo: TAS-70 Details the issues with apparent memory leak.
BuilderFromGVCF - Class in net.maizegenetics.dna.snp.io
Created by zrm22 on 3/24/17.
BuilderFromHapMap - Class in net.maizegenetics.dna.snp.io
 
BuilderFromHapMapLIX - Class in net.maizegenetics.dna.snp.io
 
BuilderFromPLINK - Class in net.maizegenetics.dna.snp.io
 
BuilderFromVCF - Class in net.maizegenetics.dna.snp.io
Create an alignment based on VCF format file (either .txt or compressed). Alleles are set as global reference. e.g. code
BuilderFromVCFUsingHTSJDK - Class in net.maizegenetics.dna.snp.io
This builder reads a VCF formatted file and creates a interface GenotypeTable
BuilderFromVCFUtil - Class in net.maizegenetics.util
 
buildFromHDF5(reader) - Method in class net.maizegenetics.taxa.TaxaListBuilder
Builds TaxaList with annotations from an HDF5 file. The list of Taxa and annotations come from the /Taxa/ path. This maybe a super set of what is present in the /Genotypes/ or /TBT/ paths.
buildFromHDF5Genotypes(reader) - Method in class net.maizegenetics.taxa.TaxaListBuilder
Builds TaxaList with annotations from an HDF5 file. The list of Taxa come from the those taxa that have been genotyped (in /Genotypes/ path), while the annotations come from the /Taxa/ path. Frequently these two lists are identical, but sometimes this can Genotypes can have a subset of the taxa in /Taxa/
buildHapmapIndex(filename) - Static method in class net.maizegenetics.dna.snp.io.LineIndexBuilder
 
buildHDF5(filename) - Static method in class net.maizegenetics.dna.snp.genotypecall.GenotypeCallTableBuilder
 
buildHDF5(reader) - Static method in class net.maizegenetics.dna.snp.genotypecall.GenotypeCallTableBuilder
 
buildOptimalAlignment() - Method in class net.maizegenetics.analysis.gbs.neobio.CrochemoreLandauZivUkelson
Retrieves an optimal alignment between the loaded sequences. See subclasses for actual implementation.
buildOptimalAlignment() - Method in class net.maizegenetics.analysis.gbs.neobio.CrochemoreLandauZivUkelsonGlobalAlignment
Builds an optimal global alignment between the loaded sequences after the block table has been computed. This method traces a path back in the block table, from the last block to the first.
buildOptimalAlignment() - Method in class net.maizegenetics.analysis.gbs.neobio.CrochemoreLandauZivUkelsonLocalAlignment
Builds an optimal local alignment between the loaded sequences after the block table has been computed by tracing a path back in the block table.
buildOptimalAlignment() - Method in class net.maizegenetics.analysis.gbs.neobio.NeedlemanWunsch
Builds an optimal global alignment between the loaded sequences. Before it is executed, the dynamic programming matrix must already have been computed by the computeMatrix method.
buildOptimalAlignment() - Method in class net.maizegenetics.analysis.gbs.neobio.SmithWaterman
Builds an optimal local alignment between the loaded sequences. Before it is executed, the dynamic programming matrix must already have been computed by the computeMatrix method.
buildPivotTBTPlugin() - Method in class net.maizegenetics.analysis.gbs.pana.PanAUsageExample
 
buildTagBlockPositionPlugin() - Method in class net.maizegenetics.analysis.gbs.pana.PanAUsageExample
 
buildTrainingSetPlugin() - Method in class net.maizegenetics.analysis.gbs.pana.PanAUsageExample
 
BuildUnfinishedHDF5GenotypesPlugin - Class in net.maizegenetics.analysis.data
Opens an "unfinished" HDF5 genotypes file, on which .closeUnfinished() was called rather than .build() and finalizes it by calling .build(). If an output file name is provided, then the input file is first copied to that, and then build() is called on that copy. If provided, root level annotations DataSetName and DataSetDescription are also added. "__DATE__" in the provided dataSet name is replaced a current date stamp ("_yyyyMMdd"). "__SNPS__" and "__TAXA__" in the dataSetDescription are replaced with the number of sites and taxa, respectively.
BuildUnfinishedHDF5GenotypesPlugin() - Constructor for class net.maizegenetics.analysis.data.BuildUnfinishedHDF5GenotypesPlugin
 
BuildUnfinishedHDF5GenotypesPlugin(parentFrame, isInteractive) - Constructor for class net.maizegenetics.analysis.data.BuildUnfinishedHDF5GenotypesPlugin
 
buildWithSiteRedirect() - Method in class net.maizegenetics.dna.map.PositionListBuilder
 
by_mean() - Method in class net.maizegenetics.analysis.numericaltransform.ImputationPlugin
 
by_mean(value) - Method in class net.maizegenetics.analysis.numericaltransform.ImputationPlugin
 
byErrorRateOrdering - Static variable in class net.maizegenetics.analysis.popgen.DonorHypoth
 
byPrevalenceOrdering - Static variable in class net.maizegenetics.analysis.popgen.DonorHypoth
 
byPValueOrdering - Static variable in class net.maizegenetics.analysis.popgen.LDResult
 
byR2Ordering - Static variable in class net.maizegenetics.analysis.popgen.LDResult
 
Byte2D - Interface in net.maizegenetics.dna.snp.byte2d
 
Byte2DBuilder - Class in net.maizegenetics.dna.snp.byte2d
Builder to store 2 dimensional byte encoded values.
BYTE_BLOCK_SCHEMA - Static variable in class net.maizegenetics.analysis.avro.AvroConstants
 
BYTE_MISSING - Static variable in interface net.maizegenetics.dna.map.TOPMInterface
 
BYTE_REPRESENTING_NAN - Static variable in class net.maizegenetics.dna.snp.score.SiteScoreUtil
 
BYTE_SCHEMA - Static variable in class net.maizegenetics.analysis.avro.AvroConstants
 
byteCounts(genotypes) - Static method in class net.maizegenetics.analysis.imputation.RandomGenotypeImputationPlugin
 
byteHaplotypeAsString(hap) - Method in class net.maizegenetics.analysis.clustering.HaplotypeCluster
Converts a byte sequence to a String
byteToFloatPercentage(value) - Static method in class net.maizegenetics.dna.snp.score.SiteScoreUtil
Converts byte value to float percentage.
byteToFloatPercentage(values) - Static method in class net.maizegenetics.dna.snp.score.SiteScoreUtil
 

C

C - Variable in class net.maizegenetics.analysis.gbs.neobio.LocalAlignmentBlock
The value of the highest scoring path contained in this block, called C-path.
c - Variable in class net.maizegenetics.stats.EMMA.EMMAforDoubleMatrix
 
C_ALLELE - Static variable in class net.maizegenetics.dna.snp.NucleotideAlignmentConstants
 
C_DIPLOID_ALLELE - Static variable in class net.maizegenetics.dna.snp.NucleotideAlignmentConstants
 
calcAccuracy(imputed, runtime) - Method in class net.maizegenetics.analysis.imputation.FILLINImputationAccuracy
 
calcAllelePresenceCountsBtwTargetAndDonors(modBitsOfTarget, donorAlign) - Static method in class net.maizegenetics.analysis.imputation.FILLINImputationUtils
Counts union and intersection of major and minor alleles between the target genotype and potential donor genotypes. The counts are done by 64 sites block. These counts can be quickly used to estimate distance for the set of blocks.
calcBitPresenceFromGenotype(genotype, mjA, mnA) - Static method in class net.maizegenetics.dna.snp.GenotypeTableUtils
Method for getting TBits rapidly from major and minor allele arrays
calcBitPresenceFromGenotype(genotype, referenceValues) - Static method in class net.maizegenetics.dna.snp.GenotypeTableUtils
 
calcBitPresenceFromGenotype(genotype, mj, mn) - Static method in class net.maizegenetics.dna.snp.GenotypeTableUtils
Method for getting Site Bits rapidly from major and minor alleles
calcBitPresenceFromGenotype(genotype, referenceValue) - Static method in class net.maizegenetics.dna.snp.GenotypeTableUtils
 
calcBitPresenceFromGenotype15(genotype, mjA, mnA) - Static method in class net.maizegenetics.dna.snp.GenotypeTableUtils
Method for getting TBits rapidly from major and minor allele arrays
calcBitPresenceOfDiploidValueFromGenotype(genotype, diploidValue) - Static method in class net.maizegenetics.dna.snp.GenotypeTableUtils
Returns BitSet indicating presence of given diploid value in genotype. This does unphased comparisons, so the order of the two allele values do not matter. If given diploid value is UNKNOWN, then it doesn't match anything. Bits set to 1 indicate match.
calcBitUnknownPresenceFromGenotype(genotype) - Static method in class net.maizegenetics.dna.snp.GenotypeTableUtils
 
calcContigencyChiSquare(permutations) - Method in class net.maizegenetics.stats.statistics.ContigencyTable
This calculates the probability in the normal approach, using the Chi Square as the test statistic.
calcIdentity(querySeq, refSeq) - Static method in class net.maizegenetics.analysis.rna.FindMatchByWordHash
 
calcMonteCarloExactTest(permutations) - Method in class net.maizegenetics.stats.statistics.ContigencyTable
This calculates the probability in the normal permutation approach, using the method described by Weir, B. S. (1996) Genetic Data Analysis II (Sinauer, Sunderland, MA).
calcRapidContigencyChiSquare(maxPermutations) - Method in class net.maizegenetics.stats.statistics.ContigencyTable
This calculates the probability in a rapid approach, using the Chi Square as the test statistic. It runs for maxPermutations permutations unless it find 10 values that beat the observed, and then it stops and calculates the p-value. This slighly biases the P-values but makes it much more rapid.
calcRapidMonteCarloExactTest(maxPermutations) - Method in class net.maizegenetics.stats.statistics.ContigencyTable
This calculates the probability in the rapid permutational approach, using the method described by Weir, B. S. (1996) Genetic Data Analysis II (Sinauer, Sunderland, MA) It runs for 1000 permutations unless it find 10 values that beat the observed, and then it stops and calculates the p-value. This slighly biases the P-values but makes it much more rapid.
calcTop2Depths(siteAlleleDepths) - Static method in class net.maizegenetics.dna.snp.io.VCFUtil
 
calculate() - Method in class net.maizegenetics.analysis.imputation.ViterbiAlgorithm
 
calculate() - Method in class net.maizegenetics.analysis.imputation.ViterbiAlgorithmVariableStateNumber
 
calculateAccuracy() - Method in class net.maizegenetics.analysis.imputation.FILLINImputationPlugin
Masks input file before imputation and calculates accuracy based on masked genotypes
calculateAccuracy(value) - Method in class net.maizegenetics.analysis.imputation.FILLINImputationPlugin
Set Calculate accuracy. Masks input file before imputation and calculates accuracy based on masked genotypes
calculateAccuracyWithinMAFCategories() - Method in class net.maizegenetics.analysis.imputation.FILLINImputationPlugin
Calculate R2 accuracy within MAF categories based on donor file
calculateAccuracyWithinMAFCategories(value) - Method in class net.maizegenetics.analysis.imputation.FILLINImputationPlugin
Set Calculate accuracy within MAF categories. Calculate R2 accuracy within MAF categories based on donor file
calculateAlpha() - Method in class net.maizegenetics.analysis.imputation.BackwardForwardAlgorithm
 
calculateAlpha() - Method in class net.maizegenetics.analysis.imputation.BackwardForwardVariableStateNumber
 
calculateBeta() - Method in class net.maizegenetics.analysis.imputation.BackwardForwardAlgorithm
 
calculateBeta() - Method in class net.maizegenetics.analysis.imputation.BackwardForwardVariableStateNumber
 
calculateBitLDForHaplotype(ignoreHets, minTaxaForEstimate, alignment, site1, site2) - Static method in class net.maizegenetics.analysis.popgen.LinkageDisequilibrium
 
calculateBitLDForHaplotype(minTaxaForEstimate, minorCnt, alignment, site1, site2) - Static method in class net.maizegenetics.analysis.popgen.LinkageDisequilibrium
 
calculateBLUP() - Method in class net.maizegenetics.stats.EMMA.EMMAforDoubleMatrix
 
calculateBlupsPredicted() - Method in class net.maizegenetics.stats.EMMA.EMMAforDoubleMatrix
 
calculateBlupsPredictedResiduals() - Method in class net.maizegenetics.stats.EMMA.EMMAforDoubleMatrix
 
calculateCladeProbabilities(tree, cladeSystems) - Static method in class net.maizegenetics.taxa.tree.CladeSystem
 
calculateCorrelations(tagTagCorrelations, tagTaxaMap, tag1, tag2, ddepths1, depthsPrime1) - Method in class net.maizegenetics.analysis.gbs.repgen.RepGenLDAnalysisPlugin
 
calculateDistanceFromKin(kin) - Method in class net.maizegenetics.analysis.association.CompressedMLMusingDoubleMatrix
 
calculateDPrime(countAB, countAb, countaB, countab, minTaxaForEstimate) - Static method in class net.maizegenetics.analysis.popgen.LinkageDisequilibrium
 
calculateFfromR2(r2, markerDf, errorDf) - Static method in class net.maizegenetics.stats.linearmodels.SolveByOrthogonalizing
 
calculateP(F, markerDf, errorDf) - Static method in class net.maizegenetics.stats.linearmodels.SolveByOrthogonalizing
 
calculatePCsAcrossNAMFounders(chr, theGenotypesForCalculatingPCs, chrVector, posVector, startPosVector, endPosVector, increment, selectedColumns) - Method in class net.maizegenetics.analysis.data.ProjectPcsAndRunModelSelectionPlugin
 
calculatePEV - Variable in class net.maizegenetics.stats.EMMA.EMMAforDoubleMatrix
 
calculateR2Fromp(alpha, modelDf, errorDf) - Static method in class net.maizegenetics.stats.linearmodels.SolveByOrthogonalizing
 
calculateRSqr(countAB, countAb, countaB, countab, minTaxaForEstimate) - Static method in class net.maizegenetics.analysis.popgen.LinkageDisequilibrium
 
calculateTagAveQS(tagCntQSMap, qualityScoreBase) - Static method in class net.maizegenetics.analysis.gbs.repgen.RepGenLoadSeqToDBPlugin
 
calculateV(ZKZ, genvar, resvar) - Method in class net.maizegenetics.analysis.association.CompressedMLMusingDoubleMatrix
 
calculateV(ZKZ, W, genvar, resvar) - Method in class net.maizegenetics.analysis.association.CompressedMLMusingDoubleMatrix
 
call() - Method in class net.maizegenetics.analysis.phg.ParseGVCF.ProcessLines
 
callBasedOnDepth(genoDepths) - Method in class net.maizegenetics.dna.snp.genotypecall.BasicGenotypeMergeRule
 
callBasedOnDepth(genoDepths) - Method in class net.maizegenetics.dna.snp.genotypecall.BasicGenotypeMergeRule
 
callBasedOnDepth(genoDepths) - Method in interface net.maizegenetics.dna.snp.genotypecall.GenotypeMergeRule
Makes a genotypic call based on allele depths
callBasedOnDepth(genoDepths) - Method in interface net.maizegenetics.dna.snp.genotypecall.GenotypeMergeRule
Makes a genotypic call based on allele depths
callBasedOnDepth(genoDepths) - Method in class net.maizegenetics.dna.snp.genotypecall.HighestDepthGenotypeMergeRule
 
callBasedOnDepth(genoDepths) - Method in class net.maizegenetics.dna.snp.genotypecall.HighestDepthGenotypeMergeRule
 
callBasedOnDepth(genoDepths) - Method in class net.maizegenetics.dna.snp.genotypecall.SetToNGenotypeMergeRule
 
callBasedOnDepth(genoDepths) - Method in class net.maizegenetics.dna.snp.genotypecall.SetToNGenotypeMergeRule
 
callBiallelicSNPsWithGap() - Method in class net.maizegenetics.analysis.gbs.DiscoverySNPCallerPlugin
Include sites where the third allele is a GAP (mutually exclusive with inclGaps)
callBiallelicSNPsWithGap(value) - Method in class net.maizegenetics.analysis.gbs.DiscoverySNPCallerPlugin
Set Call Biallelic SNPs with Gap. Include sites where the third allele is a GAP (mutually exclusive with inclGaps)
callMergeSelection() - Method in class net.maizegenetics.analysis.data.MergeGenotypeTablesPluginV2
Selection for Call Merging
callMergeSelection(value) - Method in class net.maizegenetics.analysis.data.MergeGenotypeTablesPluginV2
Set Call Merge Rule. Selection for Call Merging
callParentAllelesByWindow(popdata, maxMissing, minMaf, windowSize, minR) - Static method in class net.maizegenetics.analysis.imputation.NucleotideImputationUtils
 
callParentAllelesByWindowForBackcrosses(popdata, maxMissing, minMaf, windowSize, minR) - Static method in class net.maizegenetics.analysis.imputation.NucleotideImputationUtils
 
callParentAllelesByWindowForMultipleBC(popdata, maxMissing, minMinorAlleleCount, windowSize) - Static method in class net.maizegenetics.analysis.imputation.NucleotideImputationUtils
 
CallParentAllelesPlugin - Class in net.maizegenetics.analysis.imputation
 
CallParentAllelesPlugin(parentFrame) - Constructor for class net.maizegenetics.analysis.imputation.CallParentAllelesPlugin
 
callParentAllelesUsingClusters(popdata, maxMissing, minMaf, windowSize, checkSubpops) - Static method in class net.maizegenetics.analysis.imputation.NucleotideImputationUtils
 
callParentAllelesUsingClustersOnly(popdata, maxMissing, minMaf, windowSize, checkSubpops) - Static method in class net.maizegenetics.analysis.imputation.NucleotideImputationUtils
 
callParentAllelesUsingTaxaGroups(family, taxaGroups, snpList) - Static method in class net.maizegenetics.analysis.imputation.NucleotideImputationUtils
 
cancel() - Method in class net.maizegenetics.plugindef.AbstractPlugin
 
cancel() - Method in interface net.maizegenetics.plugindef.Plugin
Attempt to cancel processing.
capacity() - Method in interface net.maizegenetics.util.BitSet
Returns capacity.
capacity() - Method in class net.maizegenetics.util.OpenBitSet
Returns the current capacity in bits (1 greater than the index of the last bit)
capacity() - Method in class net.maizegenetics.util.UnmodifiableBitSet
 
cardinality() - Method in interface net.maizegenetics.util.BitSet
 
cardinality(index) - Method in interface net.maizegenetics.util.BitSet
Return number of set bits up to and including bit at given index.
cardinality() - Method in class net.maizegenetics.util.OpenBitSet
 
cardinality(index) - Method in class net.maizegenetics.util.OpenBitSet
 
cardinality() - Method in class net.maizegenetics.util.UnmodifiableBitSet
 
cardinality(index) - Method in class net.maizegenetics.util.UnmodifiableBitSet
 
case_sensitive - Variable in class net.maizegenetics.analysis.gbs.neobio.ScoringScheme
Determines whether this scoring scheme ignores the case of characters when computing their score. It is set by the constructor and cannot be changed afterwards.
CategoricalAttribute - Class in net.maizegenetics.phenotype
 
CategoricalAttribute(name, stringValues) - Constructor for class net.maizegenetics.phenotype.CategoricalAttribute
 
cdf(x, n) - Static method in class net.maizegenetics.stats.statistics.ApproxFastChiSquareDistribution
cumulative density function of the chi-square distribution
cdf(x, n) - Static method in class net.maizegenetics.stats.statistics.ChiSquareDistribution
cumulative density function of the chi-square distribution
cdf(x, lambda) - Static method in class net.maizegenetics.stats.statistics.ExponentialDistribution
cumulative density function of the exponential distribution
cdf(x, shape, scale) - Static method in class net.maizegenetics.stats.statistics.GammaDistribution
cumulative density function of the Gamma distribution
cdf(x, m, sd) - Static method in class net.maizegenetics.stats.statistics.NormalDistribution
cumulative density function
cdf(x, k, m) - Static method in class net.maizegenetics.stats.statistics.ParetoDistribution
cumulative density function of the Pareto distribution
cdfFastApprox(x, n) - Method in class net.maizegenetics.stats.statistics.ApproxFastChiSquareDistribution
cumulative density function of the chi-square distribution
center(values) - Static method in class net.maizegenetics.stats.linearmodels.SolveByOrthogonalizing
 
centerAndScale(values) - Static method in class net.maizegenetics.stats.linearmodels.SolveByOrthogonalizing
 
CENTERED_IBS_SUMPK - Static variable in class net.maizegenetics.taxa.distance.DistanceMatrixBuilder
 
changeAlignmentIdentifiers(alternateIdGroups) - Method in class net.maizegenetics.taxa.IdentifierSynonymizer
 
changeAttributeType(changeMap) - Method in class net.maizegenetics.phenotype.PhenotypeBuilder
 
changeData(newdata) - Method in class net.maizegenetics.stats.linearmodels.LinearModelForStepwiseRegression
 
ChangeLog - Class in net.maizegenetics.util
This outputs the change logs messages in HTML for tassel-5-source since this last "New Build Date" message. The results can be added to Tassel5ChangeHistory.html on the website.
changeName(newName) - Method in class net.maizegenetics.phenotype.CategoricalAttribute
 
changeName(newName) - Method in class net.maizegenetics.phenotype.NumericAttribute
 
changeName(newName) - Method in interface net.maizegenetics.phenotype.PhenotypeAttribute
 
changeName(newName) - Method in class net.maizegenetics.phenotype.TaxaAttribute
 
characteristics() - Method in class net.maizegenetics.analysis.modelfitter.CovariatePermutationTestSpliterator
 
characteristics() - Method in class net.maizegenetics.analysis.modelfitter.ForwardStepAdditiveSpliterator
 
characteristics() - Method in class net.maizegenetics.analysis.modelfitter.NestedCovariatePermutationTestSpliterator
 
characteristics() - Method in class net.maizegenetics.dna.map.PositionList.PositionListCollector
 
characteristics() - Method in class net.maizegenetics.taxa.TaxaList.TaxaListCollector
 
characteristics() - Method in class net.maizegenetics.util.BitSet.BitSetListCollector
 
charAt(pos) - Method in class net.maizegenetics.analysis.gbs.neobio.CharSequence
Returns the character at a given position. For the client, the first character is at position 1, while the last character is at position length(). This is convinient for sequence alignment algorithms based on a classic dynamic programming matrix since the sequences usually start at row/column 1. This method does not check boundaries, therefore an ArrayIndexOutOfBoundsException may be raised if pos is out of bounds.
CharSequence - Class in net.maizegenetics.analysis.gbs.neobio
This class implements a sequence of characters stored as an array that provides random access to any position in constant time.
CharSequence(reader) - Constructor for class net.maizegenetics.analysis.gbs.neobio.CharSequence
Creates a new instance of a CharSequence, loading the sequence data from the Reader input stream.
ChartDisplayPlugin - Class in net.maizegenetics.analysis.chart
 
ChartDisplayPlugin(parentFrame, isInteractive) - Constructor for class net.maizegenetics.analysis.chart.ChartDisplayPlugin
Creates a new instance of ChartDisplayPlugin
ChartDisplayPlugin.ChartType - Enum in net.maizegenetics.analysis.chart
 
checkAlignmentOrderIgnoringParents(alignments, family, r) - Static method in class net.maizegenetics.analysis.imputation.NucleotideImputationUtils
 
checkParentage(popdata) - Static method in class net.maizegenetics.analysis.imputation.NucleotideImputationUtils
Checks whether alleleA is parent1 and alleleC is parent2. If not, switches them.
checkQuery(query) - Static method in class net.maizegenetics.analysis.data.GenomeAnnosDBQueryToPositionListPlugin
Checks that the query is safe and that the results will contain fields labeled "chr" & "position".
checksubpops(popdata, halfWindowSize) - Static method in class net.maizegenetics.analysis.imputation.NucleotideImputationUtils
 
CheckSum - Class in net.maizegenetics.util
 
checkSynForDups() - Method in class net.maizegenetics.taxa.IdentifierSynonymizer
 
chiSquareDf1(ob1, ob2, ex1, ex2, chiValueCutoff) - Method in class net.maizegenetics.analysis.gbs.Clusters
 
ChiSquareDistribution - Class in net.maizegenetics.stats.statistics
chi-square distribution (distribution of sum of squares of n uniform random variables) (Parameter: n; mean: n; variance: 2*n) The chi-square distribution is a special case of the Gamma distribution (shape parameter = n/2.0, scale = 2.0).
chiSquareEvenDf1(ob1, ob2, chiValueCutoff) - Method in class net.maizegenetics.analysis.gbs.Clusters
 
ChiSquareTest - Class in net.maizegenetics.stats.statistics
chi-square test
chooseEnzyme(enzyme) - Static method in class net.maizegenetics.analysis.gbs.ParseBarcodeRead
Determines which cut sites to look for, and sets them, based on the enzyme used to generate the GBS library. For two-enzyme GBS both enzymes MUST be specified and separated by a dash "-". e.g. PstI-MspI, SbfI-MspI
chr() - Method in class net.maizegenetics.dna.snp.io.ReadBedfile.BedFileRange
Return chromosome
chrB - Variable in class net.maizegenetics.dna.map.AbstractPETagsOnPhysicalMap
 
chrContig - Variable in class net.maizegenetics.dna.map.AbstractPETagsOnPhysicalMap
 
chrEndIndex - Variable in class net.maizegenetics.analysis.gbs.SimpleGenotypeSBit
Last SNP index of gt chromosome in the whole SNP list, exclusive
chrF - Variable in class net.maizegenetics.dna.map.AbstractPETagsOnPhysicalMap
 
chrName - Variable in class net.maizegenetics.analysis.modelfitter.AbstractAdditiveSite
 
chrNum - Variable in class net.maizegenetics.analysis.gbs.SimpleGenotypeSBit
 
chrom() - Method in class net.maizegenetics.analysis.gbs.v2.SNPCutPosTagVerificationPlugin
Chromosome as String
chrom(value) - Method in class net.maizegenetics.analysis.gbs.v2.SNPCutPosTagVerificationPlugin
Set outputDir path. Directory file path where output files will be writen
chromosomalPosition(site) - Method in interface net.maizegenetics.dna.map.PositionList
Returns the physical position at given site.
chromosomalPosition(site) - Method in class net.maizegenetics.dna.snp.CombineGenotypeTable
 
chromosomalPosition(site) - Method in class net.maizegenetics.dna.snp.CoreGenotypeTable
 
chromosomalPosition(site) - Method in interface net.maizegenetics.dna.snp.GenotypeTable
Returns the physical position at given site.
chromosomalPosition(site) - Method in class net.maizegenetics.dna.snp.MergedGenotypeTable
 
chromosomalPosition(site) - Method in class net.maizegenetics.dna.snp.TOPMGenotypeTable
 
chromosome() - Method in class net.maizegenetics.analysis.gbs.repgen.RefTagData
 
chromosome - Variable in class net.maizegenetics.analysis.imputation.PopulationData
 
chromosome() - Method in class net.maizegenetics.analysis.phg.ParseGVCF.GVCFLine
 
Chromosome - Class in net.maizegenetics.dna.map
Defines the chromosome structure and length. The name and length recorded for each chromosome.
Chromosome(name) - Constructor for class net.maizegenetics.dna.map.Chromosome
Deprecated. 
chromosome(val) - Method in class net.maizegenetics.dna.map.GeneralPosition.Builder
Set Chromosome
chromosome() - Method in class net.maizegenetics.dna.map.GenomeFeature
 
chromosome(chr) - Method in class net.maizegenetics.dna.map.GenomeFeatureBuilder
 
chromosome(chr) - Method in class net.maizegenetics.dna.map.GenomeFeatureBuilder
 
chromosome(chr) - Method in class net.maizegenetics.dna.map.GenomeFeatureBuilder
 
chromosome(site) - Method in interface net.maizegenetics.dna.map.PositionList
Return Chromosome for given site.
chromosome(name) - Method in interface net.maizegenetics.dna.map.PositionList
Return Chromosome with matching name. First to match will be returned.
chromosome - Variable in class net.maizegenetics.dna.map.TagGeneticMappingInfo
Chromosome of the most significant site
chromosome - Variable in class net.maizegenetics.dna.map.TagMappingInfo
Chromosome as an integer
chromosome - Variable in class net.maizegenetics.dna.map.TagMappingInfoV3
Chromosome as an integer, unknown = Integer.MIN_VALUE
chromosome(site) - Method in class net.maizegenetics.dna.snp.CombineGenotypeTable
 
chromosome(name) - Method in class net.maizegenetics.dna.snp.CombineGenotypeTable
 
chromosome(site) - Method in class net.maizegenetics.dna.snp.CoreGenotypeTable
 
chromosome(name) - Method in class net.maizegenetics.dna.snp.CoreGenotypeTable
 
chromosome(site) - Method in interface net.maizegenetics.dna.snp.GenotypeTable
Return Chromosome for given site.
chromosome(name) - Method in interface net.maizegenetics.dna.snp.GenotypeTable
Return Chromosome with matching name. First to match will be returned.
chromosome(site) - Method in class net.maizegenetics.dna.snp.MergedGenotypeTable
 
chromosome(name) - Method in class net.maizegenetics.dna.snp.MergedGenotypeTable
 
chromosome(site) - Method in class net.maizegenetics.dna.snp.TOPMGenotypeTable
 
chromosome(name) - Method in class net.maizegenetics.dna.snp.TOPMGenotypeTable
 
CHROMOSOME_INDICES - Static variable in class net.maizegenetics.util.Tassel5HDF5Constants
 
CHROMOSOME_SCHEMA - Static variable in class net.maizegenetics.analysis.avro.AvroConstants
 
chromosomeName() - Method in class net.maizegenetics.analysis.modelfitter.AbstractAdditiveSite
 
chromosomeName() - Method in interface net.maizegenetics.analysis.modelfitter.AdditiveSite
 
chromosomeName(site) - Method in interface net.maizegenetics.dna.map.PositionList
Return Chromosome Name for given site.
chromosomeName(site) - Method in class net.maizegenetics.dna.snp.CombineGenotypeTable
 
chromosomeName(site) - Method in class net.maizegenetics.dna.snp.CoreGenotypeTable
 
chromosomeName(site) - Method in interface net.maizegenetics.dna.snp.GenotypeTable
Return Chromosome Name for given site.
chromosomeName(site) - Method in class net.maizegenetics.dna.snp.MergedGenotypeTable
 
chromosomeName(site) - Method in class net.maizegenetics.dna.snp.TOPMGenotypeTable
 
chromosomeNumber - Variable in class net.maizegenetics.analysis.gbs.SimpleGenotypeSBit
 
chromosomes() - Method in interface net.maizegenetics.dna.map.GenomeSequence
Returns a list of chromosomes whose sequences have been stored in the chromsomeSequence map of the class implementing this interface. Return empty set if empty.
chromosomes() - Method in interface net.maizegenetics.dna.map.PositionList
Return all chromosomes.
chromosomes() - Method in class net.maizegenetics.dna.snp.CombineGenotypeTable
 
chromosomes() - Method in class net.maizegenetics.dna.snp.CoreGenotypeTable
 
chromosomes() - Method in interface net.maizegenetics.dna.snp.GenotypeTable
Return all chromosomes.
chromosomes() - Method in class net.maizegenetics.dna.snp.MergedGenotypeTable
 
chromosomes() - Method in class net.maizegenetics.dna.snp.TOPMGenotypeTable
 
chromosomes - Variable in class net.maizegenetics.plugindef.GenerateRCode.PositionVectors
 
CHROMOSOMES - Static variable in class net.maizegenetics.util.Tassel5HDF5Constants
 
chromosomeSequence(chrom) - Method in interface net.maizegenetics.dna.map.GenomeSequence
Takes a Chromosome object and returns the stored byte array representing the genomic sequence for the specified chromosome.
chromosomeSequence(chrom, startSite, endSite) - Method in interface net.maizegenetics.dna.map.GenomeSequence
Returns the partial genomic sequence for a chromosome, from the specified start position to the specified end position. THe start/end positions are inclusive and the request is 1-based (though the alleles are stored in a 0-based byte array).
chromosomeSequenceAndStats(chrom, startSite, lastSite) - Method in interface net.maizegenetics.dna.map.GVCFGenomeSequence
 
chromosomeSiteCount(chromosome) - Method in interface net.maizegenetics.dna.map.PositionList
Return number of sites for given Chromosome
chromosomeSiteCount(locus) - Method in class net.maizegenetics.dna.snp.CombineGenotypeTable
 
chromosomeSiteCount(chromosome) - Method in class net.maizegenetics.dna.snp.CoreGenotypeTable
 
chromosomeSiteCount(chromosome) - Method in interface net.maizegenetics.dna.snp.GenotypeTable
Return number of sites for given chromosome.
chromosomeSiteCount(chromosome) - Method in class net.maizegenetics.dna.snp.MergedGenotypeTable
 
chromosomeSiteCount(chromosome) - Method in class net.maizegenetics.dna.snp.TOPMGenotypeTable
 
chromosomeSize(chromosome) - Method in interface net.maizegenetics.dna.map.GenomeSequence
Returns the length of the current chromsome
chromosomesOffsets() - Method in interface net.maizegenetics.dna.map.PositionList
Returns starting site for each chromosome.
chromosomesOffsets() - Method in class net.maizegenetics.dna.snp.CombineGenotypeTable
 
chromosomesOffsets() - Method in class net.maizegenetics.dna.snp.CoreGenotypeTable
 
chromosomesOffsets() - Method in interface net.maizegenetics.dna.snp.GenotypeTable
Returns starting site for each chromosome.
chromosomesOffsets() - Method in class net.maizegenetics.dna.snp.MergedGenotypeTable
 
chromosomesOffsets() - Method in class net.maizegenetics.dna.snp.TOPMGenotypeTable
 
chrPosFile() - Method in class net.maizegenetics.analysis.filter.FilterSiteBuilderPlugin
Filter based on list of chromsome / position in file.
chrPosFile(value) - Method in class net.maizegenetics.analysis.filter.FilterSiteBuilderPlugin
Set Chr Pos File. Filter based on list of chromsome / position in file.
chrPosFile() - Method in class net.maizegenetics.dna.snp.FilterSite
 
chrStartIndex - Variable in class net.maizegenetics.analysis.gbs.SimpleGenotypeSBit
First SNP index of gt chromosome in the whole SNP list
chunkSize - Static variable in class net.maizegenetics.dna.BaseEncoder
defines the number of bases fitting with a long
chunkSizeForInt - Static variable in class net.maizegenetics.dna.BaseEncoder
 
CLADE_PROBABILITY - Variable in interface net.maizegenetics.taxa.tree.AttributeNode
attribute name for the probability of the clade defined by an internal node.
cladeCount(subtree, trees) - Static method in class net.maizegenetics.taxa.tree.RootedTreeUtils
 
CladeSystem - Class in net.maizegenetics.taxa.tree
data structure for a set of splits
CladeSystem(idGroup, size) - Constructor for class net.maizegenetics.taxa.tree.CladeSystem
 
ClassicMds - Class in net.maizegenetics.stats.PCA
 
ClassicMds(dm) - Constructor for class net.maizegenetics.stats.PCA.ClassicMds
 
cleanProgressUnit(plugin) - Method in class net.maizegenetics.progress.ProgressPanel
 
clear() - Method in class net.maizegenetics.analysis.avro.GenericArrayPositions
 
clear() - Method in class net.maizegenetics.analysis.avro.GenericArrayTaxa
 
clear() - Method in class net.maizegenetics.analysis.avro.GenericMapAnnotations
 
clear() - Method in class net.maizegenetics.dna.snp.FilterList
 
clear(index) - Method in interface net.maizegenetics.util.BitSet
Clears a bit, allowing access beyond the current set size without changing the size.
clear(startIndex, endIndex) - Method in interface net.maizegenetics.util.BitSet
Clears a range of bits. Clearing past the end does not change the size of the set.
clear(startIndex, endIndex) - Method in interface net.maizegenetics.util.BitSet
Clears a range of bits. Clearing past the end does not change the size of the set.
clear(index) - Method in class net.maizegenetics.util.OpenBitSet
clears a bit, allowing access beyond the current set size without changing the size.
clear(startIndex, endIndex) - Method in class net.maizegenetics.util.OpenBitSet
Clears a range of bits. Clearing past the end does not change the size of the set.
clear(startIndex, endIndex) - Method in class net.maizegenetics.util.OpenBitSet
Clears a range of bits. Clearing past the end does not change the size of the set.
clear() - Method in class net.maizegenetics.util.UndirectedGraph.UndirectedSet
 
clear(index) - Method in class net.maizegenetics.util.UnmodifiableBitSet
 
clear(startIndex, endIndex) - Method in class net.maizegenetics.util.UnmodifiableBitSet
 
clear(startIndex, endIndex) - Method in class net.maizegenetics.util.UnmodifiableBitSet
 
clearAlignmentData() - Method in interface net.maizegenetics.dna.tag.RepGenDataWriter
Removes all data from the DB that was added from SAMToGBSDBPlugin call. The tables cleared are CutPosition and TagCutPosition
clearAlignmentData() - Method in class net.maizegenetics.dna.tag.RepGenSQLite
 
clearAlignmentData() - Method in class net.maizegenetics.dna.tag.TagDataSQLite
 
clearAlignmentData() - Method in interface net.maizegenetics.dna.tag.TagDataWriter
Removes all data from the DB that was added from SAMToGBSDBPlugin call. The tables cleared are CutPosition and TagCutPosition
clearDiscoveryData() - Method in interface net.maizegenetics.dna.tag.RepGenDataWriter
Removes all data from the DB that was added from the DiscoverySNPCallerPluginV2 The tables cleared are Allele, TagAllele and SNPPosition
clearDiscoveryData() - Method in class net.maizegenetics.dna.tag.RepGenSQLite
 
clearDiscoveryData() - Method in class net.maizegenetics.dna.tag.TagDataSQLite
 
clearDiscoveryData() - Method in interface net.maizegenetics.dna.tag.TagDataWriter
Removes all data from the DB that was added from the DiscoverySNPCallerPluginV2 The tables cleared are Allele, TagAllele and SNPPosition
clearSNPQualityData() - Method in interface net.maizegenetics.dna.tag.RepGenDataWriter
Removes all data from the snpQuality table
clearSNPQualityData() - Method in class net.maizegenetics.dna.tag.RepGenSQLite
 
clearSNPQualityData() - Method in class net.maizegenetics.dna.tag.TagDataSQLite
 
clearSNPQualityData() - Method in interface net.maizegenetics.dna.tag.TagDataWriter
Removes all data from the snpQuality table
clearTagTaxaDistributionData() - Method in interface net.maizegenetics.dna.tag.RepGenDataWriter
Removes all data from the tagtaxadistribution table. This should be called from GBSSeqToTagDBPlugin when a user requests an "append" option (ie, db exists, and user opted NOT to clear it). AFter we grab the existing data it is cleared. It will be re-entered when GBSSeqToTagDBPlugin completes.
clearTagTaxaDistributionData() - Method in class net.maizegenetics.dna.tag.RepGenSQLite
 
clearTagTaxaDistributionData() - Method in class net.maizegenetics.dna.tag.TagDataSQLite
 
clearTagTaxaDistributionData() - Method in interface net.maizegenetics.dna.tag.TagDataWriter
Removes all data from the tagtaxadistribution table. This should be called from GBSSeqToTagDBPlugin when a user requests an "append" option (ie, db exists, and user opted NOT to clear it). AFter we grab the existing data it is cleared. It will be re-entered when GBSSeqToTagDBPlugin completes.
clearVariants() - Method in class net.maizegenetics.dna.map.TagsOnPhysicalMap
Sets the variant definition & offset arrays to null for each tag.
clearVariants() - Method in class net.maizegenetics.dna.map.TagsOnPhysicalMapV3
 
clearVariants() - Method in class net.maizegenetics.dna.map.TagsOnPhysMapHDF5
 
clearVariants() - Method in interface net.maizegenetics.dna.map.TOPMInterface
Clears all variant definitions and position offsets.
clone() - Method in class net.maizegenetics.util.OpenBitSet
 
close() - Method in class net.maizegenetics.analysis.gbs.SNPLogging
 
close() - Method in class net.maizegenetics.dna.tag.FastqReader
 
close() - Method in class net.maizegenetics.dna.tag.RepGenSQLite
 
close() - Method in class net.maizegenetics.dna.tag.TagDataSQLite
 
closeInstance() - Static method in class net.maizegenetics.tassel.TasselLogging
 
closeLogfile() - Static method in class net.maizegenetics.util.LoggingUtils
 
closeUnfinished() - Method in class net.maizegenetics.dna.snp.GenotypeTableBuilder
Used to close an HDF5 GenotypeTableBuilder, when it will be reopened later and appended. This file cannot be used for other purposes in this unfinished state.
cluster() - Method in class net.maizegenetics.analysis.imputation.FSFHapImputationPlugin
use the cluster algorithm
cluster(value) - Method in class net.maizegenetics.analysis.imputation.FSFHapImputationPlugin
Set Cluster. use the cluster algorithm
clusterBySmallestDistance(orig) - Static method in class net.maizegenetics.taxa.distance.DistanceMatrixUtils
 
clusterDistanceAveragePairDiff(cluster0, cluster1) - Static method in class net.maizegenetics.analysis.clustering.HaplotypeClusterer
 
clusterDistanceClusterDiffProportion(cluster0, cluster1) - Static method in class net.maizegenetics.analysis.clustering.HaplotypeClusterer
 
clusterDistanceClusterHaplotypeDiff(cluster0, cluster1) - Static method in class net.maizegenetics.analysis.clustering.HaplotypeClusterer
 
clusterDistanceDistinctHaplotypeProportion(cluster0, cluster1) - Static method in class net.maizegenetics.analysis.clustering.HaplotypeClusterer
 
clusterDistanceDistinctHaplotypes(cluster0, cluster1) - Static method in class net.maizegenetics.analysis.clustering.HaplotypeClusterer
 
clusterDistanceMaxPairDiff(cluster0, cluster1) - Static method in class net.maizegenetics.analysis.clustering.HaplotypeClusterer
 
clusterDistanceTotalPairDiff(cluster0, cluster1) - Static method in class net.maizegenetics.analysis.clustering.HaplotypeClusterer
 
ClusterGenotypesPlugin - Class in net.maizegenetics.analysis.imputation
 
ClusterGenotypesPlugin(parentFrame, isInteractive) - Constructor for class net.maizegenetics.analysis.imputation.ClusterGenotypesPlugin
 
clusteringMethod() - Method in class net.maizegenetics.analysis.tree.CreateTreePlugin
Clustering Method
clusteringMethod(value) - Method in class net.maizegenetics.analysis.tree.CreateTreePlugin
Set Clustering Method. Clustering Method
Clusters - Class in net.maizegenetics.analysis.gbs
 
Clusters(rbt) - Constructor for class net.maizegenetics.analysis.gbs.Clusters
 
Clusters(tbt) - Constructor for class net.maizegenetics.analysis.gbs.Clusters
 
Clusters(infileS, binary) - Constructor for class net.maizegenetics.analysis.gbs.Clusters
 
clusterWindow(a, start, length, maxdif, minNotMissingPerHaplotype) - Method in class net.maizegenetics.analysis.imputation.BiparentalHaplotypeFinder
 
clusterWindow(a, start, length, maxdif) - Static method in class net.maizegenetics.analysis.imputation.NucleotideImputationUtils
 
clusterWindow(a, start, length, maxdif, minNotMissingPerHaplotype) - Method in class net.maizegenetics.analysis.imputation.SelfedHaplotypeFinder
 
CMD_CANCEL - Static variable in class net.maizegenetics.analysis.filter.FilterTraitsDialog
 
CMD_CHANGE_COV - Static variable in class net.maizegenetics.analysis.filter.FilterTraitsDialog
 
CMD_CHANGE_DATA - Static variable in class net.maizegenetics.analysis.filter.FilterTraitsDialog
 
CMD_EXCLUDE - Static variable in class net.maizegenetics.analysis.filter.FilterTraitsDialog
 
CMD_EXCLUDE_ALL - Static variable in class net.maizegenetics.analysis.filter.FilterTraitsDialog
 
CMD_INCLUDE - Static variable in class net.maizegenetics.analysis.filter.FilterTraitsDialog
 
CMD_INCLUDE_ALL - Static variable in class net.maizegenetics.analysis.filter.FilterTraitsDialog
 
CMD_OK - Static variable in class net.maizegenetics.analysis.filter.FilterTraitsDialog
 
cmdLineName() - Method in class net.maizegenetics.plugindef.PluginParameter
 
code(ifEvidence) - Static method in enum net.maizegenetics.analysis.gbs.AnnotateTOPM.EvidenceType
 
col - Variable in class net.maizegenetics.analysis.gbs.neobio.Smawk
An array of column indexes reflecting the current state of the matrix. When columns are deleted, the corresponding indexes are simply moved to the end of the vector.
col_codes - Variable in class net.maizegenetics.analysis.gbs.neobio.ScoringMatrix
Stores matrix column headers in the order they were found.
colByte(value) - Method in class net.maizegenetics.analysis.monetdb.ColumnsToBinaryFullGenomeTablePlugin
Set Columns keep as Byte. Comma separated list of column names to generate byte binaries for
collapseCounts() - Method in class net.maizegenetics.dna.tag.PETagCounts
Collapse PETagCounts, the tag count of collapsed tags is set to 0
collapseCounts() - Method in class net.maizegenetics.dna.tag.TagCountMutable
 
collapseCounts() - Method in class net.maizegenetics.dna.tag.TagCounts
 
collect() - Static method in interface net.maizegenetics.taxa.TaxaList
Returns TaxaList Collector.
collect(numBits) - Static method in interface net.maizegenetics.util.BitSet
Returns BitSet Collector.
collectProportions(tree, trees) - Static method in class net.maizegenetics.taxa.tree.RootedTreeUtils
 
collectReorder() - Static method in interface net.maizegenetics.dna.map.PositionList
Returns PositionList Collector that reorders position if necessary.
collectTaxa(root, table) - Static method in class net.maizegenetics.taxa.tree.RootedTreeUtils
Collects all of the names of the taxa in the tree into a hashtable.
collectValidateOrder() - Static method in interface net.maizegenetics.dna.map.PositionList
Returns PositionList Collector that validates order of Positions.
colsAllele() - Method in class net.maizegenetics.analysis.monetdb.ColumnsToBinaryFullGenomeTablePlugin
Comma separated list of column names to generate byte binaries for
colsAllele(value) - Method in class net.maizegenetics.analysis.monetdb.ColumnsToBinaryFullGenomeTablePlugin
Set Columns translate allele values to 0-5. Comma separated list of column names of single character alleles to be translated from A/C/G/T/+/- to 0-5.
colsAllele() - Method in class net.maizegenetics.analysis.monetdb.ColumnsToBinarySNPOnlyTablePlugin
Comma separated list of column names to generate byte binaries for
colsAllele(value) - Method in class net.maizegenetics.analysis.monetdb.ColumnsToBinarySNPOnlyTablePlugin
Set Columns translate allele values to 0-5. Comma separated list of column names of single character alleles to be translated from A/C/G/T/+/- to 0-5.
colsByte() - Method in class net.maizegenetics.analysis.monetdb.ColumnsToBinaryFullGenomeTablePlugin
Comma separated list of column names to generate byte binaries for
colsByte() - Method in class net.maizegenetics.analysis.monetdb.ColumnsToBinarySNPOnlyTablePlugin
Comma separated list of column names to generate byte binaries for
colsByte(value) - Method in class net.maizegenetics.analysis.monetdb.ColumnsToBinarySNPOnlyTablePlugin
Set Columns keep as Byte. Comma separated list of column names to generate byte binaries for
colsChar() - Method in class net.maizegenetics.analysis.monetdb.ColumnsToBinaryFullGenomeTablePlugin
Comma separated list of column names to generate char binaries for
colsChar(value) - Method in class net.maizegenetics.analysis.monetdb.ColumnsToBinaryFullGenomeTablePlugin
Set Columns keep as Char. Comma separated list of column names to generate char binaries for
colsChar() - Method in class net.maizegenetics.analysis.monetdb.ColumnsToBinarySNPOnlyTablePlugin
Comma separated list of column names to generate char binaries for
colsChar(value) - Method in class net.maizegenetics.analysis.monetdb.ColumnsToBinarySNPOnlyTablePlugin
Set Columns keep as Char. Comma separated list of column names to generate char binaries for
colsFloat() - Method in class net.maizegenetics.analysis.monetdb.ColumnsToBinaryFullGenomeTablePlugin
Comma separated list of column names to generate real binaries for
colsFloat(value) - Method in class net.maizegenetics.analysis.monetdb.ColumnsToBinaryFullGenomeTablePlugin
Set Columns keep as Real (Float). Comma separated list of column names to generate real binaries for
colsFloat() - Method in class net.maizegenetics.analysis.monetdb.ColumnsToBinarySNPOnlyTablePlugin
Comma separated list of column names to generate real binaries for
colsFloat(value) - Method in class net.maizegenetics.analysis.monetdb.ColumnsToBinarySNPOnlyTablePlugin
Set Columns keep as Real (Float). Comma separated list of column names to generate real binaries for
colsInt() - Method in class net.maizegenetics.analysis.monetdb.ColumnsToBinaryFullGenomeTablePlugin
Comma separated list of column names to generate int binaries for
colsInt(value) - Method in class net.maizegenetics.analysis.monetdb.ColumnsToBinaryFullGenomeTablePlugin
Set Columns keep as Int. Comma separated list of column names to generate int binaries for
colsInt() - Method in class net.maizegenetics.analysis.monetdb.ColumnsToBinarySNPOnlyTablePlugin
Comma separated list of column names to generate int binaries for
colsInt(value) - Method in class net.maizegenetics.analysis.monetdb.ColumnsToBinarySNPOnlyTablePlugin
Set Columns keep as Int. Comma separated list of column names to generate int binaries for
colsLog10() - Method in class net.maizegenetics.analysis.monetdb.ColumnsToBinaryFullGenomeTablePlugin
Comma separated list of column names to first transform using -log10 then generate binaries for
colsLog10(value) - Method in class net.maizegenetics.analysis.monetdb.ColumnsToBinaryFullGenomeTablePlugin
Set Columns to Keep and transform -log10. Comma separated list of column names to first transform using -log10 then generate binaries for
colsLog10() - Method in class net.maizegenetics.analysis.monetdb.ColumnsToBinarySNPOnlyTablePlugin
Comma separated list of column names to first transform using -log10 then generate binaries for
colsLog10(value) - Method in class net.maizegenetics.analysis.monetdb.ColumnsToBinarySNPOnlyTablePlugin
Set Columns to Keep and transform -log10. Comma separated list of column names to first transform using -log10 then generate binaries for
colsLong() - Method in class net.maizegenetics.analysis.monetdb.ColumnsToBinaryFullGenomeTablePlugin
Comma separated list of column names to generate long binaries for
colsLong(value) - Method in class net.maizegenetics.analysis.monetdb.ColumnsToBinaryFullGenomeTablePlugin
Set Columns keep as Long. Comma separated list of column names to generate long binaries for
colsLong() - Method in class net.maizegenetics.analysis.monetdb.ColumnsToBinarySNPOnlyTablePlugin
Comma separated list of column names to generate long binaries for
colsLong(value) - Method in class net.maizegenetics.analysis.monetdb.ColumnsToBinarySNPOnlyTablePlugin
Set Columns keep as Long. Comma separated list of column names to generate long binaries for
colsShort() - Method in class net.maizegenetics.analysis.monetdb.ColumnsToBinaryFullGenomeTablePlugin
Comma separated list of column names to generate short binaries for
colsShort(value) - Method in class net.maizegenetics.analysis.monetdb.ColumnsToBinaryFullGenomeTablePlugin
Set Columns keep as Short. Comma separated list of column names to generate short binaries for
colsShort() - Method in class net.maizegenetics.analysis.monetdb.ColumnsToBinarySNPOnlyTablePlugin
Comma separated list of column names to generate short binaries for
colsShort(value) - Method in class net.maizegenetics.analysis.monetdb.ColumnsToBinarySNPOnlyTablePlugin
Set Columns keep as Short. Comma separated list of column names to generate short binaries for
colStart - Variable in class net.maizegenetics.analysis.gbs.neobio.PairwiseAlignment
The beginning COLUMN of the matrix that was aligned. If seq1 is the same length or shorter then seq1, this correlates to the position on seq1 where alignment started. If seq2 is shorter than seq1, this correlates to the position on seq2 where alignment started.
ColtDoubleMatrix - Class in net.maizegenetics.matrixalgebra.Matrix
 
ColtDoubleMatrix(aMatrix) - Constructor for class net.maizegenetics.matrixalgebra.Matrix.ColtDoubleMatrix
 
ColtDoubleMatrix(row, col) - Constructor for class net.maizegenetics.matrixalgebra.Matrix.ColtDoubleMatrix
 
ColtDoubleMatrix(row, col, values) - Constructor for class net.maizegenetics.matrixalgebra.Matrix.ColtDoubleMatrix
 
ColtDoubleMatrix(row, col, value) - Constructor for class net.maizegenetics.matrixalgebra.Matrix.ColtDoubleMatrix
 
ColtDoubleMatrix(values) - Constructor for class net.maizegenetics.matrixalgebra.Matrix.ColtDoubleMatrix
 
ColtDoubleMatrix(values) - Constructor for class net.maizegenetics.matrixalgebra.Matrix.ColtDoubleMatrix
 
ColtDoubleMatrix(size) - Constructor for class net.maizegenetics.matrixalgebra.Matrix.ColtDoubleMatrix
 
ColtDoubleMatrix(diagonal) - Constructor for class net.maizegenetics.matrixalgebra.Matrix.ColtDoubleMatrix
 
ColtEigenvalueDecomposition - Class in net.maizegenetics.matrixalgebra.decomposition
 
ColtEigenvalueDecomposition(dm) - Constructor for class net.maizegenetics.matrixalgebra.decomposition.ColtEigenvalueDecomposition
 
ColtEigenvalueDecomposition(matrix) - Constructor for class net.maizegenetics.matrixalgebra.decomposition.ColtEigenvalueDecomposition
 
ColtSingularValueDecomposition - Class in net.maizegenetics.matrixalgebra.decomposition
 
ColtSingularValueDecomposition(dm) - Constructor for class net.maizegenetics.matrixalgebra.decomposition.ColtSingularValueDecomposition
 
ColtSingularValueDecomposition(matrix) - Constructor for class net.maizegenetics.matrixalgebra.decomposition.ColtSingularValueDecomposition
 
column(j) - Method in class net.maizegenetics.matrixalgebra.Matrix.BlasDoubleMatrix
 
column(j) - Method in class net.maizegenetics.matrixalgebra.Matrix.ColtDoubleMatrix
 
column(j) - Method in interface net.maizegenetics.matrixalgebra.Matrix.DoubleMatrix
 
column(j) - Method in class net.maizegenetics.matrixalgebra.Matrix.EJMLDoubleMatrix
 
column(index) - Method in class net.maizegenetics.util.ColumnMatrix
 
columnLabels() - Static method in interface net.maizegenetics.analysis.modelfitter.ForwardRegression
 
ColumnMatrix - Class in net.maizegenetics.util
 
ColumnMatrix.Builder - Class in net.maizegenetics.util
 
columnMean(data, col) - Static method in class net.maizegenetics.analysis.numericaltransform.kNearestNeighbors
 
columnNames - Variable in class net.maizegenetics.plugindef.GenerateRCode.TableReportVectors
 
columnRank() - Method in class net.maizegenetics.matrixalgebra.Matrix.BlasDoubleMatrix
 
columnRank() - Method in class net.maizegenetics.matrixalgebra.Matrix.ColtDoubleMatrix
 
columnRank() - Method in interface net.maizegenetics.matrixalgebra.Matrix.DoubleMatrix
 
columnRank() - Method in class net.maizegenetics.matrixalgebra.Matrix.EJMLDoubleMatrix
 
ColumnsToBinaryFullGenomeTablePlugin - Class in net.maizegenetics.analysis.monetdb
This plugin is copied from the ColumnsToBinarySNPOnlyTablePlugin (which was copied Kelly's ColumnsToBinaryPlugin, which re-worked various lynn methods) to create binary files for loading into the hmp321_snp table in the maizeFullGEnomeDB of the Rare Alleles monetdb instance. THe difference between this plugin and the ColumnsToBinarySNPOnlyTablePlugin is the latter creates entries only for identified hmp321 SNPs This method (ColumnsToBinaryFullGenomePlugin) creates entries for all positions listed in in the reference genome. To be consistent with the existing columns in monetdb maize tables, the reference file must be a link to a copy of the Zea_mays.AGPv3.20.dna.genome.fa file stored on andersonii in Research/Zea/Genotypes/Annotations/monetDB/refGenomeFiles. The "inputFile" parameter can be either a single file containing data for all chromosomes or a directory of files split by chromosome. If all chroms are in a single file, that file must be sorted by chromosome and position, and must contain a header line that contains the columns "chr" and "pos" along with user specified data columns. If the "inputFile" parameter is a directory, the only *.txt files it holds must be files intended for this processing. These files must be split by chromosome and must be named such that they will sort lexicographically in chromosome order. For example: files named chr01.txt, chr02.txt ... chr09.txt, chr10.txt will sort from 1-10. But files named chr1.txt, chr2,txt ... chr9.txt, chr10.txt will not. In the latter case, chr10.txt will be processed before the other files. This plugin may also be used to create binaries for the maizeChrom10DB. In this case, we still use the full reference genome, but only chrom 10 is processed. The inputFile paramaeter shoudl be just 1 file containing chromosome 10 data.
ColumnsToBinaryFullGenomeTablePlugin(parentFrame, isInteractive) - Constructor for class net.maizegenetics.analysis.monetdb.ColumnsToBinaryFullGenomeTablePlugin
 
ColumnsToBinaryFullGenomeTablePlugin() - Constructor for class net.maizegenetics.analysis.monetdb.ColumnsToBinaryFullGenomeTablePlugin
 
ColumnsToBinarySNPOnlyTablePlugin - Class in net.maizegenetics.analysis.monetdb
This plugin is copied from Kelly's ColumnsToBinaryPlugin (which was re-worked from various lynn methods) to create binary files for loading into the hmp321_snp table in the maizeFullGenomeDB of the Rare ALleles monetdb instance. THe difference between this plugin and the ColumnsToBinaryFullGenomeTablePlugin is the latter creates entries for all positions listed in the reference genome. This method only creates entries positions identified as SNPs from hmp321. To be consistent with the existing columns in monetdb, the reference directory must be a link to a directory that contains copies of the SNPPos_chromX.txt files stored on andersonii in Research/Zea/Genotypes/Annotations/monetDB/refGenomeFiles. The "inputFile" parameter can be either a single file containing data for all chromosomes or a directory of files split by chromosome. If all chroms are in a single file, that file must be sorted by chromosome and position, and must contain a header line that contains the columns "chr" and "pos" along with user specified data columns. If the "inputFile" parameter is a directory, the only *.txt files it holds must be files intended for this processing. These files must be split by chromosome and must be named such that they will sort lexicographically in chromosome order. For example: files named chr01.txt, chr02.txt ... chr09.txt, chr10.txt will sort from 1-10. But files named chr1.txt, chr2,txt ... chr9.txt, chr10.txt will not. In the latter case, chr10.txt will be processed before the other files.
ColumnsToBinarySNPOnlyTablePlugin(parentFrame, isInteractive) - Constructor for class net.maizegenetics.analysis.monetdb.ColumnsToBinarySNPOnlyTablePlugin
 
ColumnsToBinarySNPOnlyTablePlugin() - Constructor for class net.maizegenetics.analysis.monetdb.ColumnsToBinarySNPOnlyTablePlugin
 
ColumnsToBinaryUtils - Class in net.maizegenetics.analysis.monetdb
This class contains utility functions to aid in creating monetdb binaries
columnSum(column) - Method in class net.maizegenetics.matrixalgebra.Matrix.BlasDoubleMatrix
 
columnSum(column) - Method in class net.maizegenetics.matrixalgebra.Matrix.ColtDoubleMatrix
 
columnSum(column) - Method in interface net.maizegenetics.matrixalgebra.Matrix.DoubleMatrix
 
columnSum(column) - Method in class net.maizegenetics.matrixalgebra.Matrix.EJMLDoubleMatrix
 
columnType - Variable in class net.maizegenetics.plugindef.GenerateRCode.TableReportVectors
 
combine(taxaDist1, taxaDist2) - Static method in class net.maizegenetics.dna.tag.TaxaDistBuilder
Combines a TaxaDistribution to an expandable TaxaDistribution. Can be used to convert a single TaxaDistribution to an expandable version
combine(bases) - Static method in class net.maizegenetics.taxa.tree.Parameterized.Utils
Combine multiple parameterized objects into one
combine(baseOne, baseTwo) - Static method in class net.maizegenetics.taxa.tree.Parameterized.Utils
Combine multiple parameterized objects into one
CombineDataSetsPlugin - Class in net.maizegenetics.analysis.data
 
CombineDataSetsPlugin() - Constructor for class net.maizegenetics.analysis.data.CombineDataSetsPlugin
Creates a new instance of CombineDataSetsPlugin
combineDonorHypothArrays(maxDonorHypotheses, dhs) - Static method in class net.maizegenetics.analysis.imputation.FILLINImputationUtils
Combines arrays of donorHypoth, sorts them, and returns the best limited by maxDonorHypotheses
CombineGenotypeCallTable - Class in net.maizegenetics.dna.snp.genotypecall
 
CombineGenotypeTable - Class in net.maizegenetics.dna.snp
Combines multiple GenotypeTables together.
combiner() - Method in class net.maizegenetics.dna.map.PositionList.PositionListCollector
 
combiner() - Method in class net.maizegenetics.taxa.TaxaList.TaxaListCollector
 
combiner() - Method in class net.maizegenetics.util.BitSet.BitSetListCollector
 
combineTwoHaplotypesAsHeterozygote() - Method in class net.maizegenetics.analysis.imputation.FILLINImputationPlugin
If true, uses combination mode in focus block, else does not impute
combineTwoHaplotypesAsHeterozygote(value) - Method in class net.maizegenetics.analysis.imputation.FILLINImputationPlugin
Set Combine two haplotypes as heterozygote. If true, uses combination mode in focus block, else does not impute
COMMENT_CHAR - Static variable in class net.maizegenetics.analysis.gbs.neobio.CharSequence
The character used to start a comment line in a sequence file. When this character is found, the rest of the line is ignored.
COMMENT_CHAR - Static variable in class net.maizegenetics.analysis.gbs.neobio.FactorSequence
The character used to start a comment line in a sequence file. When this character is found, the rest of the line is ignored.
COMMENT_CHAR - Static variable in class net.maizegenetics.analysis.gbs.neobio.ScoringMatrix
The character used to start a comment line in the scoring matrix file.
commentChar() - Method in class net.maizegenetics.dna.snp.io.LineIndex
 
commentChar(commentChar) - Method in class net.maizegenetics.dna.snp.io.LineIndexBuilder
 
Companion - Static variable in class net.maizegenetics.analysis.ListPluginParameters
 
compare(index1, index2) - Method in class net.maizegenetics.dna.map.PETagsOnPhysicalMapV3
 
compare(index1, index2) - Method in class net.maizegenetics.dna.map.TagsOnPhysicalMap
 
compare(index1, index2) - Method in interface net.maizegenetics.dna.map.TOPMInterface
Compares tags at given indices.
compare(index1, index2) - Method in class net.maizegenetics.dna.tag.AbstractPETags
Compare two PE tags
compare(index1, index2) - Method in class net.maizegenetics.dna.tag.AbstractTags
 
compare(index1, index2) - Method in class net.maizegenetics.dna.tag.TagCountMutable
 
compare(index1, index2) - Method in class net.maizegenetics.dna.tag.TagCounts
 
compare(sequence1, sequence2) - Method in class net.maizegenetics.dna.tag.TagCounts
 
compare(ef, of) - Static method in class net.maizegenetics.stats.statistics.ChiSquareTest
chi square test
compare(o1, o2) - Method in class net.maizegenetics.util.StringNumberComparator
 
compareAlignment(origFile, maskFile, impFile, noMask) - Static method in class net.maizegenetics.analysis.imputation.FILLINImputationAccuracy
Legacy approach for measuring accuracy, but need to maintain some tests.
compareAlignment(impGT, keyGT, taxaPrefix) - Static method in class net.maizegenetics.analysis.imputation.FILLINImputationAccuracy
Calculates proportion imputed, homozygous proportion right, heterozygous proportion right
CompareGenosBetweenHapMapFilesPlugin - Class in net.maizegenetics.analysis.gbs
 
CompareGenosBetweenHapMapFilesPlugin() - Constructor for class net.maizegenetics.analysis.gbs.CompareGenosBetweenHapMapFilesPlugin
 
CompareGenosBetweenHapMapFilesPlugin(parentFrame) - Constructor for class net.maizegenetics.analysis.gbs.CompareGenosBetweenHapMapFilesPlugin
 
CompareGenosBetweenHapMapFilesPlugin.SiteCompareType - Enum in net.maizegenetics.analysis.gbs
 
compareHaplotypes(h0, h1, overlap, haplength) - Static method in class net.maizegenetics.analysis.imputation.NucleotideImputationUtils
 
compareOriginalAgainstImputed(originalFile, imputedFile) - Static method in class net.maizegenetics.analysis.gbs.ProductionPipelineMain
Generates basic summary information about imputation such as change in sites or taxa count change in missing data change in heterozygosity how many sites changed their major allele
compareSequence(queryLong, maxDivCheck) - Method in class net.maizegenetics.analysis.gbs.Barcode
Return the minimum sequence divergence between a query sequence and barcode with its overhang
compareTags(index1, index2) - Method in class net.maizegenetics.dna.tag.AbstractTags
 
compareTags(index1, t2) - Method in class net.maizegenetics.dna.tag.AbstractTags
 
compareTags(t1, t2) - Static method in class net.maizegenetics.dna.tag.AbstractTags
 
compareTo(arg0) - Method in class net.maizegenetics.analysis.clustering.Haplotype
 
compareTo(cluster) - Method in class net.maizegenetics.analysis.clustering.HaplotypeCluster
 
compareTo(anotherBarcode) - Method in class net.maizegenetics.analysis.gbs.Barcode
 
compareTo(other) - Method in class net.maizegenetics.analysis.gbs.repgen.AlignmentInfo
 
compareTo(other) - Method in class net.maizegenetics.analysis.modelfitter.AbstractAdditiveSite
 
compareTo(o) - Method in class net.maizegenetics.analysis.popgen.DonorHypoth
 
compareTo(o) - Method in class net.maizegenetics.dna.map.Chromosome
Compares chromosomes numerically if both are numbers. Otherwise compares as strings.
compareTo(o) - Method in class net.maizegenetics.dna.map.DonorHaplotypes
 
compareTo(o) - Method in class net.maizegenetics.dna.map.GeneralPosition
 
compareTo(o) - Method in class net.maizegenetics.dna.snp.io.ReadBedfile.BedFileRange
 
compareTo(o) - Method in class net.maizegenetics.dna.tag.AbstractTag
 
compareTo(otherLevel) - Method in class net.maizegenetics.stats.linearmodels.BasicLevel
 
compareTo(c) - Method in class net.maizegenetics.taxa.Taxon
 
compareTo(o) - Method in class net.maizegenetics.util.Tuple
Using this method (i.e. sorting Tuples) seems to imply both x and y are Comparable. If that's not the case, results are unpredictable.
component1() - Method in class net.maizegenetics.analysis.data.MeanR2FromLDPlugin.AccumulateR2
 
component2() - Method in class net.maizegenetics.analysis.data.MeanR2FromLDPlugin.AccumulateR2
 
component3() - Method in class net.maizegenetics.analysis.data.MeanR2FromLDPlugin.AccumulateR2
 
component4() - Method in class net.maizegenetics.analysis.data.MeanR2FromLDPlugin.AccumulateR2
 
component5() - Method in class net.maizegenetics.analysis.data.MeanR2FromLDPlugin.AccumulateR2
 
component6() - Method in class net.maizegenetics.analysis.data.MeanR2FromLDPlugin.AccumulateR2
 
componentHidden(e) - Method in class net.maizegenetics.tassel.SeqViewerPanel
 
componentMoved(e) - Method in class net.maizegenetics.tassel.SeqViewerPanel
 
componentResized(e) - Method in class net.maizegenetics.tassel.SeqViewerPanel
 
componentShown(e) - Method in class net.maizegenetics.tassel.SeqViewerPanel
 
compose(input) - Static method in class net.maizegenetics.matrixalgebra.Matrix.BlasDoubleMatrix
 
compose(components) - Method in class net.maizegenetics.matrixalgebra.Matrix.DoubleMatrixFactory
 
compositeAlignments() - Method in class net.maizegenetics.dna.snp.CombineGenotypeTable
 
compositeAlignments() - Method in class net.maizegenetics.dna.snp.CoreGenotypeTable
 
compositeAlignments() - Method in interface net.maizegenetics.dna.snp.GenotypeTable
Returns individual genotype tables within this genotype table.
compositeAlignments() - Method in class net.maizegenetics.dna.snp.MergedGenotypeTable
 
compositeAlignments() - Method in class net.maizegenetics.dna.snp.TOPMGenotypeTable
 
CompressedDoubleMatrix - Class in net.maizegenetics.analysis.association
 
CompressedDoubleMatrix(kinship, theTree) - Constructor for class net.maizegenetics.analysis.association.CompressedDoubleMatrix
 
CompressedDoubleMatrix.kinshipMethod - Enum in net.maizegenetics.analysis.association
 
compressedMatrix - Variable in class net.maizegenetics.analysis.association.CompressedDoubleMatrix
 
CompressedMLMusingDoubleMatrix - Class in net.maizegenetics.analysis.association
 
CompressedMLMusingDoubleMatrix(parentPlugin, dataset, kinshipMatrix, useCompression, useP3D, compression) - Constructor for class net.maizegenetics.analysis.association.CompressedMLMusingDoubleMatrix
 
CompressedMLMusingDoubleMatrix(parentPlugin, dataset, kinshipMatrix, weights, useCompression, useP3D, compression) - Constructor for class net.maizegenetics.analysis.association.CompressedMLMusingDoubleMatrix
 
compression - Variable in class net.maizegenetics.analysis.association.MLMPlugin
 
compression - Variable in class net.maizegenetics.analysis.association.WeightedMLMPlugin
 
compressionType - Variable in class net.maizegenetics.analysis.association.MLMPlugin
 
compressionType - Variable in class net.maizegenetics.analysis.association.WeightedMLMPlugin
 
computeAllDistances(tree, a, dist, idist, countEdges, epsilon) - Static method in class net.maizegenetics.taxa.tree.TreeUtils
 
computeBlockTable() - Method in class net.maizegenetics.analysis.gbs.neobio.CrochemoreLandauZivUkelson
Computes the block table. This method is a general specification of how the block table should be computed. It creates the block table according to the number of factors of each sequence. It then goes over each position of the block table, retrieves the corresponding factors from each sequence, and repasses the information to the subclasses that will do the actual computation of each block using the scoring scheme previously set.
computeBoxCox(phenotypeValues, minimumValue, randomSeed, startLambda, endLambda, stepLambda) - Static method in class net.maizegenetics.analysis.numericaltransform.BoxCoxTransformation
 
computeColumnMaxima(matrix, col_maxima) - Method in class net.maizegenetics.analysis.gbs.neobio.Smawk
Computes the column maxima of a given matrix. It first sets up arrays of row and column indexes to simulate a copy of the matrix (where all operations will be performed). It then calls the recursive protected computeColumnMaxima method.
computeColumnMaxima(col_maxima) - Method in class net.maizegenetics.analysis.gbs.neobio.Smawk
This method implements the SMAWK algorithm to compute the column maxima of a given matrix. It uses the arrays of row and column indexes to performs all operations on this 'fake' copy of the original matrix.
computeDistance(tree, a, b) - Static method in class net.maizegenetics.taxa.tree.TreeUtils
compute distance between two external nodes
computeGenotypeR(site1, site2, a) - Static method in class net.maizegenetics.analysis.imputation.NucleotideImputationUtils
 
computeHetBitDistances(theTBA, taxon1, taxon2) - Static method in class net.maizegenetics.analysis.distance.IBSDistanceMatrix
Compute distance for a pair of taxa.
computeHetBitDistances(theTBA, taxon1, taxon2, minSitesCompared) - Static method in class net.maizegenetics.analysis.distance.IBSDistanceMatrix
Compute distance for a pair of taxa.
computeHetBitDistances(theTBA, taxon1, taxon2, minSitesCompared, firstWord, lastWord, maskBadSet) - Static method in class net.maizegenetics.analysis.distance.IBSDistanceMatrix
Compute distance for a pair of taxa. Optimized for calculations sites within a certain range of underlying word (64 sites chunks) in the TBit array
computeHetBitDistances(iMj, iMn, jMj, jMn, minSitesCompared) - Static method in class net.maizegenetics.analysis.distance.IBSDistanceMatrix
Calculation of distance using the bit vector of major and minor alleles.
computeHetBitDistances(iMj, iMn, jMj, jMn, minSitesCompared, firstWord, lastWord) - Static method in class net.maizegenetics.analysis.distance.IBSDistanceMatrix
Calculation of distance using the bit vector of major and minor alleles.
computeHetBitDistancesThirdState(iMj, iMn, iMn2, jMj, jMn, jMn2, minSitesCompared) - Static method in class net.maizegenetics.analysis.distance.IBSDistanceMatrix
Calculation of distance using the bit vector of the first three alleles.
computeHetBitDistancesThirdState(iMj, iMn, iMn2, jMj, jMn, jMn2, minSitesCompared, firstWord, lastWord) - Static method in class net.maizegenetics.analysis.distance.IBSDistanceMatrix
Calculation of distance using the bit vectors of the first three alleles.
computeHetDistances(first, second, minSitesComp) - Static method in class net.maizegenetics.analysis.distance.IBSDistanceMatrix
 
computeHetDistances(first, second, minSitesComp) - Static method in class net.maizegenetics.analysis.distance.IBSDistanceMatrix2Alleles
 
computeHetDistances(first, second, minSitesComp) - Static method in class net.maizegenetics.analysis.distance.IBSDistanceMatrix3Alleles
 
computeMatrix() - Method in class net.maizegenetics.analysis.gbs.neobio.NeedlemanWunsch
Computes the dynamic programming matrix.
computeMatrix() - Method in class net.maizegenetics.analysis.gbs.neobio.SmithWaterman
Computes the dynamic programming matrix.
computeMatrix() - Method in class net.maizegenetics.analysis.gbs.SmithWaterman
Computes the dynamic programming matrix. If the scoring scheme is not compatible with the loaded sequences.
computeOutputBorder(block, row, col, dim, lc, lr) - Method in class net.maizegenetics.analysis.gbs.neobio.CrochemoreLandauZivUkelsonGlobalAlignment
Computes the output border of a block. This is performed in five steps: Retrieve the block's input border; Retrieve the block's complete DIST matrix; Create an interface to the class OutMatrix matrix from the input border and DIST matrix; Use class Smawk to compute all column maxima of the OUT matrix (SMAWK finds the index of the row that contains the maximum value of a column); Assemble the output border by extracting the maximum values of each column of the OUT matrix using the information obtained in the previous step.
computeOutputBorder(block, row, col, dim, lc, lr) - Method in class net.maizegenetics.analysis.gbs.neobio.CrochemoreLandauZivUkelsonLocalAlignment
Computes the output border of a block. This method works essentially in the same way as its global alignment counterpart: Retrieve the block's input border; Retrieve the block's complete DIST matrix; Create an interface to the class OutMatrix matrix from the input border and DIST matrix; Use class Smawk to compute all column maxima of the OUT matrix (SMAWK finds the index of the row that contains the maximum value of a column); Assemble the output border by extracting the maximum values of each column of the OUT matrix using the information obtained in the previous step. However, it also check if there is a better path starting inside the block (an S path) and oupdate the output border accordingly. It also checks if this block has any path of score higher than the maximum score found so far.
computePairwiseAlignment() - Method in class net.maizegenetics.analysis.gbs.neobio.CrochemoreLandauZivUkelson
Computes the block table (the result depends on subclasses, see computeBlockTable for details) and requests subclasses to retrieve an optimal alignment between the loaded sequences. The actual product depends on the subclasses which can produce a global (see CrochemoreLandauZivUkelsonGlobalAlignment) or local alignment (see CrochemoreLandauZivUkelsonLocalAlignment).
computePairwiseAlignment() - Method in class net.maizegenetics.analysis.gbs.neobio.NeedlemanWunsch
Builds an optimal global alignment between the loaded sequences after computing the dynamic programming matrix. It calls the buildOptimalAlignment method after the computeMatrix method computes the dynamic programming matrix.
computePairwiseAlignment() - Method in class net.maizegenetics.analysis.gbs.neobio.PairwiseAlignmentAlgorithm
Subclasses must implement this method to compute an alignment between the loaded sequences using the scoring scheme previously set. This methid is called by the getPairwiseAlignment method when needed.
computePairwiseAlignment() - Method in class net.maizegenetics.analysis.gbs.neobio.SmithWaterman
Builds an optimal local alignment between the loaded sequences after computing the dynamic programming matrix. It calls the buildOptimalAlignment method after the computeMatrix method computes the dynamic programming matrix.
computeRForAlleles(site1, site2, a) - Static method in class net.maizegenetics.analysis.imputation.NucleotideImputationUtils
 
computeRForMissingness(site1, site2, a) - Static method in class net.maizegenetics.analysis.imputation.NucleotideImputationUtils
 
computeScore() - Method in class net.maizegenetics.analysis.gbs.neobio.CrochemoreLandauZivUkelson
Computes the block table (the result depends on subclasses, see computeBlockTable for details) and requests subclasses to locate the score of the highest scoring alignment between the two sequences in the block table. The result depends on the subclasses, and either a global alignment (see CrochemoreLandauZivUkelsonGlobalAlignment) or local alignment score (see CrochemoreLandauZivUkelsonLocalAlignment) will be produced.
computeScore() - Method in class net.maizegenetics.analysis.gbs.neobio.NeedlemanWunsch
Computes the score of the best global alignment between the two sequences using the scoring scheme previously set. This method calculates the similarity value only (doesn't build the whole matrix so the alignment cannot be recovered, however it has the advantage of requiring O(n) space only).
computeScore() - Method in class net.maizegenetics.analysis.gbs.neobio.PairwiseAlignmentAlgorithm
Subclasses must implement this method to compute the score of the alignment between the loaded sequences using the scoring scheme previously set. This methid is called by the getScore method when needed.
computeScore() - Method in class net.maizegenetics.analysis.gbs.neobio.SmithWaterman
Computes the score of the best local alignment between the two sequences using the scoring scheme previously set. This method calculates the similarity value only (doesn't build the whole matrix so the alignment cannot be recovered, however it has the advantage of requiring O(n) space only).
computeScore() - Method in class net.maizegenetics.analysis.gbs.SmithWaterman
Computes the score of the best local alignment between the two sequences using the scoring scheme previously set. This method calculates the similarity value only (doesn't build the whole matrix so the alignment cannot be recovered, however it has the advantage of requiring O(n) space only).
computeZKZ(data, X, Z, kin, traitname) - Method in class net.maizegenetics.analysis.association.CompressedMLMusingDoubleMatrix
Computes ZKZ. If compression is specified then the compressed ZKZ is calculated along with compressed versions of Z and K.
concatenate(dm, rows) - Method in class net.maizegenetics.matrixalgebra.Matrix.BlasDoubleMatrix
 
concatenate(dm, rows) - Method in class net.maizegenetics.matrixalgebra.Matrix.ColtDoubleMatrix
 
concatenate(dm, rows) - Method in interface net.maizegenetics.matrixalgebra.Matrix.DoubleMatrix
 
concatenate(dm, rows) - Method in class net.maizegenetics.matrixalgebra.Matrix.EJMLDoubleMatrix
 
concatenate() - Method in class net.maizegenetics.phenotype.PhenotypeBuilder
 
configFile() - Method in class net.maizegenetics.tassel.PreferencesDialog
Global configuration file
configFile(value) - Method in class net.maizegenetics.tassel.PreferencesDialog
Set Config File. Global configuration file
connConfigFile() - Method in class net.maizegenetics.analysis.data.FeatureListToPositionsPlugin
DB connection config file
connConfigFile(value) - Method in class net.maizegenetics.analysis.data.FeatureListToPositionsPlugin
Set DB Config File. DB connection config file
connConfigFile() - Method in class net.maizegenetics.analysis.data.GenomeAnnosDBQueryToPositionListPlugin
DB connection config file
connConfigFile(value) - Method in class net.maizegenetics.analysis.data.GenomeAnnosDBQueryToPositionListPlugin
Set DB config file. DB connection config file
connection(propertiesFile) - Static method in class net.maizegenetics.analysis.gobii.BMSConnection
 
connection(host, user, password, dbName) - Static method in class net.maizegenetics.analysis.gobii.BMSConnection
 
connection(propertiesFile) - Static method in class net.maizegenetics.analysis.gobii.GOBIIPostgresConnection
Creates a Postgres database connection given a properties file
connection(host, user, password, dbName) - Static method in class net.maizegenetics.analysis.gobii.GOBIIPostgresConnection
Creates a Postgres database connection.
connectToDatabaseOrDie(dbName, props) - Static method in class net.maizegenetics.analysis.gobii.GOBIIDbUtils
 
connectToDB(configFile) - Static method in class net.maizegenetics.analysis.data.GenomeAnnosDBQueryToPositionListPlugin
 
connectToDB(configFile) - Static method in class net.maizegenetics.analysis.gobii.GOBIIDbUtils
 
cons(car, cdr) - Static method in class net.maizegenetics.util.db.Pair
 
contains(o) - Method in class net.maizegenetics.analysis.avro.GenericArrayPositions
 
contains(o) - Method in class net.maizegenetics.analysis.avro.GenericArrayTaxa
 
contains(hap) - Method in class net.maizegenetics.analysis.clustering.HaplotypeCluster
 
contains(s) - Method in class net.maizegenetics.analysis.gbs.v2.BarcodeTrie
checks if the String is in the trie.
contains(o) - Method in class net.maizegenetics.dna.snp.FilterList
 
contains(sublevel) - Method in class net.maizegenetics.stats.linearmodels.BasicLevel
 
contains(sublevel) - Method in interface net.maizegenetics.stats.linearmodels.Level
 
contains(taxon) - Method in class net.maizegenetics.taxa.TaxaListBuilder
 
containsAll(c) - Method in class net.maizegenetics.analysis.avro.GenericArrayPositions
 
containsAll(c) - Method in class net.maizegenetics.analysis.avro.GenericArrayTaxa
 
containsAll(c) - Method in class net.maizegenetics.dna.snp.FilterList
 
containsClade(root, clade) - Static method in class net.maizegenetics.taxa.tree.RootedTreeUtils
 
containsKey(key) - Method in class net.maizegenetics.analysis.avro.GenericMapAnnotations
 
containsNovelTaxa(root, taxa) - Static method in class net.maizegenetics.taxa.tree.RootedTreeUtils
 
containsSubtree(root, node) - Static method in class net.maizegenetics.taxa.tree.RootedTreeUtils
 
containsValue(value) - Method in class net.maizegenetics.analysis.avro.GenericMapAnnotations
 
contig - Variable in class net.maizegenetics.dna.tag.AbstractPETags
Contigs in Long array
ContigencyTable - Class in net.maizegenetics.stats.statistics
Class for permuting contigency tables and determining the likelihood of the table. If determining of the probability of a 2x2 table use FisherExact as it is much faster.
ContigencyTable(maxSize) - Constructor for class net.maizegenetics.stats.statistics.ContigencyTable
constructor for Contigency table
contigFile() - Method in class net.maizegenetics.analysis.rna.LoadRNAContigsToGBSDBPlugin
Input file containing contigs in fasta format.
contigFile(value) - Method in class net.maizegenetics.analysis.rna.LoadRNAContigsToGBSDBPlugin
Set Input Fasta Contig File. Input file containing contigs in fasta format.
contigLength - Variable in class net.maizegenetics.dna.tag.AbstractPETags
Length of contigs, 0 means contig doesn't exist
contigLengthInLong - Variable in class net.maizegenetics.dna.tag.AbstractPETags
Length of contigs in Long primitive data type, 0 means contig doesn't exist
contigPETagCount() - Method in class net.maizegenetics.analysis.gbs.ContigPETagCountPlugin
Make contigs of PETagCounts from forward and backward tags
ContigPETagCountPlugin - Class in net.maizegenetics.analysis.gbs
 
ContigPETagCountPlugin() - Constructor for class net.maizegenetics.analysis.gbs.ContigPETagCountPlugin
 
ContigPETagCountPlugin(parentFrame) - Constructor for class net.maizegenetics.analysis.gbs.ContigPETagCountPlugin
 
contigPETags() - Method in class net.maizegenetics.dna.tag.AbstractPETags
Make contigs from forward and backward tags
contribution1 - Variable in class net.maizegenetics.analysis.imputation.PopulationData
 
contribution2 - Variable in class net.maizegenetics.analysis.imputation.PopulationData
 
convergence - Variable in class net.maizegenetics.stats.EMMA.EMMAforDoubleMatrix
 
convert(input, outputClass) - Static method in class net.maizegenetics.plugindef.AbstractPlugin
 
convert(instance, target) - Static method in class net.maizegenetics.util.db.TransformerService
 
ConvertAlignmentCoordinatesPlugin - Class in net.maizegenetics.analysis.data
 
ConvertAlignmentCoordinatesPlugin(parentFrame, isInteractive) - Constructor for class net.maizegenetics.analysis.data.ConvertAlignmentCoordinatesPlugin
 
convertDoubleArrayToFloat(doubleArray) - Static method in class net.maizegenetics.analysis.association.AssociationUtils
 
convertFloatArrayToDouble(floatArray) - Static method in class net.maizegenetics.analysis.association.AssociationUtils
 
convertGenotypesToParentCalls() - Method in class net.maizegenetics.analysis.imputation.BiparentalHaplotypeFinder
 
convertGenotypeStringToDiploidByteArray(diploidString) - Static method in class net.maizegenetics.dna.snp.NucleotideAlignmentConstants
Convert a genotype (diploid) string (e.g. ACGTA) to arrays of diploid bytes (e.g. {0,17,34,51,0})
convertGenotypeTableSiteToVariantContext(genotypeTable, sites) - Static method in class net.maizegenetics.dna.snp.io.VCFUtil
Method to convert a list of positions into a single variantContext record If sites only has one element, it will just create genotypes for that position(Fixing indels with missing information) If sites has multiple consecutive elements, it is likely an indel This needs to walk through the sites and combine the alleles together ignoring - and + nucleotides
convertGenotypeTableToVariantContextList(genotypeTable) - Static method in class net.maizegenetics.dna.snp.io.VCFUtil
Method to convert a genotype table to a List of VariantContexts This is done by walking through the genotypeTable's positions in order. To Handle indels, we need to process a set of positions at a time It will start with the first position and hold its index temporarily Combine consecutive indel positions into this index list. A consecutive position is one where the chromosomes match, and the current position is less than 1 physical position away from the previous We need to check less than one as an insertion has the same physical reference position If the consecutive position also contains an indel character "+" or "-" we need to add it to the block Otherwise(either non indel or non-consecutive) process the previous block and setup a new block with the current site
convertGenotypeToDoubleProbability(genotype, sitesByTaxa) - Static method in class net.maizegenetics.dna.snp.GenotypeTableUtils
 
convertGenotypeToFloatProbability(genotype, sitesByTaxa) - Static method in class net.maizegenetics.dna.snp.GenotypeTableUtils
 
convertHaplotypeStringToAlleleByteArray(haploString) - Static method in class net.maizegenetics.dna.snp.NucleotideAlignmentConstants
Convert a haploid (allele) string (e.g. ACGTA) to arrays of allele bytes (e.g. {0,1,2,3,0})
convertNames(tree, filename) - Static method in class net.maizegenetics.taxa.tree.NewickUtils
This converts tree node names based on the conversion file specified.
convertNegativeBranchLengthsToZeroLength(node) - Static method in class net.maizegenetics.taxa.tree.NodeUtils
If the given node or the sub tree defined by that node have negative branch lengths, they'll have zeron branch lengths after a call to this function!
convertNucleotideGenotypesToStringList(data) - Static method in class net.maizegenetics.dna.snp.GenotypeTableUtils
Converts the byte representation of genotypes to string list of genotypes
ConvertOldFastqToModernFormatPlugin - Class in net.maizegenetics.util
This plugin takes a single fastq or a directory of fastq files in the "old" format and converts them to the "modern" illumina format. The old format had multiple taxa combined in a single file, with barcodes attaached to each read sequence. The new fastQ format has the taxa (samples) each in individual files. THis method takes the old fastq and for each read block, subsets the sequence to start after the barcode (but including the initial cut site) and end after the ending cut site. The quality score is subsetted identically to the sequence so the 2 match. Files are written to a user defined directory.
ConvertOldFastqToModernFormatPlugin() - Constructor for class net.maizegenetics.util.ConvertOldFastqToModernFormatPlugin
 
ConvertOldFastqToModernFormatPlugin(parentFrame, isInteractive) - Constructor for class net.maizegenetics.util.ConvertOldFastqToModernFormatPlugin
 
convertParentCallsToNucleotides(popdata) - Static method in class net.maizegenetics.analysis.imputation.NucleotideImputationUtils
 
convertTableReportToGuavaTable(tr) - Static method in class net.maizegenetics.util.TableReportUtils
 
convertToHDF5(hdf5Outfile) - Method in class net.maizegenetics.dna.snp.io.BuilderFromVCF
Create a HDF5 version of file from the VCF file. This is useful in many cases where VCF files are too large to load fully into memory.
convertToTBTByte() - Method in class net.maizegenetics.dna.tag.TagsByTaxaByteHDF5TagGroups
 
convertToTBTByte() - Method in class net.maizegenetics.dna.tag.TagsByTaxaByteHDF5TaxaGroups
 
ConvertTreeNamesPlugin - Class in net.maizegenetics.analysis.tree
 
ConvertTreeNamesPlugin(parentFrame, isInteractive) - Constructor for class net.maizegenetics.analysis.tree.ConvertTreeNamesPlugin
 
ConvertTreeNamesPlugin() - Constructor for class net.maizegenetics.analysis.tree.ConvertTreeNamesPlugin
 
ConvertTreeNamesPluginKt - Class in net.maizegenetics.analysis.tree
 
copy() - Method in class net.maizegenetics.analysis.clustering.HaplotypeCluster
This function returns a copy of the component Haplotypes not references to them.
copy(id, chr, start, end, r2Total, r2Count) - Method in class net.maizegenetics.analysis.data.MeanR2FromLDPlugin.AccumulateR2
 
copy() - Method in interface net.maizegenetics.analysis.modelfitter.AdditiveSite
 
copy() - Method in class net.maizegenetics.analysis.modelfitter.GenotypeAdditiveSite
 
copy() - Method in class net.maizegenetics.analysis.modelfitter.RefProbAdditiveSite
 
copy() - Method in class net.maizegenetics.matrixalgebra.Matrix.BlasDoubleMatrix
 
copy() - Method in class net.maizegenetics.matrixalgebra.Matrix.ColtDoubleMatrix
 
copy() - Method in interface net.maizegenetics.matrixalgebra.Matrix.DoubleMatrix
 
copy() - Method in class net.maizegenetics.matrixalgebra.Matrix.EJMLDoubleMatrix
 
copy() - Method in class net.maizegenetics.stats.linearmodels.SweepFast
 
copyGenotypes(t4File, newT5File) - Static method in class net.maizegenetics.analysis.data.MigrateHDF5FromT4T5
 
copyOrthogonalizedData() - Method in class net.maizegenetics.stats.linearmodels.SolveByOrthogonalizing
 
copyTagMapRow(sourceTOPM, sourceRow, destRow, merge) - Method in class net.maizegenetics.dna.map.TagsOnPhysicalMap
This helps collapse identical reads from different regions of the genome together.
copyUColumns() - Method in class net.maizegenetics.stats.linearmodels.SolveByOrthogonalizing
 
CoreGenotypeTable - Class in net.maizegenetics.dna.snp
Basic implementation of a interface GenotypeTable. Use the GenotypeTableBuilder to construct.
CorePhenotype - Class in net.maizegenetics.phenotype
 
CorePhenotype(attributes, types, name) - Constructor for class net.maizegenetics.phenotype.CorePhenotype
 
correctSelfPhaseUsingCross(selfPhaseFilename, crossPhaseFilename, parent, chr, outfileName) - Method in class net.maizegenetics.analysis.imputation.SelfedHaplotypeFinder
 
cosine(data1, data2) - Static method in class net.maizegenetics.analysis.numericaltransform.kNearestNeighbors
Computes the cosine similarity of two vectors.
cosineSimRank(data, row, col, k) - Static method in class net.maizegenetics.analysis.numericaltransform.kNearestNeighbors
Rank all the rows according to their cosine similarity with the given row.
COUNT - Static variable in enum net.maizegenetics.dna.WHICH_ALLELE
Count of the number of allele types
countAllelesAtAllSites() - Method in class net.maizegenetics.analysis.clustering.HaplotypeCluster
 
CountAssociationsPlugin - Class in net.maizegenetics.analysis.data
 
CountAssociationsPlugin(parentFrame, isInteractive) - Constructor for class net.maizegenetics.analysis.data.CountAssociationsPlugin
 
CountAssociationsPlugin() - Constructor for class net.maizegenetics.analysis.data.CountAssociationsPlugin
 
CountAssociationsPluginKt - Class in net.maizegenetics.analysis.data
 
countHeterozygousSites() - Method in class net.maizegenetics.analysis.clustering.HaplotypeCluster
 
countNotMissing() - Method in class net.maizegenetics.analysis.clustering.Haplotype
 
countParameters(ps) - Static method in class net.maizegenetics.taxa.tree.MultiParameterized
 
countSortOrder(counts, descending) - Static method in class net.maizegenetics.analysis.imputation.RephaseParents
 
countTags(keyFileS, enzyme, inputFileSWithBarcode, inputFileSWithoutBarcode, minCount, tagLengthInLong) - Method in class net.maizegenetics.analysis.gbs.FastqToPETagCountPlugin
Derives a PETagCount list for a pair of Fastq files.
countTags(keyFileS, enzyme, fastqDirectory, outputDir, maxGoodReads, minCount) - Static method in class net.maizegenetics.analysis.gbs.FastqToTagCountPlugin
Derives a tagCount list for each fastq file in the fastqDirectory.
countTags(myInput, myOutput, maxGoodReads, minCount, maxCount) - Static method in class net.maizegenetics.analysis.gbs.KmerToTagCountPlugin
Derives a tagCount list for each fastq file in the fastqDirectory.
countTags(keyFileS, enzyme, inputFileSWithBarcode, inputFileSWithoutBarcode, minCount, tagLengthInLong) - Method in class net.maizegenetics.analysis.gbs.QseqToPETagCountPlugin
Derives a PETagCount list for a pair of Qseq files.
countTags(keyFileS, enzyme, qseqDirectory, outputDir, maxGoodReads, minCount) - Static method in class net.maizegenetics.analysis.gbs.QseqToTagCountPlugin
Derives a tagCount list for each qseq file in the qseqDirectory.
countTaxaSharedWith(hapCluster) - Method in class net.maizegenetics.analysis.clustering.HaplotypeCluster
 
countUnknownAndHeterozygotes(a) - Static method in class net.maizegenetics.analysis.imputation.FILLINImputationUtils
Sums the number of unknown and heterozgyous sites in a byte genotype
covariance() - Method in class net.maizegenetics.analysis.data.PrincipalComponentsPlugin
If the box is checked, then the analysis will do an eigenvalue decomposition of the covariance matrix. If the box is unchecked, it will use a correlation matrix. Using the covariance matrix is recommended for genotypes while the correlation matrix is often used for phenotypes.
covariance(value) - Method in class net.maizegenetics.analysis.data.PrincipalComponentsPlugin
Set covariance (alternative = correlation). If the box is checked, then the analysis will do an eigenvalue decomposition of the covariance matrix. If the box is unchecked, it will use a correlation matrix. Using the covariance matrix is recommended for genotypes while the correlation matrix is often used for phenotypes.
covariateAttributeList - Variable in class net.maizegenetics.analysis.modelfitter.StepwiseAdditiveModelFitter
 
covariateAttributeStream() - Method in class net.maizegenetics.phenotype.CorePhenotype
 
covariateAttributeStream() - Method in class net.maizegenetics.phenotype.FilterPhenotype
 
covariateAttributeStream() - Method in interface net.maizegenetics.phenotype.Phenotype
 
CovariateModelEffect - Class in net.maizegenetics.stats.linearmodels
 
CovariateModelEffect(covariate) - Constructor for class net.maizegenetics.stats.linearmodels.CovariateModelEffect
 
CovariateModelEffect(covariate, id) - Constructor for class net.maizegenetics.stats.linearmodels.CovariateModelEffect
 
CovariatePermutationTestSpliterator - Class in net.maizegenetics.analysis.modelfitter
A Spliterator that uses the covariate from an AdditiveSite to test it against a baseModel and a list of permuted data sets using a fixed effect linear model. This class is used as part of stepwise model fitting to process a list of AdditiveSites. The permutation test is used to determine the entry and exit limits to be used for model fitting.
CovariatePermutationTestSpliterator(permutedData, siteList, baseModel) - Constructor for class net.maizegenetics.analysis.modelfitter.CovariatePermutationTestSpliterator
 
create(maxTaxa, taxaWithTag) - Static method in class net.maizegenetics.dna.tag.TaxaDistBuilder
Create a TaxaDistribution with only a single taxa with a tag. Very memory efficient, but needs conversion add an additional taxon with a tag
create(maxTaxa) - Static method in class net.maizegenetics.dna.tag.TaxaDistBuilder
Create an expandable TaxaDistribution with no initial values
create(maxTaxa, taxaWithTags, depthOfTags) - Static method in class net.maizegenetics.dna.tag.TaxaDistBuilder
Create an fixed TaxaDistribution with set values
create(encodedTaxaDistribution) - Static method in class net.maizegenetics.dna.tag.TaxaDistBuilder
Create an fixed TaxaDistribution with set values
create(srcTaxaDist) - Static method in class net.maizegenetics.dna.tag.TaxaDistBuilder
Copies a TaxaDistribution to an expandable TaxaDistribution. Can be used to convert a single TaxaDistribution to an expandable version
create(maxTaxa, encodeTaxaDepths) - Static method in class net.maizegenetics.dna.tag.TaxaDistBuilder
Create expandable TaxaDistribution from encoded taxa distribution. The int[] encoding use first three bytes for taxa index, and last byte for depth as unsigned byte. Depths greater than 256 just increase.
createAnnoHDF5WithHapMap(hapMapDir, outputFile, currChr) - Method in class net.maizegenetics.dna.pd.PDAnnotation
 
createAnova() - Method in class net.maizegenetics.analysis.modelfitter.StepwiseAdditiveModelFitterPlugin
Create pre- and post-scan anova reports.
createAnova(value) - Method in class net.maizegenetics.analysis.modelfitter.StepwiseAdditiveModelFitterPlugin
Set Create anova reports. Create pre- and post-scan anova reports.
createAnovaReport - Variable in class net.maizegenetics.analysis.modelfitter.StepwiseAdditiveModelFitter
 
createAnovaReport(createIt) - Method in class net.maizegenetics.analysis.modelfitter.StepwiseAdditiveModelFitter
 
createBlock(factor1, factor2, row, col) - Method in class net.maizegenetics.analysis.gbs.neobio.CrochemoreLandauZivUkelson
Computes a block of the block table, which corresponds to an alignment block between one factor of sequence 1 and one factor of sequence 2. See subclasses for actual implementation.
createBlock(factor1, factor2, row, col) - Method in class net.maizegenetics.analysis.gbs.neobio.CrochemoreLandauZivUkelsonGlobalAlignment
Creates and computes all information of an alignment block. Its main job is to compute the DIST column for the block. It then request the computeOutputBorder method to compute the block's output border.
createBlock(factor1, factor2, row, col) - Method in class net.maizegenetics.analysis.gbs.neobio.CrochemoreLandauZivUkelsonLocalAlignment
Creates and computes all information of an alignment block. This method works essentially in the same way as its global alignment counterpart. Its main job is to compute the DIST column for the block. It then request the computeOutputBorder method to compute the block's output border. It also computes all S, C and E-paths of this block. Finally, it checks if the C-path of this block is higher than the highest score found so far.
createChart(dataset) - Method in class net.maizegenetics.analysis.chart.XYScatterAndLinePanel
 
createChart(dataset) - Method in class net.maizegenetics.analysis.chart.XYScatterMultipleYPanel
 
createEffects() - Method in class net.maizegenetics.analysis.modelfitter.StepwiseAdditiveModelFitterPlugin
Create a report of marker effects based on the scan results.
createEffects(value) - Method in class net.maizegenetics.analysis.modelfitter.StepwiseAdditiveModelFitterPlugin
Set Create effects report. Create a report of marker effects based on the scan results.
createEffectsPrescan() - Method in class net.maizegenetics.analysis.modelfitter.StepwiseAdditiveModelFitterPlugin
Create a report of marker effects based on the results pre-scan.
createEffectsPrescan(value) - Method in class net.maizegenetics.analysis.modelfitter.StepwiseAdditiveModelFitterPlugin
Set Create prescan effects. Create a report of marker effects based on the results pre-scan.
createFile(inTags, newHDF5file) - Static method in class net.maizegenetics.dna.map.TagsOnPhysicalMapV3
Initialize HDF5 TOPM from TagCounts file. The "MAXMAPPING"(set to 0), "TAGLENGTHINLONG", "tags" and "tagLength" are added.
createFile(inTags, newHDF5file, maxMapping, maxVariants) - Static method in class net.maizegenetics.dna.map.TagsOnPhysMapHDF5
 
createFirstColumnBlock(factor1, factor2, row) - Method in class net.maizegenetics.analysis.gbs.neobio.CrochemoreLandauZivUkelson
Computes a block at the first column (column zero) of the block table, which corresponds to an alignment block between one factor of sequence 1 and an empty string. See subclasses for actual implementation.
createFirstColumnBlock(factor1, factor2, row) - Method in class net.maizegenetics.analysis.gbs.neobio.CrochemoreLandauZivUkelsonGlobalAlignment
Creates and computes all information of an alignment block of the first column of the block table. This is a special case of the createBlock method.
createFirstColumnBlock(factor1, factor2, row) - Method in class net.maizegenetics.analysis.gbs.neobio.CrochemoreLandauZivUkelsonLocalAlignment
Creates and computes all information of an alignment block of the first column of the block table. This is a special case of the createBlock method.
createFirstRowBlock(factor1, factor2, col) - Method in class net.maizegenetics.analysis.gbs.neobio.CrochemoreLandauZivUkelson
Computes a block at the first row (row zero) of the block table, which corresponds to an alignment block between one factor of sequence 2 and an empty string. See subclasses for actual implementation.
createFirstRowBlock(factor1, factor2, col) - Method in class net.maizegenetics.analysis.gbs.neobio.CrochemoreLandauZivUkelsonGlobalAlignment
Creates and computes all information of an alignment block of the first row of the block table. This is a special case of the createBlock method.
createFirstRowBlock(factor1, factor2, col) - Method in class net.maizegenetics.analysis.gbs.neobio.CrochemoreLandauZivUkelsonLocalAlignment
Creates and computes all information of an alignment block of the first column of the block table. This is a special case of the createBlock method.
createFixedEffectsArray(factorList, covariateList, missing, numberOfObservations) - Static method in class net.maizegenetics.analysis.association.AssociationUtils
 
createFixedEffectsArray(factorList, covariateList, missing) - Static method in class net.maizegenetics.stats.linearmodels.LinearModelUtils
 
createFrom(values) - Method in interface net.maizegenetics.util.db.DBTuple
 
createFrom(values) - Method in class net.maizegenetics.util.db.DefaultDBTuple
 
createHDF5GenotypeModule(h5w) - Static method in class net.maizegenetics.util.HDF5Utils
 
createHDF5PositionModule(h5w) - Static method in class net.maizegenetics.util.HDF5Utils
 
createHDF5TagModule(h5w, tagLengthInLong) - Static method in class net.maizegenetics.util.HDF5Utils
 
createHDF5TaxaList(writer, exportList) - Static method in class net.maizegenetics.taxa.TaxaListBuilder
 
createHDF5TaxaModule(h5w) - Static method in class net.maizegenetics.util.HDF5Utils
 
CreateHybridGenotypesPlugin - Class in net.maizegenetics.analysis.data
 
CreateHybridGenotypesPlugin(parentFrame, isInteractive) - Constructor for class net.maizegenetics.analysis.data.CreateHybridGenotypesPlugin
 
createIdxValues(configFile, outputDir, datasetID, platformID, experimentID) - Static method in class net.maizegenetics.analysis.gobii.UpdateMarkerAndDNA_idxes
 
createIndex() - Method in class net.maizegenetics.analysis.data.LIXPlugin
Create Index for given file.
createIndex(value) - Method in class net.maizegenetics.analysis.data.LIXPlugin
Set Create Index. Create Index for given file.
createMaskForAlignmentConflicts(unimpAlign, donorAlign, print) - Static method in class net.maizegenetics.analysis.imputation.FILLINDonorGenotypeUtils
Create mask for all sites where major & minor are swapped between GenotypeTables returns in this order [goodMask, swapMjMnMask, errorMask, invariantMask]
createMergeOutfile(infiles, outfile) - Static method in class net.maizegenetics.analysis.gbs.MergeTagsByTaxaFilesByRowPlugin
Determines the dimensions of the merged matrix, and creates a RandomAccessFile on disk large enough to hold the data.
createMergeOutfile(infiles, outfile) - Static method in class net.maizegenetics.analysis.gbs.MergeTagsByTaxaFilesPlugin
Determines the dimensions of the merged matrix, and creates a RandomAccessFile on disk large enough to hold the data.
createMouseInputListener() - Method in class net.maizegenetics.tassel.SeqViewerPanel.MyTableUI
 
createNameGidMap(mappingFile, taxaField) - Method in class net.maizegenetics.analysis.gobii.HapBreakpoints_IFLFilePlugin
 
createNode() - Static method in class net.maizegenetics.taxa.tree.NodeFactory
create a node
createNode(id) - Static method in class net.maizegenetics.taxa.tree.NodeFactory
create a node, with a specified identifier
createNode(id, height) - Static method in class net.maizegenetics.taxa.tree.NodeFactory
create a node, with a specified identifier
createNode(node) - Static method in class net.maizegenetics.taxa.tree.NodeFactory
constructor used to clone a node and all children
createNode(children) - Static method in class net.maizegenetics.taxa.tree.NodeFactory
 
createNode(children, height) - Static method in class net.maizegenetics.taxa.tree.NodeFactory
Create a node with the specified children, and the specified branch height
createNodeBranchLength(branchLength, id) - Static method in class net.maizegenetics.taxa.tree.NodeFactory
create a node, with a specified identifier
createNodeBranchLength(branchLength, children) - Static method in class net.maizegenetics.taxa.tree.NodeFactory
Create a node with the specified children, and the specified branch length
createNodeList() - Method in class net.maizegenetics.taxa.tree.SimpleTree
count and list external and internal nodes and compute heights of each node
createNodeList() - Method in interface net.maizegenetics.taxa.tree.Tree
This method is called to ensure that the calls to other methods in this interface are valid.
createOrderEnumerator(size) - Method in interface net.maizegenetics.stats.math.OrderEnumerator.OEFactory
For generating an ordering from 0..size-1. Enumerator doesn't have to actually produce
createParametizedWrapper(parameters, lowerLimits, upperLimits, defaultValues) - Static method in class net.maizegenetics.taxa.tree.Parameterized.Utils
Create a wrapper around a set of double arrays to create a parameterized object (changes to parameterized object change given arrays)
createParametizedWrapper(parameters, lowerLimits, upperLimits, defaultValues, parametersSE) - Static method in class net.maizegenetics.taxa.tree.Parameterized.Utils
Create a wrapper around a set of double arrays to create a parameterized object (changes to parameterized object change given arrays)
createParentalByteGenos(genos, parentAGenos, parentBGenos, hets) - Method in class net.maizegenetics.analysis.data.GenosToABHPlugin
 
createPermutedData() - Method in class net.maizegenetics.analysis.association.AbstractFixedEffectLM
 
createPhenotypeFromRDataFrameElements(taxaArray, colNames, attributeType, dataVectors) - Static method in class net.maizegenetics.plugindef.GenerateRCode
 
createPhenotypeFromTransform(taxaListNames, variableNames, data, outputObjectName, types) - Static method in class net.maizegenetics.phenotype.PhenotypeUtils
 
createPhenotypeObjectFromDB(phenos) - Static method in class net.maizegenetics.phenotype.PhenotypeUtils
 
createPhenotypeObjectFromDB2(phenos) - Static method in class net.maizegenetics.phenotype.PhenotypeUtils
 
createPositions(genotypes, translate) - Static method in class net.maizegenetics.dna.snp.FilterGenotypeTable
 
createPostgreSQLStatement(conn) - Static method in class net.maizegenetics.analysis.gobii.GOBIIDbUtils
 
createPostScanEffectsReport - Variable in class net.maizegenetics.analysis.modelfitter.StepwiseAdditiveModelFitter
 
createPostScanEffectsReport(createIt) - Method in class net.maizegenetics.analysis.modelfitter.StepwiseAdditiveModelFitter
 
createPreScanEffectsReport - Variable in class net.maizegenetics.analysis.modelfitter.StepwiseAdditiveModelFitter
 
createPreScanEffectsReport(createIt) - Method in class net.maizegenetics.analysis.modelfitter.StepwiseAdditiveModelFitter
 
createRandomDistribution(arraySize, proportionToFill, maxValue) - Static method in class net.maizegenetics.dna.tag.TagsByTaxaByteHDF5TagGroups
 
createRefTagsFromBlast(chromStartEndFile, forwardP, reverseP, refTagPositionMap) - Method in class net.maizegenetics.analysis.gbs.repgen.RampSeqAlignFromBlastTags
 
createReportFromCurrentModel(sflm) - Method in class net.maizegenetics.analysis.modelfitter.StepwiseOLSModelFitter
 
createReportFromCurrentModelWithCI(sflm) - Method in class net.maizegenetics.analysis.modelfitter.StepwiseOLSModelFitter
 
createReportRowsFromCurrentModel(sflm) - Method in class net.maizegenetics.analysis.modelfitter.StepwiseOLSModelFitter
 
createReportRowsFromCurrentModelAfterScanCI(sflm) - Method in class net.maizegenetics.analysis.modelfitter.StepwiseOLSModelFitter
 
createResiduals() - Method in class net.maizegenetics.analysis.modelfitter.StepwiseAdditiveModelFitterPlugin
Create a phenotype dataset of model residuals for each chromosome. For each chromosome, the residuals will be calculated from a model with all terms EXCEPT the markers on that chromosome.
createResiduals(value) - Method in class net.maizegenetics.analysis.modelfitter.StepwiseAdditiveModelFitterPlugin
Set Create residuals. Create a phenotype dataset of model residuals for each chromosome. For each chromosome, the residuals will be calculated from a model with all terms EXCEPT the markers on that chromosome.
createResidualsByChr - Variable in class net.maizegenetics.analysis.modelfitter.StepwiseAdditiveModelFitter
 
createResidualsByChr(createIt) - Method in class net.maizegenetics.analysis.modelfitter.StepwiseAdditiveModelFitter
 
createResPhenotype(emma, taxa, traitName) - Method in class net.maizegenetics.analysis.association.CompressedMLMusingDoubleMatrix
 
createRootBlock(factor1, factor2) - Method in class net.maizegenetics.analysis.gbs.neobio.CrochemoreLandauZivUkelson
Computes the root block of the block table. See subclasses for actual implementation.
createRootBlock(factor1, factor2) - Method in class net.maizegenetics.analysis.gbs.neobio.CrochemoreLandauZivUkelsonGlobalAlignment
Creates the root block. This is a special case of the createBlock method. No information is actually computed.
createRootBlock(factor1, factor2) - Method in class net.maizegenetics.analysis.gbs.neobio.CrochemoreLandauZivUkelsonLocalAlignment
Creates the root block. This is a special case of the createBlock method. No information is actually computed.
createSmallCallTable(variants) - Static method in class net.maizegenetics.util.BuilderFromVCFUtil
 
createStep() - Method in class net.maizegenetics.analysis.modelfitter.StepwiseAdditiveModelFitterPlugin
Create a report of the which markers enter and leave the model as it is being fit.
createStep(value) - Method in class net.maizegenetics.analysis.modelfitter.StepwiseAdditiveModelFitterPlugin
Set Create step report. Create a report of the which markers enter and leave the model as it is being fit.
createStepReport - Variable in class net.maizegenetics.analysis.modelfitter.StepwiseAdditiveModelFitter
 
createStepReport(createIt) - Method in class net.maizegenetics.analysis.modelfitter.StepwiseAdditiveModelFitter
 
createSubPops(popdata, isNAM) - Static method in class net.maizegenetics.analysis.imputation.NucleotideImputationUtils
 
createTaxa(genotypes, translate) - Static method in class net.maizegenetics.dna.snp.FilterGenotypeTable
 
createTaxaMap(conn, mappingFile) - Method in class net.maizegenetics.analysis.gobii.MarkerDNARun_IFLFilePlugin
 
CreateTreePlugin - Class in net.maizegenetics.analysis.tree
 
CreateTreePlugin(parentFrame, isInteractive) - Constructor for class net.maizegenetics.analysis.tree.CreateTreePlugin
Creates a new instance of CreateTreePlugin
CreateTreePlugin.CLUSTERING_METHOD - Enum in net.maizegenetics.analysis.tree
 
creatMergeTBTByTagCount(infileDirS, outfileS, tagCountFileS) - Method in class net.maizegenetics.analysis.gbs.MergeTagsByTaxaFilesByRowPlugin
 
creatTagGeneticMappingInfoDatasets(startIndex, size) - Method in class net.maizegenetics.dna.map.TagsOnPhysicalMapV3
Creat datasets in HDF5 holding genetic mapping information, which is used to test multiple alignment hypothesis
creatTagGeneticMappingInfoGWDataset() - Method in class net.maizegenetics.dna.map.TagsOnPhysicalMapV3
Creat dataset in HDF5 holding genome wide genetic mapping information, which is used to build training dataset to predict hypothesis genetic mapping
creatTagMappingInfoDatasets(startIndex, size) - Method in class net.maizegenetics.dna.map.TagsOnPhysicalMapV3
Creat datasets in HDF5 holding mapping information, which is used to annotate the TOPM with multiple alignment hypothesis
criterionValue - Variable in class net.maizegenetics.analysis.modelfitter.AbstractAdditiveSite
 
criterionValue() - Method in class net.maizegenetics.analysis.modelfitter.AbstractAdditiveSite
 
criterionValue(value) - Method in class net.maizegenetics.analysis.modelfitter.AbstractAdditiveSite
 
criterionValue() - Method in interface net.maizegenetics.analysis.modelfitter.AdditiveSite
 
criterionValue(value) - Method in interface net.maizegenetics.analysis.modelfitter.AdditiveSite
 
CrochemoreLandauZivUkelson - Class in net.maizegenetics.analysis.gbs.neobio
This abstract class is the superclass of both global and local sequence alignment algorithms (with linear gap penalty function) due to Maxime Crochemore, Gad Landau and Michal Ziv-Ukelson (2002).
CrochemoreLandauZivUkelsonGlobalAlignment - Class in net.maizegenetics.analysis.gbs.neobio
This class implements the global pairwise sequence alignment algorithm (with linear gap penalty function) due to Maxime Crochemore, Gad Landau and Michal Ziv-Ukelson (2002).
CrochemoreLandauZivUkelsonLocalAlignment - Class in net.maizegenetics.analysis.gbs.neobio
This class implements the local pairwise sequence alignment algorithm (with linear gap penalty function) due to Maxime Crochemore, Gad Landau and Michal Ziv-Ukelson (2002).
crossproduct() - Method in class net.maizegenetics.matrixalgebra.Matrix.BlasDoubleMatrix
 
crossproduct(dm) - Method in class net.maizegenetics.matrixalgebra.Matrix.BlasDoubleMatrix
 
crossproduct() - Method in class net.maizegenetics.matrixalgebra.Matrix.ColtDoubleMatrix
 
crossproduct(dm) - Method in class net.maizegenetics.matrixalgebra.Matrix.ColtDoubleMatrix
 
crossproduct() - Method in interface net.maizegenetics.matrixalgebra.Matrix.DoubleMatrix
 
crossproduct(dm) - Method in interface net.maizegenetics.matrixalgebra.Matrix.DoubleMatrix
 
crossproduct() - Method in class net.maizegenetics.matrixalgebra.Matrix.EJMLDoubleMatrix
 
crossproduct(dm) - Method in class net.maizegenetics.matrixalgebra.Matrix.EJMLDoubleMatrix
 
CrossProgenyEmissionMatrix - Class in net.maizegenetics.analysis.imputation
 
CrossProgenyEmissionMatrix(hap, originalGenotypes, taxonIndex, siteIndices) - Constructor for class net.maizegenetics.analysis.imputation.CrossProgenyEmissionMatrix
 
CrossProgenyEmissionMatrix(hapProbs, originalGenotypes, stateByObs, taxonIndex, siteIndices) - Constructor for class net.maizegenetics.analysis.imputation.CrossProgenyEmissionMatrix
 
culledFiles(directoryFiles, keyFile) - Static method in class net.maizegenetics.analysis.gbs.v2.GBSUtils
Produces a list of fastq files that are represented by the plugin's keyfile
currentBlockIndex - Variable in class net.maizegenetics.dna.tag.AbstractTagsHDF5
 
currentIndex - Variable in class net.maizegenetics.dna.tag.AbstractTagsHDF5
 
currentTraitName - Variable in class net.maizegenetics.analysis.association.AbstractFixedEffectLM
 
currentTraitName - Variable in class net.maizegenetics.analysis.modelfitter.StepwiseAdditiveModelFitter
 
cutOrSnpPosition() - Method in class net.maizegenetics.analysis.gbs.v2.SNPCutPosTagVerificationPlugin
Cut Position
cutOrSnpPosition(value) - Method in class net.maizegenetics.analysis.gbs.v2.SNPCutPosTagVerificationPlugin
Set cut position.

D

data - Variable in class net.maizegenetics.analysis.gbs.neobio.Trie
This node's stored data.
DATA_SOURCE - Static variable in class net.maizegenetics.util.db.LambdaTuplesContext
 
DataAccessException - Exception in net.maizegenetics.util.db
General runtime Exception used to rethrow checked exceptions. It adds a bit of intelligence in that it adds an errorCode and state which it stored based on the wrapped exception (see SQL exception) User: julian3 Date: 2013/11/10 Time: 7:15 PM PROJECT: ${PROJECT} DESCRIPTION: Code Borrowed from http://java.dzone.com/articles/adding-java-8-lambda-goodness Original package can be downloaded from https://github.com/jexenberger/lambda-tuples
DataAccessException() - Constructor for exception net.maizegenetics.util.db.DataAccessException
 
DataAccessException(message) - Constructor for exception net.maizegenetics.util.db.DataAccessException
 
DataAccessException(message, cause) - Constructor for exception net.maizegenetics.util.db.DataAccessException
 
DataAccessException(cause) - Constructor for exception net.maizegenetics.util.db.DataAccessException
 
DataAccessException(message, cause, enableSuppression, writableStackTrace) - Constructor for exception net.maizegenetics.util.db.DataAccessException
 
dataAttributeList - Variable in class net.maizegenetics.analysis.modelfitter.StepwiseAdditiveModelFitter
 
dataAttributeStream() - Method in class net.maizegenetics.phenotype.CorePhenotype
 
dataAttributeStream() - Method in class net.maizegenetics.phenotype.FilterPhenotype
 
dataAttributeStream() - Method in interface net.maizegenetics.phenotype.Phenotype
 
dataname - Variable in class net.maizegenetics.analysis.modelfitter.StepwiseAdditiveModelFitter
 
dataset() - Method in class net.maizegenetics.analysis.gobii.GOBIIPlugin
Dataset Name
dataset(value) - Method in class net.maizegenetics.analysis.gobii.GOBIIPlugin
Set Dataset Name. Dataset Name
DataSet - Class in net.maizegenetics.plugindef
This is a set of Datum.
DataSet(list, creator) - Constructor for class net.maizegenetics.plugindef.DataSet
Creates a new instance of Datum
DataSet(theDatum, creator) - Constructor for class net.maizegenetics.plugindef.DataSet
Convenience constructor for a single Datum
DataSet(list, creator) - Constructor for class net.maizegenetics.plugindef.DataSet
Creates a new instance of Datum
dataSetDescription() - Method in class net.maizegenetics.analysis.data.BuildUnfinishedHDF5GenotypesPlugin
(Optional) Short data set description to be added as an root level annotation under "dataSetDescription"
dataSetDescription(value) - Method in class net.maizegenetics.analysis.data.BuildUnfinishedHDF5GenotypesPlugin
Set Data set description. (Optional) Short data set description to be added as an root level annotation under "/DataSetDescription"
dataSetDescription() - Method in class net.maizegenetics.analysis.data.MergeRenameDeleteTaxaPlugin
(Optional) Short data set description to be added as an root level annotation under "dataSetDescription"
dataSetDescription(value) - Method in class net.maizegenetics.analysis.data.MergeRenameDeleteTaxaPlugin
Set Data set description. (Optional) Short data set description to be added as an root level annotation under "/DataSetDescription"
dataSetDescription(dataSetDescription) - Method in class net.maizegenetics.dna.snp.GenotypeTableBuilder
 
dataSetName() - Method in class net.maizegenetics.analysis.data.BuildUnfinishedHDF5GenotypesPlugin
(Optional) Short data set name to be added as an root level annotation under "/DataSetName"
dataSetName(value) - Method in class net.maizegenetics.analysis.data.BuildUnfinishedHDF5GenotypesPlugin
Set Data set name. (Optional) Short data set name to be added as an root level annotation under "dataSetName"
dataSetName() - Method in class net.maizegenetics.analysis.data.MergeRenameDeleteTaxaPlugin
(Optional) Short data set name to be added as an root level annotation under "/DataSetName"
dataSetName(value) - Method in class net.maizegenetics.analysis.data.MergeRenameDeleteTaxaPlugin
Set Data set name. (Optional) Short data set name to be added as an root level annotation under "dataSetName"
datasetName() - Method in class net.maizegenetics.analysis.gobii.MarkerDNARun_IFLFilePlugin
Name of dataset for this data. Must match one the name of one of the administered datasets in the db.
datasetName(value) - Method in class net.maizegenetics.analysis.gobii.MarkerDNARun_IFLFilePlugin
Set Dataset Name. Name of dataset for this data. Must match one the name of one of the administered datasets in the db.
datasetName() - Method in class net.maizegenetics.analysis.gobii.MonetDB_IFLFilePlugin
Name of dataset whose marker and dnarun IDs are to be pulled
datasetName(value) - Method in class net.maizegenetics.analysis.gobii.MonetDB_IFLFilePlugin
Set dataset name. Name of dataset whose marker and dnarun IDs are to be pulled
datasetName() - Method in class net.maizegenetics.analysis.gobii.PreProcessGOBIIMappingFilePlugin
Name of dataset whose marker and dnarun IDs are to be pulled
datasetName(value) - Method in class net.maizegenetics.analysis.gobii.PreProcessGOBIIMappingFilePlugin
Set dataset name. Name of dataset whose marker and dnarun IDs are to be pulled
dataSetName(dataSetName) - Method in class net.maizegenetics.dna.snp.GenotypeTableBuilder
 
dataSetReturned(event) - Method in class net.maizegenetics.analysis.data.CombineDataSetsPlugin
 
dataSetReturned(event) - Method in class net.maizegenetics.analysis.data.PassThroughPlugin
 
dataSetReturned(event) - Method in class net.maizegenetics.pipeline.TasselPipeline
Returns Tassel data set after complete.
dataSetReturned(event) - Method in class net.maizegenetics.pipeline.TasselPipelineStepsDialog
 
dataSetReturned(event) - Method in class net.maizegenetics.plugindef.AbstractPlugin
Returns data set after complete.
dataSetReturned(event) - Method in class net.maizegenetics.plugindef.DefaultPluginListener
 
dataSetReturned(event) - Method in interface net.maizegenetics.plugindef.PluginListener
Returns Tassel data set after complete.
dataSetReturned(event) - Method in class net.maizegenetics.progress.PluginProgressUnit
 
dataSetReturned(event) - Method in class net.maizegenetics.tassel.DataTreePanel
Returns Tassel data set after complete.
DataTreePanel - Class in net.maizegenetics.tassel
 
DataTreePanel(theQAF) - Constructor for class net.maizegenetics.tassel.DataTreePanel
 
dataVector - Variable in class net.maizegenetics.plugindef.GenerateRCode.TableReportVectors
 
Datum - Class in net.maizegenetics.plugindef
This wraps data elements used as input or output to Tassel modules.
Datum(name, data, comment) - Constructor for class net.maizegenetics.plugindef.Datum
Creates a new instance of Datum
datumList() - Method in class net.maizegenetics.analysis.association.AbstractFixedEffectLM
 
datumList() - Method in interface net.maizegenetics.analysis.association.FixedEffectLM
 
datumList() - Method in class net.maizegenetics.analysis.association.PhenotypeLM
 
DAYS - Variable in interface net.maizegenetics.taxa.tree.Units
 
dbConfigFile() - Method in class net.maizegenetics.analysis.gobii.MarkerDNARun_IFLFilePlugin
DB connection config file
dbConfigFile(value) - Method in class net.maizegenetics.analysis.gobii.MarkerDNARun_IFLFilePlugin
Set dbConfigFile. DB connection config file
dbConfigFile() - Method in class net.maizegenetics.analysis.gobii.MonetDB_IFLFilePlugin
DB connection config file
dbConfigFile(value) - Method in class net.maizegenetics.analysis.gobii.MonetDB_IFLFilePlugin
Set dbConfigFile. DB connection config file
dbConfigFile() - Method in class net.maizegenetics.analysis.gobii.PreProcessGOBIIMappingFilePlugin
DB connection config file
dbConfigFile(value) - Method in class net.maizegenetics.analysis.gobii.PreProcessGOBIIMappingFilePlugin
Set dbConfigFile. DB connection config file
dBFile() - Method in class net.maizegenetics.analysis.gbs.repgen.RampSeqAlignFromBlastTags
Input database file with tags and taxa distribution
dBFile(value) - Method in class net.maizegenetics.analysis.gbs.repgen.RampSeqAlignFromBlastTags
Set Input DB. Input database file with tags and taxa distribution
dBFile() - Method in class net.maizegenetics.analysis.gbs.v2.SNPQualityProfilerPlugin
Name of output file (e.g. GBSv2.db)
dBFile(value) - Method in class net.maizegenetics.analysis.gbs.v2.SNPQualityProfilerPlugin
Set GBS DB File. Name of output file (e.g. GBSv2.db)
dBName() - Method in class net.maizegenetics.analysis.gobii.GOBIIPlugin
Database Name
dBName(value) - Method in class net.maizegenetics.analysis.gobii.GOBIIPlugin
Set Database Name. Database Name
DBTuple - Interface in net.maizegenetics.util.db
A tuple is as defined in the relational model, where each element is defined by a name, and is ordered according to the order of elements in the resultant set User: julian3 Date: 2013/11/14 Time: 12:12 PM PROJECT: ${PROJECT} DESCRIPTION: Code Borrowed from http://java.dzone.com/articles/adding-java-8-lambda-goodness Original package can be downloaded from https://github.com/jexenberger/lambda-tuples
dcoP - Variable in class net.maizegenetics.dna.map.TagMappingInfo
Double cross-over probability Round(Log2(P)), unknown Byte.MIN_VALUE
dcoP - Variable in class net.maizegenetics.dna.map.TagMappingInfoV3
Double cross-over probability Round(Log2(P)), unknown = Byte.MIN_VALUE
deCode(evidenceByte) - Static method in enum net.maizegenetics.analysis.gbs.AnnotateTOPM.EvidenceType
 
decodeBySign(srcCompChunk) - Static method in class net.maizegenetics.dna.tag.TagsByTaxaByteHDF5TagGroups
 
decodeBySign(source) - Static method in class net.maizegenetics.dna.tag.TagsByTaxaByteHDF5TagGroups
 
decodeBySign(srcCompChunk) - Static method in class net.maizegenetics.dna.tag.TagsByTaxaByteHDF5TaxaGroups
 
decodeBySign(source) - Static method in class net.maizegenetics.dna.tag.TagsByTaxaByteHDF5TaxaGroups
 
decodeSnpName(name) - Static method in class net.maizegenetics.dna.snp.io.ReadNumericMarkerUtils
 
DEFAULT - Static variable in class net.maizegenetics.matrixalgebra.Matrix.DoubleMatrixFactory
 
DEFAULT_ATTRIBUTES_PATH - Static variable in class net.maizegenetics.dna.snp.HapMapHDF5Constants
 
DEFAULT_CITATION - Static variable in class net.maizegenetics.plugindef.AbstractPlugin
 
DEFAULT_LENGTH - Variable in interface net.maizegenetics.taxa.tree.BranchLimits
default branch length
DEFAULT_MAX_NUMBER_ENTRIES - Static variable in class net.maizegenetics.util.ExceptionUtils
Default maximun number of entries.
DEFAULT_NAME - Static variable in class net.maizegenetics.phenotype.TaxaAttribute
 
defaultCache - Static variable in class net.maizegenetics.analysis.gbs.v2.EnzymeList
This is the application level default that will initiate using the EnzymeList default constructor.
DefaultDBTuple - Class in net.maizegenetics.util.db
Default implementation of a Tuple. It is a simple extension of an ArrayList and stored the values as an array User: julian3 Date: 2013/11/10 Time: 7:05 PM PROJECT: lambda_tuples DESCRIPTION: Code Borrowed from http://java.dzone.com/articles/adding-java-8-lambda-goodness Original package can be downloaded from https://github.com/jexenberger/lambda-tuples
DefaultDBTuple(list) - Constructor for class net.maizegenetics.util.db.DefaultDBTuple
 
DefaultDBTuple(values) - Constructor for class net.maizegenetics.util.db.DefaultDBTuple
 
DefaultPluginListener - Class in net.maizegenetics.plugindef
 
defaultValue() - Method in class net.maizegenetics.plugindef.PluginParameter
 
degree(n) - Method in class net.maizegenetics.util.DirectedGraph
 
degree(n) - Method in interface net.maizegenetics.util.Graph
Gets the degree of a node
degree(n) - Method in class net.maizegenetics.util.UndirectedGraph
 
degreesOfFreedom() - Method in class net.maizegenetics.stats.linearmodels.SolveByOrthogonalizing.Marker
 
deleteByThreshold(threshold) - Method in class net.maizegenetics.taxa.IdentifierSynonymizer
 
deleteElements(name) - Method in class net.maizegenetics.taxa.IdentifierSynonymizer
 
deleteOddColumns() - Method in class net.maizegenetics.analysis.gbs.neobio.Smawk
This method simulates a deletion of odd rows by manipulating the col array of indexes. In fact, nothing is deleted, but the indexes are moved to the end of the array in a way that they can be easily restored by the restoreOddColumns method using a reverse approach.
deleteOldData() - Method in class net.maizegenetics.analysis.gbs.v2.DiscoverySNPCallerPluginV2
Delete exisiting Discovery data from DB
deleteOldData(value) - Method in class net.maizegenetics.analysis.gbs.v2.DiscoverySNPCallerPluginV2
Set Delete old data flag. True indicates we want the db tables cleared
deleteOldData() - Method in class net.maizegenetics.analysis.gbs.v2.GBSSeqToTagDBPlugin
Delete exisiting DB
deleteOldData(value) - Method in class net.maizegenetics.analysis.gbs.v2.GBSSeqToTagDBPlugin
Set Delete old data flag. True indicates we want the db tables cleared
deleteOldData() - Method in class net.maizegenetics.analysis.gbs.v2.SAMToGBSdbPlugin
Delete exisiting Alignment data from DB
deleteOldData(value) - Method in class net.maizegenetics.analysis.gbs.v2.SAMToGBSdbPlugin
Set Delete old data flag. True indicates we want the db tables cleared
deleteOldData() - Method in class net.maizegenetics.analysis.gbs.v2.SNPQualityProfilerPlugin
Delete exisiting SNP Quality data from DB
deleteOldData(value) - Method in class net.maizegenetics.analysis.gbs.v2.SNPQualityProfilerPlugin
Set Delete old data flag. True indicates we want the db tables cleared
deleteOldData() - Method in class net.maizegenetics.analysis.rna.LoadRNAContigsToGBSDBPlugin
Delete existing SNP quality data from db tables
deleteOldData(value) - Method in class net.maizegenetics.analysis.rna.LoadRNAContigsToGBSDBPlugin
Set Delete Old Data. Delete existing SNP quality data from db tables
deleteRow(reduced_rows, k) - Method in class net.maizegenetics.analysis.gbs.neobio.Smawk
This method simulates a deletion of a row in the matrix during the reduce operation. It just moves the index to the end of the array in a way that it can be restored afterwards by the restoreRows method (nothing is actually deleted). Deleted indexes are kept in ascending order.
deleteSelectedNodes() - Method in class net.maizegenetics.tassel.DataTreePanel
 
deleteTaxon(taxonName) - Method in class net.maizegenetics.dna.tag.TagsByTaxaByteHDF5TaxaGroups
 
DELIMITER - Static variable in class net.maizegenetics.taxa.Taxon
 
delta - Variable in class net.maizegenetics.stats.EMMA.EMMAforDoubleMatrix
 
dependentOnParameter(parameter) - Method in class net.maizegenetics.plugindef.PluginParameter.Builder
 
dependentOnParameter(parameter, value) - Method in class net.maizegenetics.plugindef.PluginParameter.Builder
 
dependentOnParameter(parameter, values) - Method in class net.maizegenetics.plugindef.PluginParameter.Builder
 
dependentOnParameter() - Method in class net.maizegenetics.plugindef.PluginParameter
 
dependentOnParameterValue() - Method in class net.maizegenetics.plugindef.PluginParameter
 
depth() - Method in class net.maizegenetics.analysis.phg.ParseGVCF.GVCFLine
Total depth
depth() - Method in class net.maizegenetics.dna.snp.CombineGenotypeTable
 
depth() - Method in class net.maizegenetics.dna.snp.CoreGenotypeTable
 
depth() - Method in interface net.maizegenetics.dna.snp.GenotypeTable
Returns allele depth object (null if not present)
DEPTH - Static variable in class net.maizegenetics.dna.snp.HapMapHDF5Constants
 
depth() - Method in class net.maizegenetics.dna.snp.MergedGenotypeTable
 
depth(taxon, site) - Method in class net.maizegenetics.dna.snp.score.AlleleDepth
Returns sum of all nucleotide depths at given taxon and site.
depth() - Method in class net.maizegenetics.dna.snp.TOPMGenotypeTable
 
DEPTH_BYTE_MISSING - Static variable in class net.maizegenetics.dna.snp.score.AlleleDepthUtil
 
DEPTH_MISSING - Static variable in class net.maizegenetics.dna.snp.score.AlleleDepthUtil
 
depthByteToInt(depth) - Static method in class net.maizegenetics.dna.snp.score.AlleleDepthUtil
Converts byte depth to integer version. Positive depths value are exact, negative depths are log approximations
depthByteToInt(depth) - Static method in class net.maizegenetics.dna.snp.score.AlleleDepthUtil
Converts byte arrays of depth to integer array version. Positive depths value are exact, negative depths are log approximations
depthForAllele(taxon, site, allele) - Method in class net.maizegenetics.dna.snp.score.AlleleDepth
Same as value() but translates allele into scoreType
depthForAlleles(taxon, site) - Method in class net.maizegenetics.dna.snp.CombineGenotypeTable
 
depthForAlleles(taxon, site) - Method in class net.maizegenetics.dna.snp.CoreGenotypeTable
 
depthForAlleles(taxon, site) - Method in interface net.maizegenetics.dna.snp.GenotypeTable
Returns depth count for each diploid allele at the given taxon and site.
depthForAlleles(taxon, site) - Method in class net.maizegenetics.dna.snp.MergedGenotypeTable
 
depthForAlleles(taxon, site) - Method in class net.maizegenetics.dna.snp.TOPMGenotypeTable
 
depthForSite(site) - Method in class net.maizegenetics.dna.snp.score.AlleleDepth
Returns sum of all nucleotide depths across all taxa at given site.
depthForTaxon(taxon) - Method in class net.maizegenetics.dna.snp.score.AlleleDepth
Returns sum of all nucleotide depths across all sites at given taxon.
depthIntToByte(depth) - Static method in class net.maizegenetics.dna.snp.score.AlleleDepthUtil
Converts integer depth to byte version. Positive return values are exact, negative return values are log approximations
depthIntToByte(depth) - Static method in class net.maizegenetics.dna.snp.score.AlleleDepthUtil
Converts integer array of depth to byte array version. Positive return values are exact, negative return values are log approximations
depthIntToByte(depth) - Static method in class net.maizegenetics.dna.snp.score.AlleleDepthUtil
Converts a two dimensional integer array of depths to a 2D byte array version. Positive return values are exact, negative return values are log approximations
depthMergeSelection() - Method in class net.maizegenetics.analysis.data.MergeGenotypeTablesPluginV2
Selection for How to Merge Depths
depthMergeSelection(value) - Method in class net.maizegenetics.analysis.data.MergeGenotypeTablesPluginV2
Set Depth Merge Rule. Selection for How to Merge Depths
depthOfGenotypesToMask() - Method in class net.maizegenetics.analysis.imputation.FILLINImputationPlugin
Depth of genotypes to mask for accuracy calculation if depth information available
depthOfGenotypesToMask(value) - Method in class net.maizegenetics.analysis.imputation.FILLINImputationPlugin
Set Depth of genotypes to mask. Depth of genotypes to mask for accuracy calculation if depth information available
depths() - Method in interface net.maizegenetics.dna.tag.TaxaDistribution
Distribution of taxa depths across all taxa. Taxa with zero depth are included in the array
depthToOutput() - Method in class net.maizegenetics.analysis.gbs.repgen.RGBSProductionSNPCallerPlugin
Output depth: write depths to the output hdf5 genotypes file
depthToOutput(value) - Method in class net.maizegenetics.analysis.gbs.repgen.RGBSProductionSNPCallerPlugin
User sets true or false, indicating if they do or do not want depth information written to the HDF5 file.
depthToOutput() - Method in class net.maizegenetics.analysis.gbs.v2.ProductionSNPCallerPluginV2
Output depth: write depths to the output hdf5 genotypes file
depthToOutput(value) - Method in class net.maizegenetics.analysis.gbs.v2.ProductionSNPCallerPluginV2
User sets true or false, indicating if they do or do not want depth information written to the HDF5 file.
description(description) - Method in class net.maizegenetics.plugindef.PluginParameter.Builder
 
description() - Method in class net.maizegenetics.plugindef.PluginParameter
 
detailedSystemOutOnHaplotypes() - Method in class net.maizegenetics.analysis.imputation.FILLINFindHaplotypesPlugin
Details of taxa included in each haplotype to system out
detailedSystemOutOnHaplotypes(value) - Method in class net.maizegenetics.analysis.imputation.FILLINFindHaplotypesPlugin
Set Detailed system out on haplotypes. Details of taxa included in each haplotype to system out
determineKeyFormat(keyFile) - Static method in class net.maizegenetics.util.ConvertOldFastqToModernFormatPlugin
 
determineQualityScoreBase(fastqFile) - Static method in class net.maizegenetics.analysis.gbs.v2.GBSUtils
Method for reading FastQ four line structure, and returning a string array with [sequence, qualityScore]
df - Variable in class net.maizegenetics.stats.linearmodels.SolveByOrthogonalizing.Marker
 
dfError - Variable in class net.maizegenetics.stats.EMMA.EMMAforDoubleMatrix
 
dfMarker - Variable in class net.maizegenetics.stats.EMMA.EMMAforDoubleMatrix
 
dfModel - Variable in class net.maizegenetics.stats.EMMA.EMMAforDoubleMatrix
 
dfsLabeledEdges(G, source) - Static method in class net.maizegenetics.util.GraphUtils
Produces edges in a depth-first search starting at source and labeled -1,0,1 for forward, reverse, and nontree (direction type). Based on http://www.ics.uci.edu/~eppstein/PADS/DFS.py by D. Eppstein, July, 2004
dfsPostorderNodes(G, source) - Static method in class net.maizegenetics.util.GraphUtils
Produces nodes in a depth-first search post-ordering starting at source (i.e. listing node starting with the last node and headed toward source)
dfsPreorderNodes(G, source) - Static method in class net.maizegenetics.util.GraphUtils
Produces nodes in a depth-first search pre-ordering starting at source (i.e. listing node starting with the source node)
diagonal(diag) - Method in class net.maizegenetics.matrixalgebra.Matrix.DoubleMatrixFactory
 
DIAGONAL_DIRECTION - Static variable in class net.maizegenetics.analysis.gbs.neobio.CrochemoreLandauZivUkelson
A constant that indicates that the diagonal direction must be followed to reach the source of an optimal path in a block during the trace back procedure to retrieve a high scoring alignment.
DialogUtils - Class in net.maizegenetics.gui
 
diceWithMetaphone(s1, s2, ignoreCase, ignoreWhite, ignorePunc) - Static method in class net.maizegenetics.taxa.IdentifierSynonymizer
 
DifferenceGenotypeCallTable - Class in net.maizegenetics.dna.snp.genotypecall
 
DifferenceGenotypeCallTable(base, hybrids, parents) - Constructor for class net.maizegenetics.dna.snp.genotypecall.DifferenceGenotypeCallTable
 
dim - Variable in class net.maizegenetics.analysis.gbs.neobio.OutMatrix
The dimension of the OUT matrix.
dimension - Variable in class net.maizegenetics.analysis.gbs.neobio.ScoringMatrix
Dimension of the (squared) matrix.
diploidAsString(site, value) - Method in class net.maizegenetics.dna.snp.CombineGenotypeTable
 
diploidAsString(site, value) - Method in class net.maizegenetics.dna.snp.CoreGenotypeTable
 
diploidAsString(site, value) - Method in class net.maizegenetics.dna.snp.genotypecall.CombineGenotypeCallTable
 
diploidAsString(site, value) - Method in class net.maizegenetics.dna.snp.genotypecall.DifferenceGenotypeCallTable
 
diploidAsString(site, value) - Method in interface net.maizegenetics.dna.snp.genotypecall.GenotypeCallTable
Returns String representation of diploid allele value at site.
diploidAsString(site, value) - Method in class net.maizegenetics.dna.snp.genotypecall.GOBIIAvroGenotypeCallTable
 
diploidAsString(site, value) - Method in class net.maizegenetics.dna.snp.genotypecall.GOBIIGenotypeCallTable
 
diploidAsString(site, value) - Method in class net.maizegenetics.dna.snp.genotypecall.HybridGenotypeCallTable
 
diploidAsString(site, value) - Method in class net.maizegenetics.dna.snp.genotypecall.LineIndexHapmapGenotypeCallTable
 
diploidAsString(site, value) - Method in class net.maizegenetics.dna.snp.genotypecall.MaskGenotypeCallTable
 
diploidAsString(site, value) - Method in class net.maizegenetics.dna.snp.genotypecall.ProjectionGenotypeCallTable
 
diploidAsString(site, value) - Method in interface net.maizegenetics.dna.snp.GenotypeTable
Returns String representation of diploid allele value at site.
diploidAsString(site, value) - Method in class net.maizegenetics.dna.snp.MergedGenotypeTable
 
diploidAsString(site, value) - Method in class net.maizegenetics.dna.snp.TOPMGenotypeTable
 
DirectedGraph<T> - Class in net.maizegenetics.util
Class used to represent a directed graph The design is inspired by the Python networkx library (https://networkx.github.io/)
DirectedGraph(nodes, adj, pred, wts) - Constructor for class net.maizegenetics.util.DirectedGraph
 
direction - Variable in class net.maizegenetics.analysis.gbs.neobio.AlignmentBlock
An array of directions that must be followed to reach the source of the highest scoring path for each entry in the output border.
direction - Variable in class net.maizegenetics.analysis.modelfitter.AbstractAdditiveSite
 
direction() - Method in class net.maizegenetics.analysis.rna.FindMatchByWordHash.Match
 
DirectoryCrawler - Class in net.maizegenetics.util
Directory crawler that matches REGEX or Glob patterns. Glob patterns are indicated by using the syntax:pattern approach that is used by PathMatcher. So to use glob "glob:*.{hmp,hmp.gz}"
dirOfFiles() - Method in class net.maizegenetics.analysis.distance.VCAPScanPlugin
Directory contains files for sub-matrices. Can be text (.txt) containing chromosome / positions, Bed (.bed), or Position List (.json or .json.gz)
dirOfFiles(value) - Method in class net.maizegenetics.analysis.distance.VCAPScanPlugin
Set Dir Of Files. Directory contains files for sub-matrices. Can be text (.txt) containing chromosome / positions, Bed (.bed), or Position List (.json or .json.gz)
discoverSNPsOnChromosome(targetChromo, locusLogDOS) - Method in class net.maizegenetics.analysis.gbs.DiscoverySNPCallerPlugin
 
DiscoverySNPCallerPlugin - Class in net.maizegenetics.analysis.gbs
This class aligns tags at the same physical location against one another, calls SNPs, and then outputs the SNPs to a HapMap file. It is multi-threaded, as there are substantial speed increases with it.
DiscoverySNPCallerPlugin() - Constructor for class net.maizegenetics.analysis.gbs.DiscoverySNPCallerPlugin
 
DiscoverySNPCallerPlugin(parentFrame, isInteractive) - Constructor for class net.maizegenetics.analysis.gbs.DiscoverySNPCallerPlugin
 
DiscoverySNPCallerPluginV2 - Class in net.maizegenetics.analysis.gbs.v2
This class aligns tags at the same physical location against one another, calls SNPs, and then outputs the SNPs to a HapMap file. It is multi-threaded, as there are substantial speed increases with it.
DiscoverySNPCallerPluginV2() - Constructor for class net.maizegenetics.analysis.gbs.v2.DiscoverySNPCallerPluginV2
 
DiscoverySNPCallerPluginV2(parentFrame, isInteractive) - Constructor for class net.maizegenetics.analysis.gbs.v2.DiscoverySNPCallerPluginV2
 
DiscreteSitesFELM - Class in net.maizegenetics.analysis.association
 
DiscreteSitesFELM(dataset, parentPlugin) - Constructor for class net.maizegenetics.analysis.association.DiscreteSitesFELM
 
displayDecimal(out, number, width) - Method in class net.maizegenetics.util.FormattedOutput
print decimal number with a prespecified number of digits after the point
displayInteger(out, num, maxNum) - Method in class net.maizegenetics.util.FormattedOutput
print integer, aligned to a reference number, (introducing space at the left side)
displayIntegerWhite(out, maxNum) - Method in class net.maizegenetics.util.FormattedOutput
print whitespace of length of a string displaying a given integer
displayLabel(out, label, width) - Method in class net.maizegenetics.util.FormattedOutput
print label with a prespecified length (label will be shortened or spaces will introduced, if necessary)
displayNamPCsOnTASSELGUI(PCResults, chrVector, posVector, startPosVector, endPosVector, theGenotypesForCalculatingPCs) - Method in class net.maizegenetics.analysis.data.ProjectPcsAndRunModelSelectionPlugin
 
displayProjectedPCsOnTASSELGUI(ProjectedPCs, chrVector, posVector, startPosVector, endPosVector, theAlignmentForGenotype) - Method in class net.maizegenetics.analysis.data.ProjectPcsAndRunModelSelectionPlugin
 
dist - Variable in class net.maizegenetics.analysis.gbs.neobio.OutMatrix
The DIST matrix of a block.
dist(b1, b2, min) - Static method in class net.maizegenetics.analysis.imputation.LDKNNiImputationHetV2Plugin
Alternative to current IBS distance measure AA <> AA = 0 Aa <> Aa = 0 distance (normal IBS distance this is 0.5) AA <> aa = 1 distance
dist(b1, b2, min) - Static method in class net.maizegenetics.analysis.imputation.LDKNNiImputationHetV3Plugin
Alternative to current IBS distance measure AA <> AA = 0 Aa <> Aa = 0 distance (normal IBS distance this is 0.5) AA <> aa = 1 distance
dist(b1, b2, min) - Static method in class net.maizegenetics.analysis.imputation.LDKNNiImputationPlugin
Alternative to current IBS distance measure AA <> AA = 0 Aa <> Aa = 0 distance (normal IBS distance this is 0.5) AA <> aa = 1 distance
dist_column - Variable in class net.maizegenetics.analysis.gbs.neobio.AlignmentBlock
The DIST column of this block.
distance(data1, data2, isManhattan) - Static method in class net.maizegenetics.analysis.numericaltransform.kNearestNeighbors
Compute Manhattan or Eulcidean distance between two vectors.
distance2clusterIndex - Variable in class net.maizegenetics.analysis.association.CompressedDoubleMatrix
 
distance_choice() - Method in class net.maizegenetics.analysis.numericaltransform.ImputationPlugin
 
distance_choice(value) - Method in class net.maizegenetics.analysis.numericaltransform.ImputationPlugin
 
distanceFrom(h0) - Method in class net.maizegenetics.analysis.clustering.Haplotype
Distance is defined as the sum of the distances between each pair of sites. If one or both of the sites are missing then the distance is zero. If the sites are equal the distance is zero. If both sites are homozygous but different, the distance is 2. If one site is heterozygous, the distance is 1.
distanceMatrix() - Method in class net.maizegenetics.plugindef.PluginParameter.Builder
 
DistanceMatrix - Class in net.maizegenetics.taxa.distance
Storage for pairwise distance matrices. Only stores half the matrix as it is symmetrical.
DistanceMatrix(distance, taxa) - Constructor for class net.maizegenetics.taxa.distance.DistanceMatrix
Constructor taking distances array and taxa list. Use DistanceMatrixBuilder instead of this.
DistanceMatrix(distances, taxa, annotations) - Constructor for class net.maizegenetics.taxa.distance.DistanceMatrix
Use DistanceMatrixBuilder instead of this.
DistanceMatrix(dm) - Constructor for class net.maizegenetics.taxa.distance.DistanceMatrix
Constructor that clones a distance matrix.
DistanceMatrix(dm, subset) - Constructor for class net.maizegenetics.taxa.distance.DistanceMatrix
Constructor that clones a distance matrix and for only the specified taxa.
DistanceMatrixBuilder - Class in net.maizegenetics.taxa.distance
 
DistanceMatrixPlugin - Class in net.maizegenetics.analysis.distance
 
DistanceMatrixPlugin(parentFrame, isInteractive) - Constructor for class net.maizegenetics.analysis.distance.DistanceMatrixPlugin
 
DistanceMatrixRangesPlugin - Class in net.maizegenetics.analysis.distance
 
DistanceMatrixRangesPlugin(parentFrame, isInteractive) - Constructor for class net.maizegenetics.analysis.distance.DistanceMatrixRangesPlugin
 
DistanceMatrixUtils - Class in net.maizegenetics.taxa.distance
Utility functions for distance matrices
DistanceMatrixWithCounts - Class in net.maizegenetics.taxa.distance
 
divergence - Variable in class net.maizegenetics.dna.map.TagMappingInfo
Number of diverging bp (edit distance) from reference, unknown = Byte.MIN_VALUE
divergence - Variable in class net.maizegenetics.dna.map.TagMappingInfoV3
Number of diverging bp (edit distance) from reference, unknown = Byte.MIN_VALUE
DiversityAnalyses - Class in net.maizegenetics.analysis.popgen
This method calculated estimates of nucleotide diversity (pi, theta, etc). In order to provide high performance, it establishes one nucleotide SitePattern, and then manipulates the weighting patterns for sliding windows and different types of sites. Total segregating sites needs to be adjusted for missing and gap data, as this will modify Theta and Tajima estimates
DiversityAnalyses(aa, slidingWindow, start, end, window, step, thePolymorphismDistribution) - Constructor for class net.maizegenetics.analysis.popgen.DiversityAnalyses
Constructor that uses a sliding window
DiversityAnalyses(aa, slidingWindow, start, end, window, step) - Constructor for class net.maizegenetics.analysis.popgen.DiversityAnalyses
 
divideChromosome(a, appoxSitesPerHaplotype, verboseOutput) - Static method in class net.maizegenetics.analysis.imputation.FILLINFindHaplotypesPlugin
Divides a genome up into roughly equally sized blocks of sites
divideChromosome(a, appoxSitesPerHaplotype) - Static method in class net.maizegenetics.analysis.imputation.FindMergeHaplotypesPlugin
 
doesGenotypeDepthExist(reader) - Static method in class net.maizegenetics.util.HDF5Utils
 
doesGenotypeModuleExist(reader) - Static method in class net.maizegenetics.util.HDF5Utils
 
doesOverlapMatch(h0, h1, overlap, forward) - Static method in class net.maizegenetics.analysis.imputation.BiparentalHaplotypeFinder
 
doesTaxaModuleExist(reader) - Static method in class net.maizegenetics.util.HDF5Utils
 
doesTaxonHaveAllAnnotations(taxon, filters) - Static method in class net.maizegenetics.taxa.TaxaListIOUtils
Tests whether a taxon has annotation values in the map
doMerge(c0, c1, maxdiff) - Static method in class net.maizegenetics.analysis.clustering.HaplotypeClusterer
Tests whether two clusters are less than or equal to maxdiff distant. Uses clusterDistanceMaxPairDiff() to calculate distance.
DominanceNormalizedIBSMatrix - Class in net.maizegenetics.analysis.distance
 
DominanceRelationshipMatrix - Class in net.maizegenetics.analysis.distance
Compute Dominance Relationship Matrix for all pairs of taxa. Missing sites are ignored. http://www.genetics.org/content/198/4/1759.abstract
donor1Taxon - Variable in class net.maizegenetics.analysis.popgen.DonorHypoth
 
donor2Taxon - Variable in class net.maizegenetics.analysis.popgen.DonorHypoth
 
donorDir() - Method in class net.maizegenetics.analysis.imputation.FILLINImputationPlugin
Directory containing donor haplotype files from output of FILLINFindHaplotypesPlugin. All files with '.gc' in the filename will be read in, only those with matching sites are used
donorDir(value) - Method in class net.maizegenetics.analysis.imputation.FILLINImputationPlugin
Set Donor Dir. Directory containing donor haplotype files from output of FILLINFindHaplotypesPlugin. All files with '.gc' in the filename will be read in, only those with matching sites are used
donorDir() - Method in class net.maizegenetics.analysis.imputation.ReImputeUpdatedTaxaByFILLINPlugin
Directory containing donor haplotype files from output of the FILLINFindHaplotypesPlugin. All files with '.gc' in the filename will be read in, only those with matching sites are used
donorDir(value) - Method in class net.maizegenetics.analysis.imputation.ReImputeUpdatedTaxaByFILLINPlugin
Set Donor Dir. Directory containing donor haplotype files from output of the FILLINFindHaplotypesPlugin. All files with '.gc' in the filename will be read in, only those with matching sites are used
DonorHaplotypes - Class in net.maizegenetics.dna.map
Defines the haplotypes and positions of a chromosomal segment
DonorHaplotypes(chromosome, startPosition, endPosition, parent1index, parent2index) - Constructor for class net.maizegenetics.dna.map.DonorHaplotypes
 
DonorHypoth - Class in net.maizegenetics.analysis.popgen
 
DonorHypoth(targetTaxon, donor1Taxon, donor2Taxon, startBlock, focusBlock, endBlock, totalSites, mendelianErrors) - Constructor for class net.maizegenetics.analysis.popgen.DonorHypoth
 
DonorHypoth(targetTaxon, donor1Taxon, donor2Taxon, startBlock, focusBlock, endBlock) - Constructor for class net.maizegenetics.analysis.popgen.DonorHypoth
 
donorMapFile() - Method in class net.maizegenetics.analysis.gobii.HapBreakpoints_IFLFilePlugin
tab-delimited File containing a TaxaColumn name to be used to map breakFile donors with a GID. This may be the same file that was used for adding germplasm and marker data.
donorMapFile(value) - Method in class net.maizegenetics.analysis.gobii.HapBreakpoints_IFLFilePlugin
Set mappingFile. tab-delimited File containing a TaxaColumn name to be used to map breakFile donors with a GID. This may be the same file that was used for adding germplasm and marker data.
dosage() - Method in class net.maizegenetics.dna.snp.CombineGenotypeTable
 
dosage(taxon, site) - Method in class net.maizegenetics.dna.snp.CombineGenotypeTable
 
dosage() - Method in class net.maizegenetics.dna.snp.CoreGenotypeTable
 
dosage(taxon, site) - Method in class net.maizegenetics.dna.snp.CoreGenotypeTable
 
dosage() - Method in interface net.maizegenetics.dna.snp.GenotypeTable
Returns dosage object (null if not present)
dosage(taxon, site) - Method in interface net.maizegenetics.dna.snp.GenotypeTable
 
dosage() - Method in class net.maizegenetics.dna.snp.MergedGenotypeTable
 
dosage(taxon, site) - Method in class net.maizegenetics.dna.snp.MergedGenotypeTable
 
Dosage - Class in net.maizegenetics.dna.snp.score
 
dosage() - Method in class net.maizegenetics.dna.snp.TOPMGenotypeTable
 
dosage(taxon, site) - Method in class net.maizegenetics.dna.snp.TOPMGenotypeTable
 
DosageBuilder - Class in net.maizegenetics.dna.snp.score
 
doTagsByTaxaExist(reader) - Static method in class net.maizegenetics.util.HDF5Utils
 
doTagsExist(reader) - Static method in class net.maizegenetics.util.HDF5Utils
 
doTaxonCallsExist(reader, taxonName) - Static method in class net.maizegenetics.util.HDF5Utils
 
doTaxonCallsExist(reader, taxon) - Static method in class net.maizegenetics.util.HDF5Utils
 
DoubleFormat - Class in net.maizegenetics.util
 
DoubleMatrix - Interface in net.maizegenetics.matrixalgebra.Matrix
 
DoubleMatrixFactory - Class in net.maizegenetics.matrixalgebra.Matrix
 
DoubleMatrixFactory(type) - Constructor for class net.maizegenetics.matrixalgebra.Matrix.DoubleMatrixFactory
 
DoubleMatrixFactory.FactoryType - Enum in net.maizegenetics.matrixalgebra.Matrix
 
doubleValue(obs) - Method in class net.maizegenetics.phenotype.NumericAttribute
 
doubleValues() - Method in class net.maizegenetics.phenotype.NumericAttribute
 
dprime(value) - Method in class net.maizegenetics.analysis.popgen.LDResult.Builder
 
dPrime() - Method in class net.maizegenetics.analysis.popgen.LDResult
 
DPRIME - Static variable in class net.maizegenetics.analysis.popgen.LinkageDisequilibriumComponent
 
duplicateHetsThreshold() - Method in class net.maizegenetics.analysis.imputation.LDKNNiImputationHetV2Plugin
Threshold for defining heterozygous sites
duplicateHetsThreshold(value) - Method in class net.maizegenetics.analysis.imputation.LDKNNiImputationHetV2Plugin
Set HeterozygousThreshold. Threshold for defining heterozygous sites
duplicateHetsThreshold() - Method in class net.maizegenetics.analysis.imputation.LDKNNiImputationHetV3Plugin
Threshold for defining heterozygous sites
duplicateHetsThreshold(value) - Method in class net.maizegenetics.analysis.imputation.LDKNNiImputationHetV3Plugin
Set HeterozygousThreshold. Threshold for defining heterozygous sites
DynamicBitStorage - Class in net.maizegenetics.dna.snp.bit
Provides rapid conversion routines and caching from byte encoding of nucleotides to bit encoding. Only two alleles are supported for each scope (e.g. Major and minor, or Reference and Alternate).
DynamicBitStorage(genotype, allele, prefAllele) - Constructor for class net.maizegenetics.dna.snp.bit.DynamicBitStorage
 

E

E_path_ancestor - Variable in class net.maizegenetics.analysis.gbs.neobio.LocalAlignmentBlock
An array of pointers to blocks that are source of E-paths.
E_path_ancestor_index - Variable in class net.maizegenetics.analysis.gbs.neobio.LocalAlignmentBlock
Indexes of of the entry in the ancestor block that is the source of the E-path.
E_path_score - Variable in class net.maizegenetics.analysis.gbs.neobio.LocalAlignmentBlock
The value of the highest scoring path which starts at the input border of this block and ends inside it, called E-path.
edges() - Method in class net.maizegenetics.util.DirectedGraph
 
edges() - Method in interface net.maizegenetics.util.Graph
Gets a collection of the edges
edges() - Method in class net.maizegenetics.util.UndirectedGraph
 
edgesIter() - Method in class net.maizegenetics.util.DirectedGraph
 
edgesIter() - Method in interface net.maizegenetics.util.Graph
Iterates over the edges
edgesIter() - Method in class net.maizegenetics.util.UndirectedGraph
 
editDistanceScoreMatch(s1, s2, ignoreCase, ignoreWhite, ignorePunc) - Static method in class net.maizegenetics.taxa.IdentifierSynonymizer
 
editWithMetaphone(s1, s2, ignoreCase, ignoreWhite, ignorePunc) - Static method in class net.maizegenetics.taxa.IdentifierSynonymizer
 
eig - Variable in class net.maizegenetics.stats.EMMA.EMMAforDoubleMatrix
 
eigA - Variable in class net.maizegenetics.stats.EMMA.EMMAforDoubleMatrix
 
EigenvalueDecomposition - Interface in net.maizegenetics.matrixalgebra.decomposition
 
eigenvalues - Variable in class net.maizegenetics.matrixalgebra.decomposition.BlasEigenvalueDecomposition
 
eigenValueSymmetricDecomposition(order, A, eigval, eigvector) - Static method in class net.maizegenetics.matrixalgebra.Matrix.BlasDoubleMatrix
 
eigenvectors - Variable in class net.maizegenetics.matrixalgebra.decomposition.BlasEigenvalueDecomposition
 
EJMLDoubleMatrix - Class in net.maizegenetics.matrixalgebra.Matrix
 
EJMLDoubleMatrix(matrix) - Constructor for class net.maizegenetics.matrixalgebra.Matrix.EJMLDoubleMatrix
 
EJMLDoubleMatrix(row, col) - Constructor for class net.maizegenetics.matrixalgebra.Matrix.EJMLDoubleMatrix
 
EJMLDoubleMatrix(row, col, values) - Constructor for class net.maizegenetics.matrixalgebra.Matrix.EJMLDoubleMatrix
 
EJMLDoubleMatrix(row, col, value) - Constructor for class net.maizegenetics.matrixalgebra.Matrix.EJMLDoubleMatrix
 
EJMLDoubleMatrix(values) - Constructor for class net.maizegenetics.matrixalgebra.Matrix.EJMLDoubleMatrix
 
EJMLDoubleMatrix(dist) - Constructor for class net.maizegenetics.matrixalgebra.Matrix.EJMLDoubleMatrix
 
EJMLDoubleMatrix(size) - Constructor for class net.maizegenetics.matrixalgebra.Matrix.EJMLDoubleMatrix
 
EJMLDoubleMatrix(diagonal) - Constructor for class net.maizegenetics.matrixalgebra.Matrix.EJMLDoubleMatrix
 
EJMLEigenvalueDecomposition - Class in net.maizegenetics.matrixalgebra.decomposition
 
EJMLEigenvalueDecomposition(matrix, isSymmetric) - Constructor for class net.maizegenetics.matrixalgebra.decomposition.EJMLEigenvalueDecomposition
 
EJMLSingularValueDecomposition - Class in net.maizegenetics.matrixalgebra.decomposition
 
EJMLSingularValueDecomposition(matrix) - Constructor for class net.maizegenetics.matrixalgebra.decomposition.EJMLSingularValueDecomposition
 
emission(emission) - Method in class net.maizegenetics.analysis.imputation.BackwardForwardAlgorithm
 
emission(emission) - Method in class net.maizegenetics.analysis.imputation.BackwardForwardVariableStateNumber
 
EmissionProbability - Class in net.maizegenetics.analysis.imputation
 
EmissionProbability() - Constructor for class net.maizegenetics.analysis.imputation.EmissionProbability
 
EMMAforDoubleMatrix - Class in net.maizegenetics.stats.EMMA
Class for implementation of the EMMA algorithm often used in GWAS. Initially developer by Kang et al Genetics March 2008 178:1709-1723
EMMAforDoubleMatrix(y, fixed, kin, nAlleles) - Constructor for class net.maizegenetics.stats.EMMA.EMMAforDoubleMatrix
 
EMMAforDoubleMatrix(data, fixed, kin, nAlleles, delta) - Constructor for class net.maizegenetics.stats.EMMA.EMMAforDoubleMatrix
This constructor assumes that Z is the identity matrix for calculating blups, predicted values and residuals. If that is not true use the contstructor that explicity takes Z. This constructor treats A as ZKZ' so it can be used if blups and residuals are not needed.
EMMAforDoubleMatrix(data, fixed, kin, inZ, nAlleles, delta) - Constructor for class net.maizegenetics.stats.EMMA.EMMAforDoubleMatrix
This constructor should be used when Z is not the identity matrix. Z is needed to calculate blups and residuals.
EMMAforDoubleMatrix(data, fixed, kin) - Constructor for class net.maizegenetics.stats.EMMA.EMMAforDoubleMatrix
This constructor is designed for G-BLUP. Uses kinship matrix with phenotypes in same order. Phenotypes = NaN for prediction set. Assumes that Z is the identity matrix for calculating blups, predicted values and residuals. If that is not true use the constructor that explicity takes Z. This constructor treats A as ZKZ' so it can be used if blups and residuals are not needed.
EMPTY_ANNOTATION_STORAGE - Static variable in class net.maizegenetics.util.GeneralAnnotationStorage
 
encodeBySign(source, chunkSize) - Static method in class net.maizegenetics.dna.tag.TagsByTaxaByteHDF5TagGroups
 
encodeBySign(source) - Static method in class net.maizegenetics.dna.tag.TagsByTaxaByteHDF5TagGroups
 
encodeBySign(source, chunkSize) - Static method in class net.maizegenetics.dna.tag.TagsByTaxaByteHDF5TaxaGroups
 
encodeBySign(source) - Static method in class net.maizegenetics.dna.tag.TagsByTaxaByteHDF5TaxaGroups
 
encodeTaxaDepth() - Method in interface net.maizegenetics.dna.tag.TaxaDistribution
Custom run length encoding compression that also use Snappy
end - Variable in class net.maizegenetics.analysis.modelfitter.CovariatePermutationTestSpliterator
 
end - Variable in class net.maizegenetics.analysis.modelfitter.ForwardStepAdditiveSpliterator
 
end() - Method in class net.maizegenetics.dna.snp.io.ReadBedfile.BedFileRange
Returns end position (exclusive)
endBlock - Variable in class net.maizegenetics.analysis.popgen.DonorHypoth
 
endChr() - Method in class net.maizegenetics.analysis.filter.FilterSiteBuilderPlugin
End Chr
endChr(value) - Method in class net.maizegenetics.analysis.filter.FilterSiteBuilderPlugin
Set End Chr. End Chr
endChr() - Method in class net.maizegenetics.dna.snp.FilterSite
 
endChromosome() - Method in class net.maizegenetics.analysis.gbs.DiscoverySNPCallerPlugin
End Chromosome
endChromosome(value) - Method in class net.maizegenetics.analysis.gbs.DiscoverySNPCallerPlugin
Set End Chromosome. End Chromosome
endChromosome() - Method in class net.maizegenetics.analysis.gbs.v2.DiscoverySNPCallerPluginV2
End Chromosome
endChromosome(value) - Method in class net.maizegenetics.analysis.gbs.v2.DiscoverySNPCallerPluginV2
Set End Chromosome. End Chromosome
endCoordinate(cigarString, startCoordinate) - Static method in class net.maizegenetics.dna.tag.SAMUtils
Uses a CIGAR code and the start coordinate of a BWA alignment to find the corresponding end coordinate.
EndelmanDistanceMatrix - Class in net.maizegenetics.analysis.distance
 
endLambda() - Method in class net.maizegenetics.analysis.numericaltransform.BoxCoxTransformationPlugin
End Lambda
endLambda(value) - Method in class net.maizegenetics.analysis.numericaltransform.BoxCoxTransformationPlugin
Set End Lambda. End Lambda
endPos() - Method in class net.maizegenetics.analysis.filter.FilterSiteBuilderPlugin
End Pos
endPos(value) - Method in class net.maizegenetics.analysis.filter.FilterSiteBuilderPlugin
Set End Pos. End Pos
endPos() - Method in class net.maizegenetics.dna.snp.FilterSite
 
endPosition() - Method in class net.maizegenetics.analysis.phg.ParseGVCF.GVCFLine
End physical position (inclusive)
endPosition - Variable in class net.maizegenetics.dna.map.TagMappingInfo
Chromosomal position of the common adapter end of the tag (smaller than startPosition if tag matches minus strand)
endPosition - Variable in class net.maizegenetics.dna.map.TagMappingInfoV3
Chromosomal position of the common adapter end of the tag (smaller than startPosition if tag matches minus strand), inclusive, unknown = Integer.MIN_VALUE
endSite() - Method in class net.maizegenetics.analysis.filter.FilterSiteBuilderPlugin
End Site
endSite(value) - Method in class net.maizegenetics.analysis.filter.FilterSiteBuilderPlugin
Set End Site. End Site
endSite - Variable in class net.maizegenetics.analysis.popgen.DonorHypoth
 
endSite() - Method in class net.maizegenetics.analysis.popgen.SequenceDiversityPlugin
End Site
endSite(value) - Method in class net.maizegenetics.analysis.popgen.SequenceDiversityPlugin
Set End Site. End Site
endSite() - Method in class net.maizegenetics.dna.snp.FilterSite
 
ensureCapacity(numBits) - Method in interface net.maizegenetics.util.BitSet
Ensure that the long[] is big enough to hold numBits, expanding it if necessary. getNumWords() is unchanged by this call.
ensureCapacity(numBits) - Method in class net.maizegenetics.util.OpenBitSet
Ensure that the long[] is big enough to hold numBits, expanding it if necessary. getNumWords() is unchanged by this call.
ensureCapacity(numBits) - Method in class net.maizegenetics.util.UnmodifiableBitSet
 
ensureCapacityWords(numWords) - Method in interface net.maizegenetics.util.BitSet
Expand the long[] with the size given as a number of words (64 bit longs). getNumWords() is unchanged by this call.
ensureCapacityWords(numWords) - Method in class net.maizegenetics.util.OpenBitSet
Expand the long[] with the size given as a number of words (64 bit longs). getNumWords() is unchanged by this call.
ensureCapacityWords(numWords) - Method in class net.maizegenetics.util.UnmodifiableBitSet
 
enterLimit - Variable in class net.maizegenetics.analysis.modelfitter.AbstractForwardRegression
 
enterLimit() - Method in class net.maizegenetics.analysis.modelfitter.ResamplingGWASPlugin
A new term entering the model must have a p-value equal to or less than the enter limit. (Default = 1e-8)
enterLimit(value) - Method in class net.maizegenetics.analysis.modelfitter.ResamplingGWASPlugin
Set Enter Limit. A new term entering the model must have a p-value equal to or less than the enter limit. (Default = 1e-8)
enterLimit - Variable in class net.maizegenetics.analysis.modelfitter.StepwiseAdditiveModelFitter
 
enterLimit(limit) - Method in class net.maizegenetics.analysis.modelfitter.StepwiseAdditiveModelFitter
 
enterLimit() - Method in class net.maizegenetics.analysis.modelfitter.StepwiseAdditiveModelFitterPlugin
When p-value is the model selection criteria, model fitting will stop when the next term chosen has a p-value greater than the enterLimit. This value will be over-ridden the permutation test, if used.
enterLimit(value) - Method in class net.maizegenetics.analysis.modelfitter.StepwiseAdditiveModelFitterPlugin
Set enterLimit. When p-value is the model selection criteria, model fitting will stop when the next term chosen has a p-value greater than the enterLimit. This value will be over-ridden the permutation test, if used.
enterlimit() - Method in class net.maizegenetics.analysis.modelfitter.StepwiseOLSModelFitterPlugin
The enter limit or maximum p-value for which a term can enter the model
enterlimit(value) - Method in class net.maizegenetics.analysis.modelfitter.StepwiseOLSModelFitterPlugin
Set Entry limit. The enter limit or maximum p-value for which a term can enter the model
entrySet() - Method in class net.maizegenetics.analysis.avro.GenericMapAnnotations
 
enzyme(value) - Method in class net.maizegenetics.analysis.gbs.FastqToTagCountPlugin
 
enzyme() - Method in class net.maizegenetics.analysis.gbs.FastqToTagCountPlugin
 
enzyme() - Method in class net.maizegenetics.analysis.gbs.ProductionPipeline
Enzyme used to create the GBS library
enzyme(value) - Method in class net.maizegenetics.analysis.gbs.ProductionPipeline
Set Enzyme. Enzyme used to create the GBS library
enzyme() - Method in class net.maizegenetics.analysis.gbs.ProductionSNPCallerPlugin
Enzyme used to create the GBS library
enzyme(value) - Method in class net.maizegenetics.analysis.gbs.ProductionSNPCallerPlugin
Set Enzyme. Enzyme used to create the GBS library
enzyme() - Method in class net.maizegenetics.analysis.gbs.SeqToTBTHDF5Plugin
Enzyme used to create the GBS library, if it differs from the one listed in the key file.
enzyme(value) - Method in class net.maizegenetics.analysis.gbs.SeqToTBTHDF5Plugin
Set Enzyme. Enzyme used to create the GBS library, if it differs from the one listed in the key file.
enzyme() - Method in class net.maizegenetics.analysis.gbs.v2.EnzymeList.Enzyme
Deprecated. 
enzyme() - Method in class net.maizegenetics.analysis.gbs.v2.GBSEnzyme
Deprecated.
 
enzyme() - Method in class net.maizegenetics.analysis.gbs.v2.GBSSeqToTagDBPlugin
Enzyme used to create the GBS library, if it differs from the one listed in the key file
enzyme(value) - Method in class net.maizegenetics.analysis.gbs.v2.GBSSeqToTagDBPlugin
Set Enzyme. Enzyme used to create the GBS library, if it differs from the one listed in the key file
enzyme() - Method in class net.maizegenetics.analysis.gbs.v2.ProductionSNPCallerPluginV2
Enzyme used to create the GBS library
enzyme(value) - Method in class net.maizegenetics.analysis.gbs.v2.ProductionSNPCallerPluginV2
Set Enzyme. Enzyme used to create the GBS library
enzyme() - Method in class net.maizegenetics.util.ConvertOldFastqToModernFormatPlugin
Enzyme used to create the GBS library
enzyme(value) - Method in class net.maizegenetics.util.ConvertOldFastqToModernFormatPlugin
Set Enzyme. Enzyme used to create the GBS library
EnzymeList - Class in net.maizegenetics.analysis.gbs.v2
This class contains a list of all the enzymes supported for GBS.
EnzymeList() - Constructor for class net.maizegenetics.analysis.gbs.v2.EnzymeList
Looks for "enzymes.ini" config file in the lib path. Loads default Enzymes if not found
EnzymeList(iniFile) - Constructor for class net.maizegenetics.analysis.gbs.v2.EnzymeList
Custom Config file
EnzymeList.Enzyme - Class in net.maizegenetics.analysis.gbs.v2
Replaces the previous GBSEnzyme class
EqtlAssociationPlugin - Class in net.maizegenetics.analysis.association
 
EqtlAssociationPlugin(parentFrame, isInteractive) - Constructor for class net.maizegenetics.analysis.association.EqtlAssociationPlugin
 
equal(node1, node2) - Static method in class net.maizegenetics.taxa.tree.RootedTreeUtils
 
equals(p) - Method in class net.maizegenetics.analysis.data.MeanR2FromLDPlugin.AccumulateR2
 
equals(obj) - Method in class net.maizegenetics.analysis.gbs.neobio.PairwiseAlignment
Compares this object to the specified object. The result is true if and only if the argument is not null and is an PairwiseAlignment object that contains the same values as this object, i.e. the same gapped sequences, the same score tag line and the same score.
equals(obj) - Method in class net.maizegenetics.analysis.gbs.repgen.RefTagData
 
equals(obj) - Method in class net.maizegenetics.analysis.popgen.DonorHypoth
 
equals(obj) - Method in class net.maizegenetics.dna.map.Chromosome
 
equals(obj) - Method in class net.maizegenetics.dna.map.DonorHaplotypes
 
equals(obj) - Method in class net.maizegenetics.dna.map.GeneralPosition
 
equals(o) - Method in class net.maizegenetics.dna.snp.SimpleAllele
 
equals(o) - Method in class net.maizegenetics.dna.tag.AbstractTag
 
equals(obj) - Method in class net.maizegenetics.plugindef.Datum
 
equals(o) - Method in class net.maizegenetics.stats.linearmodels.BasicLevel
 
equals(c) - Method in class net.maizegenetics.taxa.Taxon
 
equals(o) - Method in class net.maizegenetics.util.db.DefaultDBTuple
 
equals(o) - Method in class net.maizegenetics.util.db.Pair
 
equals(o) - Method in class net.maizegenetics.util.OpenBitSet
returns true if both sets have the same bits set
equals(obj) - Method in class net.maizegenetics.util.Tuple
 
equals(o) - Method in class net.maizegenetics.util.UnmodifiableBitSet
 
erf(x) - Static method in class net.maizegenetics.stats.math.ErrorFunction
error function
erfc(x) - Static method in class net.maizegenetics.stats.math.ErrorFunction
complementary error function = 1-erf(x)
ERROR_DESC - Static variable in class net.maizegenetics.dna.snp.HapMapHDF5Constants
 
errorCode - Variable in exception net.maizegenetics.util.db.DataAccessException
 
errorFilter(rc, errorRate, queryIndex, hitIndexArray) - Method in class net.maizegenetics.analysis.gbs.UNetworkFilter
 
ErrorFunction - Class in net.maizegenetics.stats.math
error function and related stuff
errorSSdf - Variable in class net.maizegenetics.analysis.association.AbstractFixedEffectLM
 
errorTolerance() - Method in class net.maizegenetics.analysis.gbs.UTagCountToTagPairPlugin
What fraction of errors to tolerate when filtering by UNEAK
errorTolerance(value) - Method in class net.maizegenetics.analysis.gbs.UTagCountToTagPairPlugin
Set Error tolerance. What fraction of errors to tolerate when filtering by UNEAK
estimatePi(totalSites, avgPairwiseDivergence, averageSiteCoverage) - Static method in class net.maizegenetics.analysis.popgen.DiversityAnalyses
 
estimatePiPerbp(totalSites, avgPairwiseDivergence, averageSiteCoverage) - Static method in class net.maizegenetics.analysis.popgen.DiversityAnalyses
 
estimateSize() - Method in class net.maizegenetics.analysis.modelfitter.CovariatePermutationTestSpliterator
 
estimateSize() - Method in class net.maizegenetics.analysis.modelfitter.ForwardStepAdditiveSpliterator
 
estimateSize() - Method in class net.maizegenetics.analysis.modelfitter.NestedCovariatePermutationTestSpliterator
 
estimateTajimaD(segSites, totalSites, averageSiteCoverage, taxa, pipbp, thetapbp) - Static method in class net.maizegenetics.analysis.popgen.DiversityAnalyses
 
estimateTheta(segSites, totalSites, averageSiteCoverage, taxa) - Static method in class net.maizegenetics.analysis.popgen.DiversityAnalyses
 
estimateThetaPerbp(segSites, totalSites, averageSiteCoverage, taxa) - Static method in class net.maizegenetics.analysis.popgen.DiversityAnalyses
 
eta2 - Variable in class net.maizegenetics.stats.EMMA.EMMAforDoubleMatrix
 
ExceptionUtils - Class in net.maizegenetics.util
 
exchangeInfo(node1, node2) - Static method in class net.maizegenetics.taxa.tree.NodeUtils
Exchange field info between two nodes. Specifically identifiers, branch lengths, node heights and branch length SEs.
excludeLast(exclude) - Method in class net.maizegenetics.analysis.filter.FilterTraitsPlugin
 
exec(action) - Static method in class net.maizegenetics.util.db.SQL
 
exec(conn) - Method in interface net.maizegenetics.util.db.SQLAction
 
execDDL(connection, sql) - Static method in class net.maizegenetics.util.db.SQL
 
execDML(connection, sql, values) - Static method in class net.maizegenetics.util.db.SQL
 
executePostgreSQLQuery(st, query, echoQuery) - Static method in class net.maizegenetics.analysis.gobii.GOBIIDbUtils
 
exitLimit - Variable in class net.maizegenetics.analysis.modelfitter.StepwiseAdditiveModelFitter
 
exitLimit(limit) - Method in class net.maizegenetics.analysis.modelfitter.StepwiseAdditiveModelFitter
 
exitLimit() - Method in class net.maizegenetics.analysis.modelfitter.StepwiseAdditiveModelFitterPlugin
During the backward step of model fitting if p-value has been chosen as the selection criterion, if the term in model with the highest p-value has a p-value > exitLimit, it will be removed from the model.
exitLimit(value) - Method in class net.maizegenetics.analysis.modelfitter.StepwiseAdditiveModelFitterPlugin
Set exitLimit. During the backward step of model fitting if p-value has been chosen as the selection criterion, if the term in model with the highest p-value has a p-value > exitLimit, it will be removed from the model.
exitlimit() - Method in class net.maizegenetics.analysis.modelfitter.StepwiseOLSModelFitterPlugin
A term exits the model on a backward step if its p-value is greater than this value
exitlimit(value) - Method in class net.maizegenetics.analysis.modelfitter.StepwiseOLSModelFitterPlugin
Set Exit limit. A term exits the model on a backward step if its p-value is greater than this value
expandingWordNum(index) - Method in class net.maizegenetics.util.OpenBitSet
 
expandMaxVariants(newMaxVariants) - Method in class net.maizegenetics.dna.map.TagsOnPhysicalMap
 
EXPECTED_SUBSTITUTIONS - Variable in interface net.maizegenetics.taxa.tree.Units
 
expID() - Method in class net.maizegenetics.analysis.gobii.GWAS_IFLPlugin
Name of the GWAS experiment to which this data belongs. This name must already exist in the name field of the gwas_experiment table.
expID(value) - Method in class net.maizegenetics.analysis.gobii.GWAS_IFLPlugin
Set GWAS Experiment Name. Name of the GWAS experiment to which this data belongs. This name must already exist in the name field of the gwas_experiment table.
expName() - Method in class net.maizegenetics.analysis.gobii.MarkerDNARun_IFLFilePlugin
Name of experiment to which this data belongs. Must match an experiment name from the db experiment table.
expName(value) - Method in class net.maizegenetics.analysis.gobii.MarkerDNARun_IFLFilePlugin
Set Experiment Name. Name of experiment to which this data belongs. Must match an experiment name from the db experiment table.
exponent() - Method in class net.maizegenetics.analysis.numericaltransform.TransformDataDialog
 
ExponentialDistribution - Class in net.maizegenetics.stats.statistics
exponential distribution. (Parameter: lambda; mean: 1/lambda; variance: 1/lambda^2) The exponential distribution is a special case of the Gamma distribution (shape parameter = 1.0, scale = 1/lambda).
EXPORT_PLUGIN_EXPORT_DIPLOIDS - Static variable in class net.maizegenetics.prefs.TasselPrefs
 
EXPORT_PLUGIN_EXPORT_DIPLOIDS_DEFAULT - Static variable in class net.maizegenetics.prefs.TasselPrefs
 
EXPORT_PLUGIN_INCLUDE_TAXA_ANNOTATIONS - Static variable in class net.maizegenetics.prefs.TasselPrefs
 
EXPORT_PLUGIN_INCLUDE_TAXA_ANNOTATIONS_DEFAULT - Static variable in class net.maizegenetics.prefs.TasselPrefs
 
EXPORT_PLUGIN_TOP - Static variable in class net.maizegenetics.prefs.TasselPrefs
 
exportAnnotatedTaxaListTable(taxa, filename) - Static method in class net.maizegenetics.taxa.TaxaListIOUtils
 
ExportAvro - Class in net.maizegenetics.analysis.avro
 
exportCrossoverPositions(parentcallFilename, outputFilename) - Static method in class net.maizegenetics.analysis.imputation.ImputationUtils
 
exportCrossoverPositionsByParent(parentcallFilename, outputMomFilename, outputDadFilename) - Static method in class net.maizegenetics.analysis.imputation.ImputationUtils
 
exportFilterToJSON(filters, filename) - Static method in class net.maizegenetics.dna.snp.io.FilterJSONUtils
 
ExportMultiplePlugin - Class in net.maizegenetics.analysis.data
 
ExportMultiplePlugin(parentFrame) - Constructor for class net.maizegenetics.analysis.data.ExportMultiplePlugin
Creates a new instance of ExportMultiplePlugin
ExportPlugin - Class in net.maizegenetics.analysis.data
 
ExportPlugin(parentFrame, isInteractive) - Constructor for class net.maizegenetics.analysis.data.ExportPlugin
Creates a new instance of ExportPlugin
exportPositionListToJSON(positions, filename) - Static method in class net.maizegenetics.dna.snp.io.JSONUtils
 
exportTaxaListToJSON(taxa, filename) - Static method in class net.maizegenetics.dna.snp.io.JSONUtils
Exports given taxa list to JSON file.
exportToFlapjack(genotype, filename) - Static method in class net.maizegenetics.plugindef.GenerateRCode
 
ExportUtils - Class in net.maizegenetics.dna.snp
Exports Genotype Tables to various file formats.
extendClusters(a, clusters, sites, windowSize, forward) - Static method in class net.maizegenetics.analysis.imputation.NucleotideImputationUtils
 
ExtractHapmapSubsetPlugin - Class in net.maizegenetics.analysis.data
 
ExtractHapmapSubsetPlugin(parentFrame) - Constructor for class net.maizegenetics.analysis.data.ExtractHapmapSubsetPlugin
 
extractSubset() - Method in class net.maizegenetics.analysis.data.ExtractHapmapSubsetPlugin
 
extractSubsetFromHDF5() - Method in class net.maizegenetics.analysis.data.ExtractHapmapSubsetPlugin
 

F

Factor - Class in net.maizegenetics.analysis.gbs.neobio
This class is used by class FactorSequence to create a linked list of factors of a text as induced by its Lempel-Ziv (LZ78) factorisation.
Factor() - Constructor for class net.maizegenetics.analysis.gbs.neobio.Factor
Creates a new empty Factor. It has no ancestor and no character (both are set to null). Its serial number is set to zero as well as its length.
Factor(ancestor, serial_number, new_char) - Constructor for class net.maizegenetics.analysis.gbs.neobio.Factor
Creates a new Factor instance with the specified serial number and new character, and pointing to the given ancestor. Its length is set to its ancestor's length plus 1.
factor1 - Variable in class net.maizegenetics.analysis.gbs.neobio.AlignmentBlock
A pointer to the factor of the first sequence being aligned.
factor2 - Variable in class net.maizegenetics.analysis.gbs.neobio.AlignmentBlock
A pointer to the factor of the second sequence being aligned.
factorAttributeList - Variable in class net.maizegenetics.analysis.modelfitter.StepwiseAdditiveModelFitter
 
factorAttributeStream() - Method in class net.maizegenetics.phenotype.CorePhenotype
 
factorAttributeStream() - Method in class net.maizegenetics.phenotype.FilterPhenotype
 
factorAttributeStream() - Method in interface net.maizegenetics.phenotype.Phenotype
 
FactorModelEffect - Class in net.maizegenetics.stats.linearmodels
 
FactorModelEffect(levels, restricted) - Constructor for class net.maizegenetics.stats.linearmodels.FactorModelEffect
 
FactorModelEffect(levels, restricted, id) - Constructor for class net.maizegenetics.stats.linearmodels.FactorModelEffect
 
FactorSequence - Class in net.maizegenetics.analysis.gbs.neobio
This class builds a list of factors of a character sequence as induced by its Lempel-Ziv (LZ78) factorisation. Each factor is enconded as the longest factor previously seen plus one character.
FactorSequence(reader) - Constructor for class net.maizegenetics.analysis.gbs.neobio.FactorSequence
Creates a new instance of a FactorSequence, loading the sequence data from the Reader input stream. A doubly-linked list of factors is built according to its LZ78 factorisation.
factorsForStandardizing() - Method in class net.maizegenetics.analysis.numericaltransform.TransformDataDialog
 
fastAssociation(genoPheno, maxp, maxThreads, writeToFile, outputFile) - Static method in class net.maizegenetics.plugindef.GenerateRCode
 
fastClear(index) - Method in interface net.maizegenetics.util.BitSet
Clears a bit. The index should be less than the BitSet size.
fastClear(index) - Method in interface net.maizegenetics.util.BitSet
Clears a bit. The index should be less than the BitSet size.
fastClear(index) - Method in class net.maizegenetics.util.OpenBitSet
clears a bit. The index should be less than the OpenBitSet size.
fastClear(index) - Method in class net.maizegenetics.util.OpenBitSet
clears a bit. The index should be less than the OpenBitSet size.
fastClear(index) - Method in class net.maizegenetics.util.UnmodifiableBitSet
 
fastClear(index) - Method in class net.maizegenetics.util.UnmodifiableBitSet
 
fastFlip(index) - Method in interface net.maizegenetics.util.BitSet
Flips a bit. The index should be less than the BitSet size.
fastFlip(index) - Method in interface net.maizegenetics.util.BitSet
Flips a bit. The index should be less than the BitSet size.
fastFlip(index) - Method in class net.maizegenetics.util.OpenBitSet
flips a bit. The index should be less than the OpenBitSet size.
fastFlip(index) - Method in class net.maizegenetics.util.OpenBitSet
flips a bit. The index should be less than the OpenBitSet size.
fastFlip(index) - Method in class net.maizegenetics.util.UnmodifiableBitSet
 
fastFlip(index) - Method in class net.maizegenetics.util.UnmodifiableBitSet
 
fastGet(index) - Method in interface net.maizegenetics.util.BitSet
Returns true or false for the specified bit index. The index should be less than the BitSet size
fastGet(index) - Method in interface net.maizegenetics.util.BitSet
Returns true or false for the specified bit index. The index should be less than the BitSet size.
fastGet(index) - Method in class net.maizegenetics.util.OpenBitSet
Returns true or false for the specified bit index. The index should be less than the OpenBitSet size
fastGet(index) - Method in class net.maizegenetics.util.OpenBitSet
Returns true or false for the specified bit index. The index should be less than the OpenBitSet size.
fastGet(index) - Method in class net.maizegenetics.util.UnmodifiableBitSet
 
fastGet(index) - Method in class net.maizegenetics.util.UnmodifiableBitSet
 
FastMultithreadedAssociationPlugin - Class in net.maizegenetics.analysis.association
 
FastMultithreadedAssociationPlugin() - Constructor for class net.maizegenetics.analysis.association.FastMultithreadedAssociationPlugin
 
FastMultithreadedAssociationPlugin(parentFrame, isInteractive) - Constructor for class net.maizegenetics.analysis.association.FastMultithreadedAssociationPlugin
 
FastqChunk - Class in net.maizegenetics.dna.read
Hold Fastq single end Fastq file
FastqChunk(fastqFileS, format, startIndex, readNum) - Constructor for class net.maizegenetics.dna.read.FastqChunk
Constructor, sample Fastq file, ignore those bad sequence at the beginning
FastqChunk(fastqFileS, format) - Constructor for class net.maizegenetics.dna.read.FastqChunk
Constructor to read in whole Fastq, fastq file should be small for test
FastqChunk(reads) - Constructor for class net.maizegenetics.dna.read.FastqChunk
 
fastqFile() - Method in class net.maizegenetics.analysis.data.KmerCountingPlugin
 
fastqFile(value) - Method in class net.maizegenetics.analysis.data.KmerCountingPlugin
 
FastqReader - Class in net.maizegenetics.dna.tag
 
FastqReader(filename) - Constructor for class net.maizegenetics.dna.tag.FastqReader
 
FastqToPETagCountPlugin - Class in net.maizegenetics.analysis.gbs
Derives a PETagCount list for a pair of Fastq files. The forward and backward tags are ordered during processing Keeps only good reads having a barcode and a cut site and no N's in the useful part of the sequence. For the barcoded end, trims off the barcodes and truncates sequences that (1) have a second cut site, or (2) read into the common adapter. For the unbarcoded end, trims off the barcodes and truncates sequences that (1) have a second cut site, or (2) read into the barcode adapter.
FastqToPETagCountPlugin() - Constructor for class net.maizegenetics.analysis.gbs.FastqToPETagCountPlugin
 
FastqToPETagCountPlugin(parentFrame) - Constructor for class net.maizegenetics.analysis.gbs.FastqToPETagCountPlugin
 
FastqToTagCountPlugin - Class in net.maizegenetics.analysis.gbs
Derives a tagCount list for each fastq file in the input directory. Keeps only good reads having a barcode and a cut site and no N's in the useful part of the sequence. Trims off the barcodes and truncates sequences that (1) have a second cut site, or (2) read into the common adapter.
FastqToTagCountPlugin() - Constructor for class net.maizegenetics.analysis.gbs.FastqToTagCountPlugin
 
FastqToTagCountPlugin(parentFrame, isInteractive) - Constructor for class net.maizegenetics.analysis.gbs.FastqToTagCountPlugin
 
FastqToTBTPlugin - Class in net.maizegenetics.analysis.gbs
This pipeline converts a series of fastq files to TagsByTaxa files (one per fastq file). It requires a list of existing tags (Tags object), which may come from a TagCounts file or TOPM file.
FastqToTBTPlugin() - Constructor for class net.maizegenetics.analysis.gbs.FastqToTBTPlugin
 
FastqToTBTPlugin(parentFrame) - Constructor for class net.maizegenetics.analysis.gbs.FastqToTBTPlugin
 
fastSet(index) - Method in interface net.maizegenetics.util.BitSet
Sets the bit at the specified index. The index should be less than the BitSet size.
fastSet(index) - Method in interface net.maizegenetics.util.BitSet
Sets the bit at the specified index. The index should be less than the BitSet size.
fastSet(index) - Method in class net.maizegenetics.util.OpenBitSet
Sets the bit at the specified index. The index should be less than the OpenBitSet size.
fastSet(index) - Method in class net.maizegenetics.util.OpenBitSet
Sets the bit at the specified index. The index should be less than the OpenBitSet size.
fastSet(index) - Method in class net.maizegenetics.util.UnmodifiableBitSet
 
fastSet(index) - Method in class net.maizegenetics.util.UnmodifiableBitSet
 
fastTestSites(obsTdist, obsMajor, obsMinor, maf, binomFunc) - Method in class net.maizegenetics.analysis.gbs.TagAgainstAnchor
fast test, using ratio to reduce the calculation of binomial and p (reduce 73%), but the time is only saved by 3%
fastTestSites(obsTdist, obsMajor, obsMinor, maf, binomFunc) - Method in class net.maizegenetics.analysis.gbs.TagAgainstAnchorHypothesis
fast test, using ratio to reduce the calculation of binomial and p (reduce 73%), but the time is only saved by 3%
FatherKey - Static variable in class net.maizegenetics.taxa.Taxon
Standard key for the father of the taxon
featureListFilename() - Method in class net.maizegenetics.analysis.data.FeatureListToPositionsPlugin
File with list of features
featureListFilename(value) - Method in class net.maizegenetics.analysis.data.FeatureListToPositionsPlugin
Set Feature List Filename. File with list of features
FeatureListToPositionsPlugin - Class in net.maizegenetics.analysis.data
 
FeatureListToPositionsPlugin(parentFrame, isInteractive) - Constructor for class net.maizegenetics.analysis.data.FeatureListToPositionsPlugin
 
featureType() - Method in class net.maizegenetics.analysis.data.FeatureListToPositionsPlugin
Feature Type
featureType(value) - Method in class net.maizegenetics.analysis.data.FeatureListToPositionsPlugin
Set Feature Type. Feature Type
Fgen - Variable in class net.maizegenetics.analysis.imputation.PopulationData
 
FILE_EXT_FASTA - Static variable in class net.maizegenetics.analysis.data.FileLoadPlugin
 
FILE_EXT_HAPMAP - Static variable in class net.maizegenetics.analysis.data.FileLoadPlugin
 
FILE_EXT_HAPMAP_GZ - Static variable in class net.maizegenetics.analysis.data.FileLoadPlugin
 
FILE_EXT_HAPMAP_GZ_LIX - Static variable in class net.maizegenetics.analysis.data.FileLoadPlugin
 
FILE_EXT_HDF5 - Static variable in class net.maizegenetics.analysis.data.FileLoadPlugin
 
FILE_EXT_NEWICK - Static variable in class net.maizegenetics.analysis.data.FileLoadPlugin
 
FILE_EXT_PHYLIP - Static variable in class net.maizegenetics.analysis.data.FileLoadPlugin
 
FILE_EXT_PLINK_MAP - Static variable in class net.maizegenetics.analysis.data.FileLoadPlugin
 
FILE_EXT_PLINK_PED - Static variable in class net.maizegenetics.analysis.data.FileLoadPlugin
 
FILE_EXT_SERIAL_GZ - Static variable in class net.maizegenetics.analysis.data.FileLoadPlugin
 
FILE_EXT_TOPM - Static variable in class net.maizegenetics.analysis.data.FileLoadPlugin
 
FILE_EXT_TOPM_BIN - Static variable in class net.maizegenetics.analysis.data.FileLoadPlugin
 
FILE_EXT_TOPM_H5 - Static variable in class net.maizegenetics.analysis.data.FileLoadPlugin
 
FILE_EXT_TOPM_TEXT - Static variable in class net.maizegenetics.analysis.data.FileLoadPlugin
 
FILE_EXT_VCF - Static variable in class net.maizegenetics.analysis.data.FileLoadPlugin
 
FileBrowserUtils - Class in net.maizegenetics.gui
 
FileLoadPlugin - Class in net.maizegenetics.analysis.data
 
FileLoadPlugin(parentFrame, isInteractive, headless) - Constructor for class net.maizegenetics.analysis.data.FileLoadPlugin
Creates a new instance of FileLoadPlugin. This only used by TASSEL GUI to bypass dialog and go straight to file browser. Bypassing the dialog causes it to bypass adding to Data Tree. This constructor tells FileLoadPlugin to add it to the Data Tree Manually.
FileLoadPlugin(parentFrame, isInteractive) - Constructor for class net.maizegenetics.analysis.data.FileLoadPlugin
Creates a new instance of FileLoadPlugin.
FileLoadPlugin.TasselFileType - Enum in net.maizegenetics.analysis.data
 
filename() - Method in class net.maizegenetics.analysis.tree.ConvertTreeNamesPlugin
Conversion filename. Each line of the file should have two names separated with a tab. The first name should be converted to the second.
filename(value) - Method in class net.maizegenetics.analysis.tree.ConvertTreeNamesPlugin
Set Name List. Conversion filename. Each line of the file should have two names separated with a tab. The first name should be converted to the second.
fileNameField - Static variable in class net.maizegenetics.analysis.gbs.v2.GBSUtils
 
fileNameField - Static variable in class net.maizegenetics.util.ConvertOldFastqToModernFormatPlugin
 
fileType() - Method in class net.maizegenetics.analysis.data.ExportPlugin
Export file format
fileType(value) - Method in class net.maizegenetics.analysis.data.ExportPlugin
Set Format. Export file format
fileType() - Method in class net.maizegenetics.analysis.data.FileLoadPlugin
Export file format (Default format depends on data being exported)
fileType(value) - Method in class net.maizegenetics.analysis.data.FileLoadPlugin
Set Format. Export file format (Default format depends on data being exported)
fileType() - Method in class net.maizegenetics.analysis.data.SortGenotypeFilePlugin
Input/output file type (if not obvious from file name)
fileType(value) - Method in class net.maizegenetics.analysis.data.SortGenotypeFilePlugin
Set File type. Input/output file type (if not obvious from file name)
fileType() - Method in class net.maizegenetics.analysis.gbs.BinaryToTextPlugin
File Type
fileType(value) - Method in class net.maizegenetics.analysis.gbs.BinaryToTextPlugin
Set File Type. File Type
fillgaps() - Method in class net.maizegenetics.analysis.imputation.FSFHapImputationPlugin
replace missing values with flanking values if equal
fillgaps(value) - Method in class net.maizegenetics.analysis.imputation.FSFHapImputationPlugin
Set Fillgaps. replace missing values with flanking values if equal
fillgaps(states) - Method in class net.maizegenetics.analysis.imputation.ImputeCrossProgeny
 
fillGapsInAlignment(popdata) - Static method in class net.maizegenetics.analysis.imputation.NucleotideImputationUtils
 
fillGapsInImputedAlignment(popdata) - Static method in class net.maizegenetics.analysis.imputation.NucleotideImputationUtils
 
fillInc(first, last) - Static method in class net.maizegenetics.analysis.imputation.FILLINImputationUtils
 
FILLINDonorGenotypeUtils - Class in net.maizegenetics.analysis.imputation
Methods for loading the donor haplotype files and for arranging the bit states (Major versus Minor) if they differ between the donor genotypes and the target genotypes
FILLINFindHaplotypesPlugin - Class in net.maizegenetics.analysis.imputation
Creates haplotypes by finding large IBS regions within GBS data. Starts with the highest coverage taxa and looks within windows of near perfect matches. Combines all matches together into one haplotype. The haplotype is named for the highest coverage sample.
FILLINFindHaplotypesPlugin() - Constructor for class net.maizegenetics.analysis.imputation.FILLINFindHaplotypesPlugin
 
FILLINFindHaplotypesPlugin(parentFrame, isInteractive) - Constructor for class net.maizegenetics.analysis.imputation.FILLINFindHaplotypesPlugin
 
FILLINImputationAccuracy - Class in net.maizegenetics.analysis.imputation
A class to mask input files, hold information related to accuracy calculation, and calculate accuracy for FILLINImputationPlugin
FILLINImputationAccuracy(unimp, maskKey, donors, propSitesMask, depthToMask, propDepthSitesToMask, outFileName, MAFClass, verbose) - Constructor for class net.maizegenetics.analysis.imputation.FILLINImputationAccuracy
 
FILLINImputationAccuracy(unimp, maskKey, outFileName, verbose) - Constructor for class net.maizegenetics.analysis.imputation.FILLINImputationAccuracy
 
FILLINImputationAccuracy(unimp, maskKey, donor, outFileName, verbose) - Constructor for class net.maizegenetics.analysis.imputation.FILLINImputationAccuracy
 
FILLINImputationAccuracy(unimp, maskKey, donor, MAFClass, outFileName, verbose) - Constructor for class net.maizegenetics.analysis.imputation.FILLINImputationAccuracy
 
FILLINImputationPlugin - Class in net.maizegenetics.analysis.imputation
FILLIN imputation relies on a libary of haplotypes and uses nearest neighbor searches followed by HMM Viterbi resolution or block-based resolution. It is the best approach for substantially unrelated taxa in TASSEL. BEAGLE4 is a better approach currently for landraces, while FILLIN outperforms if there is a good reference set of haplotypes.
FILLINImputationPlugin() - Constructor for class net.maizegenetics.analysis.imputation.FILLINImputationPlugin
 
FILLINImputationPlugin(parentFrame, isInteractive) - Constructor for class net.maizegenetics.analysis.imputation.FILLINImputationPlugin
 
FILLINImputationUtils - Class in net.maizegenetics.analysis.imputation
Basic utility functions to support imputation by blocks.
fillMergeOutfile(infiles, outfile) - Static method in class net.maizegenetics.analysis.gbs.MergeTagsByTaxaFilesPlugin
Inserts tag count values into the RandomAccessFile created by @link{createMergeOutfile}.
filter(orig, filter) - Static method in class net.maizegenetics.analysis.filter.FilterBySites
 
filter(orig, filter) - Static method in class net.maizegenetics.analysis.filter.FilterByTaxa
 
filter(filenames) - Method in class net.maizegenetics.dna.map.TagsOnPhysicalMap
Clears variant sites that are not found in the supplied alignments.
Filter - Interface in net.maizegenetics.dna.snp
 
FILTER_ALIGN_PLUGIN_MAX_FREQ - Static variable in class net.maizegenetics.prefs.TasselPrefs
 
FILTER_ALIGN_PLUGIN_MAX_FREQ_DEFAULT - Static variable in class net.maizegenetics.prefs.TasselPrefs
 
FILTER_ALIGN_PLUGIN_MIN_COUNT - Static variable in class net.maizegenetics.prefs.TasselPrefs
 
FILTER_ALIGN_PLUGIN_MIN_COUNT_DEFAULT - Static variable in class net.maizegenetics.prefs.TasselPrefs
 
FILTER_ALIGN_PLUGIN_MIN_FREQ - Static variable in class net.maizegenetics.prefs.TasselPrefs
 
FILTER_ALIGN_PLUGIN_MIN_FREQ_DEFAULT - Static variable in class net.maizegenetics.prefs.TasselPrefs
 
FILTER_ALIGN_PLUGIN_TOP - Static variable in class net.maizegenetics.prefs.TasselPrefs
 
FILTER_TAXA_PROPS_PLUGIN_MAX_HET - Static variable in class net.maizegenetics.prefs.TasselPrefs
 
FILTER_TAXA_PROPS_PLUGIN_MAX_HET_DEFAULT - Static variable in class net.maizegenetics.prefs.TasselPrefs
 
FILTER_TAXA_PROPS_PLUGIN_MIN_HET - Static variable in class net.maizegenetics.prefs.TasselPrefs
 
FILTER_TAXA_PROPS_PLUGIN_MIN_HET_DEFAULT - Static variable in class net.maizegenetics.prefs.TasselPrefs
 
FILTER_TAXA_PROPS_PLUGIN_MIN_NOT_MISSING - Static variable in class net.maizegenetics.prefs.TasselPrefs
 
FILTER_TAXA_PROPS_PLUGIN_MIN_NOT_MISSING_DEFAULT - Static variable in class net.maizegenetics.prefs.TasselPrefs
 
FILTER_TAXA_PROPS_PLUGIN_TOP - Static variable in class net.maizegenetics.prefs.TasselPrefs
 
FilterAlignmentPlugin - Class in net.maizegenetics.analysis.filter
 
FilterAlignmentPlugin(parentFrame, isInteractive) - Constructor for class net.maizegenetics.analysis.filter.FilterAlignmentPlugin
Deprecated. 
FilterAlleleDepth - Class in net.maizegenetics.dna.snp.score
 
FilterAlleleProbability - Class in net.maizegenetics.dna.snp.score
 
FilterAndMaskGVCFGenomeSequence - Class in net.maizegenetics.dna.snp
Created by zrm22 on 4/3/17.
FilterBySites - Class in net.maizegenetics.analysis.filter
 
FilterByTaxa - Class in net.maizegenetics.analysis.filter
 
filterByTOPM(inputFileName, topm) - Static method in class net.maizegenetics.dna.tag.TagsByTaxaUtils
Outputs taxon bitDistribution of all tags in the supplied TOPM file.
FilterDataSetPlugin - Class in net.maizegenetics.analysis.filter
 
FilterDataSetPlugin(names, types) - Constructor for class net.maizegenetics.analysis.filter.FilterDataSetPlugin
Creates a new instance of FilterDataSetPlugin
FilterDosage - Class in net.maizegenetics.dna.snp.score
 
filterFiles(dir, match) - Static method in class net.maizegenetics.analysis.imputation.ImputationUtils
 
filterForListOfReads(readsToKeepFile, outFile, binary) - Method in class net.maizegenetics.dna.tag.ReadsByTaxa
 
FilterGenotypeTable - Class in net.maizegenetics.dna.snp
Taxa and site filtering of GenotypeTables. The class essentially creates views of the baseGenotypeTable through arrays for indirection.
FilterHDF5AlleleDepth - Class in net.maizegenetics.dna.snp.score
 
FilterJSONUtils - Class in net.maizegenetics.dna.snp.io
 
FilterList - Class in net.maizegenetics.dna.snp
 
FilterList(filters) - Constructor for class net.maizegenetics.dna.snp.FilterList
 
FilterList(filter) - Constructor for class net.maizegenetics.dna.snp.FilterList
 
filterName() - Method in class net.maizegenetics.analysis.filter.FilterSiteBuilderPlugin
Filter Name
filterName(value) - Method in class net.maizegenetics.analysis.filter.FilterSiteBuilderPlugin
Set Filter Name. Filter Name
filterName() - Method in class net.maizegenetics.analysis.filter.FilterTaxaBuilderPlugin
Filter Name
filterName(value) - Method in class net.maizegenetics.analysis.filter.FilterTaxaBuilderPlugin
Set Filter Name. Filter Name
filterName() - Method in class net.maizegenetics.dna.snp.FilterSite
 
filterName() - Method in class net.maizegenetics.dna.snp.FilterTaxa
 
FilterPhenotype - Class in net.maizegenetics.phenotype
 
FilterReferenceProbability - Class in net.maizegenetics.dna.snp.score
 
FilterSite - Class in net.maizegenetics.dna.snp
 
FilterSite(values) - Constructor for class net.maizegenetics.dna.snp.FilterSite
 
FilterSite.FILTER_SITES_ATTRIBUTES - Enum in net.maizegenetics.dna.snp
 
FilterSite.SITE_RANGE_FILTER_TYPES - Enum in net.maizegenetics.dna.snp
 
FilterSiteBuilderPlugin - Class in net.maizegenetics.analysis.filter
 
FilterSiteBuilderPlugin(parentFrame, isInteractive) - Constructor for class net.maizegenetics.analysis.filter.FilterSiteBuilderPlugin
 
FilterSiteBuilderPlugin() - Constructor for class net.maizegenetics.analysis.filter.FilterSiteBuilderPlugin
 
FilterSiteNamePlugin - Class in net.maizegenetics.analysis.filter
Deprecated. 
FilterSiteNamePlugin(parentFrame, isInteractive) - Constructor for class net.maizegenetics.analysis.filter.FilterSiteNamePlugin
Deprecated.
Creates a new instance of FilterSiteNamePlugin
filterSitesByBedFile(input, bedFile, includeSites) - Static method in class net.maizegenetics.dna.snp.GenotypeTableUtils
This returns the subset of genotypes specified by the given BED file. Start positions are inclusive and end positions are exclusive. If includeSites is false, this returns everything except the subset specified by the BED file.
filterSitesByChrPos(input, positionList, includeSites) - Static method in class net.maizegenetics.dna.snp.GenotypeTableUtils
 
filterSitesByChrPos(input, filename, includeSites) - Static method in class net.maizegenetics.dna.snp.GenotypeTableUtils
 
filterSitesByGRanges(input, seqName, start, end) - Static method in class net.maizegenetics.plugindef.GenerateRCode
Filters given genotypes to only the ranges specified.
filterSnpsByTag(a, minMaf, maxMissing, maxHet) - Static method in class net.maizegenetics.analysis.imputation.NucleotideImputationUtils
 
FilterSubsetPlugin - Class in net.maizegenetics.analysis.filter
 
FilterSubsetPlugin(parentFrame, isInteractive) - Constructor for class net.maizegenetics.analysis.filter.FilterSubsetPlugin
Creates a new instance of FilterSiteNamePlugin
FilterTableReport - Class in net.maizegenetics.dna.snp
 
FilterTableReport(filters) - Constructor for class net.maizegenetics.dna.snp.FilterTableReport
 
filterTagMapPlugin() - Method in class net.maizegenetics.analysis.gbs.pana.PanAUsageExample
 
FilterTaxa - Class in net.maizegenetics.dna.snp
 
FilterTaxa(values) - Constructor for class net.maizegenetics.dna.snp.FilterTaxa
 
FilterTaxa.FILTER_TAXA_ATTRIBUTES - Enum in net.maizegenetics.dna.snp
 
FilterTaxaBuilderPlugin - Class in net.maizegenetics.analysis.filter
 
FilterTaxaBuilderPlugin(parentFrame, isInteractive) - Constructor for class net.maizegenetics.analysis.filter.FilterTaxaBuilderPlugin
 
FilterTaxaBuilderPlugin() - Constructor for class net.maizegenetics.analysis.filter.FilterTaxaBuilderPlugin
 
FilterTaxaPropertiesPlugin - Class in net.maizegenetics.analysis.filter
 
FilterTaxaPropertiesPlugin(parentFrame, isInteractive) - Constructor for class net.maizegenetics.analysis.filter.FilterTaxaPropertiesPlugin
Creates a new instance of FilterTaxaPropertiesPlugin
FilterTraitsDialog - Class in net.maizegenetics.analysis.filter
 
FilterTraitsDialog(parent, aPhenotype) - Constructor for class net.maizegenetics.analysis.filter.FilterTraitsDialog
 
FilterTraitsPlugin - Class in net.maizegenetics.analysis.filter
 
FilterTraitsPlugin(parentFrame, isInteractive) - Constructor for class net.maizegenetics.analysis.filter.FilterTraitsPlugin
 
finalize() - Method in class net.maizegenetics.analysis.modelfitter.AdditiveModelForwardRegression
 
findBestMatch(taxaName, referenceTaxa) - Method in class net.maizegenetics.taxa.IdentifierSynonymizer
 
findByIdentifier(node, identifierNames) - Static method in class net.maizegenetics.taxa.tree.NodeUtils
Returns the first nodes in this tree that has the required identifiers.
findByIdentifier(node, identifiers) - Static method in class net.maizegenetics.taxa.tree.NodeUtils
Returns the first nodes in this tree that has the required identifiers.
findByIdentifier(node, identifier) - Static method in class net.maizegenetics.taxa.tree.NodeUtils
Returns the first node in this tree that has the required identifier.
findByIdentifier(node, identifierName) - Static method in class net.maizegenetics.taxa.tree.NodeUtils
Returns the first node in this tree that has the required identifier.
findCI(me, theModel) - Method in class net.maizegenetics.analysis.modelfitter.StepwiseAdditiveModelFitter
 
findDelta - Variable in class net.maizegenetics.stats.EMMA.EMMAforDoubleMatrix
 
findHeterozygousDonorHypoth(targetTaxon, mjT, mnT, firstBlock, lastBlock, focusBlock, donorAlign, d1, donor2Indices, maxDonorHypotheses, minTestSites) - Static method in class net.maizegenetics.analysis.imputation.FILLINImputationUtils
Simple algorithm that does a one dimensional test of donors. A single donor with a list of others donor combinations to minimize the number of unmatched informative alleles.
findHeterozygousDonorHypoth(targetTaxon, mjT, mnT, firstBlock, lastBlock, focusBlock, donorAlign, donor1Indices, donor2Indices, maxDonorHypotheses, minTestSites) - Static method in class net.maizegenetics.analysis.imputation.FILLINImputationUtils
Simple algorithm that does a two dimensional test of donors. A list donor versus with a list of others donor combinations to minimize the number of unmatched informative alleles.
findHomozygousDonorHypoth(targetTaxon, firstBlock, lastBlock, focusBlock, donor1indices, targetToDonorDistances, minTestSites, maxDonorHypotheses) - Static method in class net.maizegenetics.analysis.imputation.FILLINImputationUtils
Simple algorithm that tests every possible haplotype as a homozygous donor to minimize the number of unmatched informative alleles. Currently, there is little tie breaking, longer matches are favored by add 0.5 errors to the error rate calculation within DonorHypoth. Distance calculation are made between first and last block. This code is relatively fast compared to calculating distance as it works with the precomputed distances.
FindInversionsPlugin - Class in net.maizegenetics.analysis.data
 
FindInversionsPlugin(parentFrame, isInteractive) - Constructor for class net.maizegenetics.analysis.data.FindInversionsPlugin
 
FindInversionsPlugin.WINDOW_UNIT - Enum in net.maizegenetics.analysis.data
 
findLargestChild(node) - Static method in class net.maizegenetics.taxa.tree.NodeUtils
Finds the largest child (in terms of node height).
FindMatchByWordHash - Class in net.maizegenetics.analysis.rna
Find Match by Words using a simple hashmap of fixed length word (kmers) to determine most similar sequence.
FindMatchByWordHash.Builder - Class in net.maizegenetics.analysis.rna
 
FindMatchByWordHash.Match - Class in net.maizegenetics.analysis.rna
 
FindMatchByWordHash.MatchType - Enum in net.maizegenetics.analysis.rna
 
findMatchesWithIntLengthWords(query, maxDiv, keepOnlyBest) - Method in class net.maizegenetics.analysis.gbs.TagMatchFinder
Return a TreeMap good hits based on a sequence query. The returned tree map is the list of tag indices as key, divergence as value. Ed- It seems like the key & value should perhaps be reversed.
FindMergeHaplotypesPlugin - Class in net.maizegenetics.analysis.imputation
Creates haplotypes by finding large IBS regions within GBS data. Starts with the highest coverage taxa and looks within windows of near perfect matches. Combines all matches together into one haplotype. The haplotype is named for the highest coverage sample. TODO: 1. plus add short inbred segments not present full ones 2. Cluster and choose haplotypes by cluster and number of new minor alleles (or information) 3. Set max het frequency as a setting
FindMergeHaplotypesPlugin() - Constructor for class net.maizegenetics.analysis.imputation.FindMergeHaplotypesPlugin
 
FindMergeHaplotypesPlugin(parentFrame) - Constructor for class net.maizegenetics.analysis.imputation.FindMergeHaplotypesPlugin
 
findMidpointNode(tree) - Static method in class net.maizegenetics.taxa.tree.TreeUtils
Return node with the highest average minimum and maximum distance. Ed thinks this is roughly the midpoint - need to look this up
findNode(num) - Method in class net.maizegenetics.taxa.tree.SimpleTree
return node with number num (as displayed in ASCII tree)
findNthOccurrenceInString(str, match, n) - Static method in class net.maizegenetics.util.Utils
Finds index of Nth occurrence of character in string.
findOneMismatch(queryLongSeq) - Method in class net.maizegenetics.analysis.gbs.PolymorphismFinder
 
findOneMismatch(queryLongSeq) - Method in class net.maizegenetics.analysis.gbs.UTagPairFinder
 
findOrderedMatches(unmatchedString, levelOfRestriction) - Method in class net.maizegenetics.taxa.IdentifierSynonymizer
 
finisher() - Method in class net.maizegenetics.dna.map.PositionList.PositionListCollector
 
finisher() - Method in class net.maizegenetics.taxa.TaxaList.TaxaListCollector
 
finisher() - Method in class net.maizegenetics.util.BitSet.BitSetListCollector
 
fireDataSetReturned(event) - Method in class net.maizegenetics.plugindef.AbstractPlugin
Returns data set after complete.
fireDataSetReturned(data) - Method in class net.maizegenetics.plugindef.AbstractPlugin
Returns data set after complete.
fireProgress(percent, listener) - Static method in class net.maizegenetics.analysis.distance.DominanceNormalizedIBSMatrix
 
fireProgress(percent, listener) - Static method in class net.maizegenetics.analysis.distance.EndelmanDistanceMatrix
 
fireProgress(percent, listener) - Static method in class net.maizegenetics.analysis.distance.GCTADistanceMatrix
 
fireProgress(percent, listener) - Static method in class net.maizegenetics.analysis.distance.IBSDistanceMatrix2Alleles
 
fireProgress(percent, listener) - Static method in class net.maizegenetics.analysis.distance.IBSDistanceMatrix3Alleles
 
fireProgress(percent, listener) - Static method in class net.maizegenetics.analysis.distance.IBSDistanceMatrixOneByAll
 
fireProgress(percent) - Method in class net.maizegenetics.analysis.popgen.LinkageDisequilibrium
 
fireProgress(event) - Method in class net.maizegenetics.plugindef.AbstractPlugin
Returns progress of execution.
fireProgress(percent) - Method in class net.maizegenetics.plugindef.AbstractPlugin
Returns progress of execution.
fireTableChanged() - Method in class net.maizegenetics.gui.AlignmentTableModel
 
fireTableChanged() - Method in class net.maizegenetics.gui.TableReportNoPagingTableModel
 
firstLastSiteOfChromosome(chromosome) - Method in class net.maizegenetics.dna.snp.CombineGenotypeTable
 
firstLastSiteOfChromosome(chromosome) - Method in class net.maizegenetics.dna.snp.CoreGenotypeTable
 
firstLastSiteOfChromosome(chromosome) - Method in interface net.maizegenetics.dna.snp.GenotypeTable
Get the first (inclusive) and last (inclusive) site of the specified chromosome in this genotype table.
firstLastSiteOfChromosome(chromosome) - Method in class net.maizegenetics.dna.snp.MergedGenotypeTable
 
firstLastSiteOfChromosome(chromosome) - Method in class net.maizegenetics.dna.snp.TOPMGenotypeTable
 
FisherExact - Class in net.maizegenetics.stats.statistics
This does a Fisher Exact test. The Fisher's Exact test procedure calculates an exact probability value for the relationship between two dichotomous variables, as found in a two by two crosstable. The program calculates the difference between the data observed and the data expected, considering the given marginal and the assumptions of the model of independence. It works in exactly the same way as the Chi-square test for independence; however, the Chi-square gives only an estimate of the true probability value, an estimate which might not be very accurate if the marginal is very uneven or if there is a small value (less than five) in one of the cells. It uses an array of factorials initialized at the beginning to provide speed. There could be better ways to do this.
fitAddDom() - Method in class net.maizegenetics.analysis.modelfitter.StepwiseAdditiveModelFitterPlugin
Should the plugin fit an additive plus dominance model? If false, an additive only model will be fit. Note this option does not implement a nested model. The isNested parameter will be ignored.
fitAddDom(value) - Method in class net.maizegenetics.analysis.modelfitter.StepwiseAdditiveModelFitterPlugin
Set Fit AddDom Model. Should the plugin fit an additive plus dominance model? If false, an additive only model will be fit. Note this option does not implement a nested model. The isNested parameter will be ignored.
fitModel() - Method in class net.maizegenetics.analysis.modelfitter.AdditiveModelForwardRegression
 
fitModel() - Method in class net.maizegenetics.analysis.modelfitter.AdditiveResidualForwardRegression
 
fitModel() - Method in interface net.maizegenetics.analysis.modelfitter.ForwardRegression
 
fitModel() - Method in class net.maizegenetics.analysis.modelfitter.StepwiseAdditiveModelFitter
 
fitModel() - Method in class net.maizegenetics.analysis.modelfitter.StepwiseOLSModelFitter
 
fitModelForSubsample(subSample, iteration) - Method in class net.maizegenetics.analysis.modelfitter.AdditiveModelForwardRegression
 
fitModelForSubsample(subSample, iteration) - Method in class net.maizegenetics.analysis.modelfitter.AdditiveResidualForwardRegression
 
fitModelForSubsample(subSample, iteration) - Method in interface net.maizegenetics.analysis.modelfitter.ForwardRegression
 
fittedModel() - Method in class net.maizegenetics.analysis.modelfitter.AbstractForwardRegression
 
fittedModel() - Method in interface net.maizegenetics.analysis.modelfitter.ForwardRegression
 
FixedEffectLM - Interface in net.maizegenetics.analysis.association
 
FixedEffectLMPlugin - Class in net.maizegenetics.analysis.association
 
FixedEffectLMPlugin(parentFrame, isInteractive) - Constructor for class net.maizegenetics.analysis.association.FixedEffectLMPlugin
 
FlapjackUtils - Class in net.maizegenetics.dna.snp.io
 
flip(index) - Method in interface net.maizegenetics.util.BitSet
Flips a bit, expanding the set size if necessary
flip(startIndex, endIndex) - Method in interface net.maizegenetics.util.BitSet
Flips a range of bits, expanding the set size if necessary
flip(index) - Method in class net.maizegenetics.util.OpenBitSet
flips a bit, expanding the set size if necessary
flip(startIndex, endIndex) - Method in class net.maizegenetics.util.OpenBitSet
Flips a range of bits, expanding the set size if necessary
flip(index) - Method in class net.maizegenetics.util.UnmodifiableBitSet
 
flip(startIndex, endIndex) - Method in class net.maizegenetics.util.UnmodifiableBitSet
 
flipAndGet(index) - Method in interface net.maizegenetics.util.BitSet
Flips a bit and returns the resulting bit value. The index should be less than the BitSet size.
flipAndGet(index) - Method in interface net.maizegenetics.util.BitSet
Flips a bit and returns the resulting bit value. The index should be less than the BitSet size.
flipAndGet(index) - Method in class net.maizegenetics.util.OpenBitSet
flips a bit and returns the resulting bit value. The index should be less than the OpenBitSet size.
flipAndGet(index) - Method in class net.maizegenetics.util.OpenBitSet
flips a bit and returns the resulting bit value. The index should be less than the OpenBitSet size.
flipAndGet(index) - Method in class net.maizegenetics.util.UnmodifiableBitSet
 
flipAndGet(index) - Method in class net.maizegenetics.util.UnmodifiableBitSet
 
flipFilterBit(index) - Method in interface net.maizegenetics.dna.map.GVCFGenomeSequence
 
flipMaskBit(index) - Method in interface net.maizegenetics.dna.map.GVCFGenomeSequence
 
floatDeflation - Static variable in class net.maizegenetics.dna.snp.HapMapHDF5Constants
 
floatDeflation - Static variable in class net.maizegenetics.util.Tassel5HDF5Constants
 
floatToBytePercentage(value) - Static method in class net.maizegenetics.dna.snp.score.SiteScoreUtil
Converts float value to byte version.
floatToBytePercentage(values) - Static method in class net.maizegenetics.dna.snp.score.SiteScoreUtil
 
floatToBytePercentage(values) - Static method in class net.maizegenetics.dna.snp.score.SiteScoreUtil
 
floatValue(obs) - Method in class net.maizegenetics.phenotype.NumericAttribute
 
floatValues() - Method in class net.maizegenetics.phenotype.NumericAttribute
 
flowcellField - Static variable in class net.maizegenetics.analysis.gbs.v2.GBSUtils
 
flowcellField - Static variable in class net.maizegenetics.util.ConvertOldFastqToModernFormatPlugin
 
focusBlock - Variable in class net.maizegenetics.analysis.popgen.DonorHypoth
 
FolderParser - Class in net.maizegenetics.dna.pd
User: dkroon
FolderParser(directoryIn) - Constructor for class net.maizegenetics.dna.pd.FolderParser
 
FolderParser(directoryIn, traitPositionIn, chrPositionIn, filenameTokenIn) - Constructor for class net.maizegenetics.dna.pd.FolderParser
 
format(number, toAppendTo, pos) - Method in class net.maizegenetics.analysis.chart.ManhattanNumberFormat
 
format(number, toAppendTo, pos) - Method in class net.maizegenetics.analysis.chart.ManhattanNumberFormat
 
format(filename) - Static method in class net.maizegenetics.dna.tag.TagsByTaxaUtils
 
format(value) - Static method in class net.maizegenetics.util.DoubleFormat
 
format(value) - Static method in class net.maizegenetics.util.DoubleFormat
 
formatResults() - Method in class net.maizegenetics.analysis.association.CompressedMLMusingDoubleMatrix
 
FormattedInput - Class in net.maizegenetics.util
tools to simplify formatted input from an input stream
FormattedOutput - Class in net.maizegenetics.util
tools to simplify formatted output to a stream
forPHG() - Method in class net.maizegenetics.analysis.ListPluginParameters.Companion
 
forPHG() - Static method in class net.maizegenetics.analysis.ListPluginParameters
 
forTASSEL() - Method in class net.maizegenetics.analysis.ListPluginParameters.Companion
 
forTASSEL() - Static method in class net.maizegenetics.analysis.ListPluginParameters
 
forwardp() - Method in class net.maizegenetics.analysis.gbs.repgen.RampSeqAlignFromBlastTags
String containing the forward primer sequence.
forwardp(value) - Method in class net.maizegenetics.analysis.gbs.repgen.RampSeqAlignFromBlastTags
Set Forward Primer. String containing the forward primer sequence.
ForwardRegression - Interface in net.maizegenetics.analysis.modelfitter
 
forwardStep(prevCriterionValue) - Method in class net.maizegenetics.analysis.modelfitter.StepwiseAddDomModelFitter
 
forwardStep(prevCriterionValue) - Method in class net.maizegenetics.analysis.modelfitter.StepwiseAdditiveModelFitter
 
forwardStep() - Method in class net.maizegenetics.analysis.modelfitter.StepwiseOLSModelFitter
 
ForwardStepAddDomSpliterator - Class in net.maizegenetics.analysis.modelfitter
 
ForwardStepAddDomSpliterator(siteList, baseModel, y) - Constructor for class net.maizegenetics.analysis.modelfitter.ForwardStepAddDomSpliterator
 
ForwardStepAdditiveSpliterator - Class in net.maizegenetics.analysis.modelfitter
This Spliterator is used to fit a baseModel plus an additive effect covariate to a data set y. It takes an AdditiveSite as input, calculates the test statistic specified by selectionCriterion, and sets its value in the AdditiveSite.
ForwardStepAdditiveSpliterator(siteList, baseModel, y) - Constructor for class net.maizegenetics.analysis.modelfitter.ForwardStepAdditiveSpliterator
 
ForwardStepAdditiveSpliterator(siteList, baseModel, y, numberOfSites) - Constructor for class net.maizegenetics.analysis.modelfitter.ForwardStepAdditiveSpliterator
 
ForwardStepNestedAdditiveSpliterator - Class in net.maizegenetics.analysis.modelfitter
 
ForwardStepNestedAdditiveSpliterator(siteList, baseModel, y, nestingFactor) - Constructor for class net.maizegenetics.analysis.modelfitter.ForwardStepNestedAdditiveSpliterator
 
ForwardStepNestedAdditiveSpliterator(siteList, baseModel, y, numberOfSites, nestingFactor) - Constructor for class net.maizegenetics.analysis.modelfitter.ForwardStepNestedAdditiveSpliterator
 
ForwardStepSubsettingAdditiveSpliterator - Class in net.maizegenetics.analysis.modelfitter
 
ForwardStepSubsettingAdditiveSpliterator(siteList, baseModel, y, subset) - Constructor for class net.maizegenetics.analysis.modelfitter.ForwardStepSubsettingAdditiveSpliterator
 
ForwardStepSubsettingNestedAdditiveSpliterator - Class in net.maizegenetics.analysis.modelfitter
 
ForwardStepSubsettingNestedAdditiveSpliterator(siteList, baseModel, y, subset, nestingFactor) - Constructor for class net.maizegenetics.analysis.modelfitter.ForwardStepSubsettingNestedAdditiveSpliterator
 
ForwardStepSubsettingNestedAdditiveSpliterator(siteList, baseModel, y, subset, numberOfSites, nestingFactor) - Constructor for class net.maizegenetics.analysis.modelfitter.ForwardStepSubsettingNestedAdditiveSpliterator
 
FRACDIGITS - Variable in interface net.maizegenetics.taxa.tree.BranchLimits
desired fractional digits when determining branch lengths
frequencyAlleles() - Static method in enum net.maizegenetics.dna.WHICH_ALLELE
 
fromAttributeList(attributes, types) - Method in class net.maizegenetics.phenotype.PhenotypeBuilder
 
fromFile(filename) - Method in class net.maizegenetics.phenotype.PhenotypeBuilder
 
fromPhenotype(base) - Method in class net.maizegenetics.phenotype.PhenotypeBuilder
 
fromPhenotypeList(phenotypes) - Method in class net.maizegenetics.phenotype.PhenotypeBuilder
 
FSFHapImputationPlugin - Class in net.maizegenetics.analysis.imputation
 
FSFHapImputationPlugin(parentFrame, isInteractive) - Constructor for class net.maizegenetics.analysis.imputation.FSFHapImputationPlugin
 
Ftest(F, numeratordf, denominatordf) - Static method in class net.maizegenetics.stats.linearmodels.LinearModelUtils
Calculates the p-value associated with an F statistic. The returned p-value is the probability that a greater F is drawn from the F-distribution.
full() - Method in class net.maizegenetics.analysis.ListPlugins
 
fullRefCoordinateToChromCoordinate(coordinates) - Method in interface net.maizegenetics.dna.map.GenomeSequence
Takes a list of coordinates from the full genome sequence and for each returns the corresponding chromosome and a coordinate relative to the start of that chromosome. The request is 0-based, as are the arrays where the alleles are stored, and the results.
fullSweepSetDmin() - Method in class net.maizegenetics.stats.linearmodels.SweepFast
 
fullTagPositions() - Method in class net.maizegenetics.dna.map.TagsOnPhysicalMap
Returns the start positions of tags whose variant arrays are full.

G

G - Variable in class net.maizegenetics.analysis.association.AbstractFixedEffectLM
 
G_ALLELE - Static variable in class net.maizegenetics.dna.snp.NucleotideAlignmentConstants
 
G_DIPLOID_ALLELE - Static variable in class net.maizegenetics.dna.snp.NucleotideAlignmentConstants
 
gamma() - Method in class net.maizegenetics.analysis.imputation.BackwardForwardAlgorithm
 
gamma() - Method in class net.maizegenetics.analysis.imputation.BackwardForwardVariableStateNumber
 
GammaDistribution - Class in net.maizegenetics.stats.statistics
gamma distribution. (Parameters: shape, scale; mean: scale*shape; variance: scale^2*shape)
GammaFunction - Class in net.maizegenetics.stats.math
gamma function
GAP_ALLELE - Static variable in class net.maizegenetics.dna.snp.NucleotideAlignmentConstants
 
GAP_ALLELE_CHAR - Static variable in class net.maizegenetics.dna.snp.NucleotideAlignmentConstants
 
GAP_ALLELE_STR - Static variable in class net.maizegenetics.dna.snp.NucleotideAlignmentConstants
 
GAP_CHARACTER - Static variable in class net.maizegenetics.analysis.gbs.neobio.PairwiseAlignmentAlgorithm
Character that signals a gap in sequence.
gap_cost - Variable in class net.maizegenetics.analysis.gbs.neobio.BasicScoringScheme
The cost of a gap (an insertion or deletion of a character).
GAP_DIPLOID_ALLELE - Static variable in class net.maizegenetics.dna.snp.NucleotideAlignmentConstants
 
gap_penalty() - Method in class net.maizegenetics.analysis.gbs.repgen.RampSeqAlignFromBlastTags
Parameter sent to Smith Waterman aligner for use in calculating penalty when when a gap is identified.
gap_penalty(value) - Method in class net.maizegenetics.analysis.gbs.repgen.RampSeqAlignFromBlastTags
Set Gap Penalty Amount. Parameter sent to Smith Waterman aligner for use in calculating penalty when when a gap is identified.
gap_penalty() - Method in class net.maizegenetics.analysis.gbs.repgen.RepGenAlignerPlugin
Parameter sent to Smith Waterman aligner for use in calculating penalty when when a gap is identified.
gap_penalty(value) - Method in class net.maizegenetics.analysis.gbs.repgen.RepGenAlignerPlugin
Set Gap Penalty Amount. Parameter sent to Smith Waterman aligner for use in calculating penalty when when a gap is identified.
gap_penalty() - Method in class net.maizegenetics.analysis.gbs.repgen.RepGenPhase2AlignerPlugin
Parameter sent to Smith Waterman aligner for use in calculating penalty when when a gap is identified.
gap_penalty(value) - Method in class net.maizegenetics.analysis.gbs.repgen.RepGenPhase2AlignerPlugin
Set Gap Penalty Amount. Parameter sent to Smith Waterman aligner for use in calculating penalty when when a gap is identified.
GAP_TAG - Static variable in class net.maizegenetics.analysis.gbs.neobio.PairwiseAlignmentAlgorithm
Character that signals a gap in the score tag line of an alignment.
gapAlignmentThreshold() - Method in class net.maizegenetics.analysis.gbs.v2.DiscoverySNPCallerPluginV2
Maximum gap alignment allowed from the equation: IndelContrast / (IndelContrast/Non-IndelContrast) IC=Indel contrasts=Sum the number ACGT vs - NC=non-indel constrasts = Sum the number of ACGT vs ACGT ignore = - vs - Gapped Alignment ratio = IC/(IC+NC)
gapAlignmentThreshold(value) - Method in class net.maizegenetics.analysis.gbs.v2.DiscoverySNPCallerPluginV2
Maximum gap alignment allowed from the equation: IndelContrast / (IndelContrast/Non-IndelContrast) IC=Indel contrasts=Sum the number ACGT vs - NC=non-indel constrasts = Sum the number of ACGT vs ACGT ignore = - vs - Gapped Alignment ratio = IC/(IC+NC)
gapped_seq1 - Variable in class net.maizegenetics.analysis.gbs.neobio.PairwiseAlignment
First gapped sequence.
gapped_seq2 - Variable in class net.maizegenetics.analysis.gbs.neobio.PairwiseAlignment
Second gapped sequence.
gBSDBFile() - Method in class net.maizegenetics.analysis.gbs.v2.SAMToGBSdbPlugin
Name of output file (e.g. GBSv2.db)
gBSDBFile(value) - Method in class net.maizegenetics.analysis.gbs.v2.SAMToGBSdbPlugin
Set GBS DB File. Name of output file (e.g. GBSv2.db)
GBSEnzyme - Class in net.maizegenetics.analysis.gbs.v2
Deprecated. 
GBSEnzyme(enzyme) - Constructor for class net.maizegenetics.analysis.gbs.v2.GBSEnzyme
Deprecated. 
GBSHDF5Constants - Class in net.maizegenetics.dna.tag
Path definitions for the HDF5 GBS file formats.
GBSSeqToTagDBPlugin - Class in net.maizegenetics.analysis.gbs.v2
Develops a discovery TBT file from a set of GBS sequence files. Keeps only good reads having a barcode and a cut site and no N's in the useful part of the sequence. Trims off the barcodes and truncates sequences that (1) have a second cut site, or (2) read into the common adapter. Originally the reference throughout was to "tag". This is being changed to "kmer" as the pipeline is a kmer alignment process.
GBSSeqToTagDBPlugin() - Constructor for class net.maizegenetics.analysis.gbs.v2.GBSSeqToTagDBPlugin
 
GBSSeqToTagDBPlugin(parentFrame, isInteractive) - Constructor for class net.maizegenetics.analysis.gbs.v2.GBSSeqToTagDBPlugin
 
GBSUtils - Class in net.maizegenetics.analysis.gbs.v2
This class contains methods and constants used by various classes in the GBSv2 pipeline.
gChr - Variable in class net.maizegenetics.dna.map.TagGWASMapInfo
Genetic mapping chromosome of a tag, unknown = Integer.MIN_VALUE
gChr - Variable in class net.maizegenetics.dna.map.TagsOnGeneticMap
 
GCTADistanceMatrix - Class in net.maizegenetics.analysis.distance
 
genDeflation - Static variable in class net.maizegenetics.dna.snp.HapMapHDF5Constants
 
genDeflation - Static variable in class net.maizegenetics.util.Tassel5HDF5Constants
 
GeneralAnnotation - Interface in net.maizegenetics.util
Provide generalized annotations (descriptors).
GeneralAnnotationStorage - Class in net.maizegenetics.util
 
GeneralAnnotationStorage.Builder - Class in net.maizegenetics.util
 
generalizedInverse() - Method in class net.maizegenetics.matrixalgebra.Matrix.BlasDoubleMatrix
 
generalizedInverse() - Method in class net.maizegenetics.matrixalgebra.Matrix.ColtDoubleMatrix
 
generalizedInverse() - Method in interface net.maizegenetics.matrixalgebra.Matrix.DoubleMatrix
 
generalizedInverse() - Method in class net.maizegenetics.matrixalgebra.Matrix.EJMLDoubleMatrix
 
generalizedInverseWithRank(rank) - Method in class net.maizegenetics.matrixalgebra.Matrix.BlasDoubleMatrix
 
generalizedInverseWithRank(rank) - Method in class net.maizegenetics.matrixalgebra.Matrix.ColtDoubleMatrix
 
generalizedInverseWithRank(rank) - Method in interface net.maizegenetics.matrixalgebra.Matrix.DoubleMatrix
inverts the matrix and returns the rank as the first element in rank[]. The original matrix is not modified.
generalizedInverseWithRank(rank) - Method in class net.maizegenetics.matrixalgebra.Matrix.EJMLDoubleMatrix
 
GeneralPosition - Class in net.maizegenetics.dna.map
Provide information on a site and its annotations. This includes information on position, MAF, coverage. This class is immutable.
GeneralPosition.Builder - Class in net.maizegenetics.dna.map
A builder for creating immutable CoreAnnotatedPosition instances. AnnotatedPositions are built off a base of a CorePosition, so build it first.
generate(currentMatch) - Static method in class net.maizegenetics.plugindef.GeneratePluginCode
 
generate(currentMatch, inputObject, outputObject) - Static method in class net.maizegenetics.plugindef.GenerateRCode
 
generateChromosomeResidualsFromCurrentModel() - Method in class net.maizegenetics.analysis.modelfitter.StepwiseOLSModelFitter
 
generateCombinedMatrix(aInverse, gStarInverse) - Static method in class net.maizegenetics.analysis.distance.HMatrixPlugin
Given the inverse of an A matrix (Pedigree Kinship matrix) and a G Matrix (Genetic Kinship Matrix) which contains mostly entries in the A Matrix creates a combined (H) matrix.
generateKotlin(currentMatch) - Static method in class net.maizegenetics.plugindef.GeneratePluginCode
 
generateMasterPositionList(alignments) - Static method in class net.maizegenetics.analysis.data.MergeGenotypeTablesPlugin
Generate a list of unique positions given an array of alignments
generateMasterTaxaList(alignments) - Static method in class net.maizegenetics.analysis.data.MergeGenotypeTablesPlugin
Generate a list of unique taxa given an array of alignments
GeneratePluginCode - Class in net.maizegenetics.plugindef
 
GenerateRCode - Class in net.maizegenetics.plugindef
 
GenerateRCode.PositionVectors - Class in net.maizegenetics.plugindef
 
GenerateRCode.TableReportVectors - Class in net.maizegenetics.plugindef
 
generateToolTip(dataset, series, item) - Method in class net.maizegenetics.analysis.chart.XYAndLineToolTipGenerator
 
generateToolTip(dataset, series, item) - Method in class net.maizegenetics.analysis.chart.XYMultipleYToolTipGenerator
 
GENERATIONS - Variable in interface net.maizegenetics.taxa.tree.Units
 
GenericArrayPositions - Class in net.maizegenetics.analysis.avro
 
GenericArrayPositions(positions) - Constructor for class net.maizegenetics.analysis.avro.GenericArrayPositions
 
GenericArrayTaxa - Class in net.maizegenetics.analysis.avro
 
GenericArrayTaxa(taxa) - Constructor for class net.maizegenetics.analysis.avro.GenericArrayTaxa
 
GenericMapAnnotations - Class in net.maizegenetics.analysis.avro
 
GenericMapAnnotations(annotations) - Constructor for class net.maizegenetics.analysis.avro.GenericMapAnnotations
 
GenericRecordChromosome - Class in net.maizegenetics.analysis.avro
 
GenericRecordGenotype - Class in net.maizegenetics.analysis.avro
 
GenericRecordGenotype(genotypeSchema, genotype) - Constructor for class net.maizegenetics.analysis.avro.GenericRecordGenotype
 
GenericRecordGenotypeTable - Class in net.maizegenetics.analysis.avro
 
GenericRecordGenotypeTable(tasselSchema, table) - Constructor for class net.maizegenetics.analysis.avro.GenericRecordGenotypeTable
 
GenericRecordPosition - Class in net.maizegenetics.analysis.avro
 
GenericRecordPosition(position) - Constructor for class net.maizegenetics.analysis.avro.GenericRecordPosition
 
GenericRecordTaxon - Class in net.maizegenetics.analysis.avro
 
GenericRecordTaxon(taxon) - Constructor for class net.maizegenetics.analysis.avro.GenericRecordTaxon
 
GENETICMAMMPING - Static variable in class net.maizegenetics.dna.tag.GBSHDF5Constants
 
GENETICMAMMPINGGW - Static variable in class net.maizegenetics.dna.tag.GBSHDF5Constants
 
GENO_DESC - Static variable in class net.maizegenetics.util.Tassel5HDF5Constants
 
genoCounts() - Method in class net.maizegenetics.dna.snp.CombineGenotypeTable
 
genoCounts() - Method in class net.maizegenetics.dna.snp.CoreGenotypeTable
 
genoCounts() - Method in interface net.maizegenetics.dna.snp.genotypecall.GenotypeCallTable
Returns counts of all diploid combinations from highest frequency to lowest for whole alignment. Resulting double dimension array holds diploids (Strings) in result[0]. And the counts are in result[1] (Longs).
genoCounts() - Method in interface net.maizegenetics.dna.snp.GenotypeTable
Returns counts of all diploid combinations from highest frequency to lowest for whole genotype table. Resulting double dimension array holds diploids (Strings) in result[0]. And the counts are in result[1] (Longs).
genoCounts() - Method in class net.maizegenetics.dna.snp.MergedGenotypeTable
 
genoCounts() - Method in class net.maizegenetics.dna.snp.TOPMGenotypeTable
 
GenomeAnnosDBQueryToPositionListPlugin - Class in net.maizegenetics.analysis.data
Reads a PostgreSQL query file and a genomeAnnosDB connection config file, checks that the query is a SELECT query for chr, position, etc.., executes the query, and turns the results into a PositionList with any result fields other that chr & position added as annotations.
GenomeAnnosDBQueryToPositionListPlugin() - Constructor for class net.maizegenetics.analysis.data.GenomeAnnosDBQueryToPositionListPlugin
 
GenomeAnnosDBQueryToPositionListPlugin(parentFrame, isInteractive) - Constructor for class net.maizegenetics.analysis.data.GenomeAnnosDBQueryToPositionListPlugin
 
GenomeFeature - Class in net.maizegenetics.dna.map
Created by Jason Wallace on 7/2/14. This class stores a generic "feature" on a genome, such as a gene, transcript, exon, miRNA, etc. The intent is for this information to be read in from an external file (such as an Ensembl GFF/GTF file) and collated into a GenomeFeatureMap, but it could be used in other ways.
GenomeFeatureBuilder - Class in net.maizegenetics.dna.map
Created by jgw87 on 7/2/14. Builder class to create a GenomeFeature. All annoations are stored in a HashMap. Any annotation can be added through the addAnnotation() method, but the more common fields have their own convenience methods. Only the feature's own ID is required; all other annotations are optional
GenomeFeatureBuilder() - Constructor for class net.maizegenetics.dna.map.GenomeFeatureBuilder
Generic constructor which does nothing special
GenomeFeatureBuilder(feature) - Constructor for class net.maizegenetics.dna.map.GenomeFeatureBuilder
Constructor to build a new feature off of an existing one.
GenomeFeatureMap - Class in net.maizegenetics.dna.map
Created by jgw87 on 7/2/14. A map to hold genome features for lookup by name and by location. The features themselves are hierarchical and so can be traced up and down the tree.
GenomeFeatureMapBuilder - Class in net.maizegenetics.dna.map
Created by jgw87 on 7/2/14. A Builder class to create a GenomeFeatureMap to identify genomic features. Can build piecemeal or read in from a file For now, not implementing functionality to make a new builder from an existing map.
GenomeSequence - Interface in net.maizegenetics.dna.map
Defines the genome sequence of a chromosome
genomeSequence(startSite, lastSite) - Method in interface net.maizegenetics.dna.map.GenomeSequence
Returns the partial genomic sequence from the specified start position to the specified end position. THe start/end positions are inclusive and the request is 0-based (though the alleles are stored in a 0-based byte array). Note the difference with chromosomes, which start with 1. Can only return 2.1 billion sites per call.
genomeSequenceAsString(startSite, lastSite) - Method in interface net.maizegenetics.dna.map.GenomeSequence
Returns the partial genomic sequence from the specified start position to the specified end position. The start/end positions are inclusive and the request is 0-based (though the alleles are stored in a 0-based byte array). Note the difference with chromosomes, which start with 1. Can only return 2.1 billion sites per call.
GenomeSequenceBuilder - Class in net.maizegenetics.dna.map
Builder for a chromosome genome sequence that hides the ReferenceGenomeSequence implementation. The sequence is read from a fasta file and stored in a byte array, 2 alleles packed per byte.
genomeSize() - Method in interface net.maizegenetics.dna.map.GenomeSequence
Returns the length of the entire genome
genomeVersion() - Method in class net.maizegenetics.analysis.data.ConvertAlignmentCoordinatesPlugin
Genome Version
genomeVersion(value) - Method in class net.maizegenetics.analysis.data.ConvertAlignmentCoordinatesPlugin
Set Genome Version. Genome Version
genomeVersion() - Method in interface net.maizegenetics.dna.map.PositionList
Gets the Genome Assembly.
genomeVersion(genomeVersion) - Method in class net.maizegenetics.dna.map.PositionListBuilder
 
genomeVersion() - Method in class net.maizegenetics.dna.snp.CombineGenotypeTable
 
genomeVersion() - Method in class net.maizegenetics.dna.snp.CoreGenotypeTable
 
genomeVersion() - Method in interface net.maizegenetics.dna.snp.GenotypeTable
Gets the Genome Assembly.
genomeVersion() - Method in class net.maizegenetics.dna.snp.MergedGenotypeTable
 
genomeVersion() - Method in class net.maizegenetics.dna.snp.TOPMGenotypeTable
 
GENOMIC - Static variable in class net.maizegenetics.dna.snp.HapMapHDF5Constants
 
genomicSelection(phenotype, matrix, doCV, kFolds, nIter) - Static method in class net.maizegenetics.plugindef.GenerateRCode
 
GenomicSelectionPlugin - Class in net.maizegenetics.analysis.association
 
GenomicSelectionPlugin(parentFrame, isInteractive) - Constructor for class net.maizegenetics.analysis.association.GenomicSelectionPlugin
 
genosSortedByFrequency(site) - Method in class net.maizegenetics.dna.snp.CombineGenotypeTable
 
genosSortedByFrequency(site) - Method in class net.maizegenetics.dna.snp.CoreGenotypeTable
 
genosSortedByFrequency(site) - Method in interface net.maizegenetics.dna.snp.genotypecall.GenotypeCallTable
Return sorted list of diploid vales from highest frequency to lowest at given site in alignment. Resulting double dimension array holds diploids (Strings) in result[0]. And the counts are in result[1] (Integers).
genosSortedByFrequency(site) - Method in interface net.maizegenetics.dna.snp.GenotypeTable
Return sorted list of diploid vales from highest frequency to lowest at given site in genotype table. Resulting double dimension array holds diploids (Strings) in result[0]. And the counts are in result[1] (Integers).
genosSortedByFrequency(site) - Method in class net.maizegenetics.dna.snp.MergedGenotypeTable
 
genosSortedByFrequency(site) - Method in class net.maizegenetics.dna.snp.TOPMGenotypeTable
 
GenosToABHPlugin - Class in net.maizegenetics.analysis.data
Plugin to convert genotypes to parental comparisons and store them in an output file. The user can get outputs as A/H/B, 0/1/2, or 0/0.5/1 for a genotype matching parent A's genotype, heterozygous, or parent B's genotype respectively. If the genotype is neither A or B or a het combination of A/B (B/A) then it is coded as "NA".
GenosToABHPlugin() - Constructor for class net.maizegenetics.analysis.data.GenosToABHPlugin
 
GenosToABHPlugin(parentFrame, isInteractive) - Constructor for class net.maizegenetics.analysis.data.GenosToABHPlugin
 
GenosToABHPlugin.OUTPUT_CHECK - Enum in net.maizegenetics.analysis.data
 
genotype(chrom, position) - Method in interface net.maizegenetics.dna.map.GenomeSequence
Returns the allele value in a byte for the specified PHYSICAL position (1-based)
genotype(chrom, positionObject) - Method in interface net.maizegenetics.dna.map.GenomeSequence
Returns the TASSEL encoding for the allele value in a byte for the specified PHYSICAL position
genotype(taxon, site) - Method in class net.maizegenetics.dna.snp.CombineGenotypeTable
 
genotype(taxon, locus, physicalPosition) - Method in class net.maizegenetics.dna.snp.CombineGenotypeTable
 
genotype(taxon, site) - Method in class net.maizegenetics.dna.snp.CoreGenotypeTable
 
genotype(taxon, chromosome, physicalPosition) - Method in class net.maizegenetics.dna.snp.CoreGenotypeTable
 
genotype(taxon, site) - Method in class net.maizegenetics.dna.snp.genotypecall.CombineGenotypeCallTable
 
genotype(taxon, site) - Method in class net.maizegenetics.dna.snp.genotypecall.DifferenceGenotypeCallTable
 
genotype(taxon, site) - Method in interface net.maizegenetics.dna.snp.genotypecall.GenotypeCallTable
Returns diploid value (genotype) for a given taxon and site.
genotype(taxon, site) - Method in class net.maizegenetics.dna.snp.genotypecall.GOBIIAvroGenotypeCallTable
 
genotype(taxon, site) - Method in class net.maizegenetics.dna.snp.genotypecall.GOBIIGenotypeCallTable
 
genotype(taxon, site) - Method in class net.maizegenetics.dna.snp.genotypecall.HybridGenotypeCallTable
 
genotype(taxon, site) - Method in class net.maizegenetics.dna.snp.genotypecall.LineIndexHapmapGenotypeCallTable
 
genotype(taxon, site) - Method in class net.maizegenetics.dna.snp.genotypecall.MaskGenotypeCallTable
 
genotype(taxon, site) - Method in class net.maizegenetics.dna.snp.genotypecall.MergedGenotypeCallTable
 
genotype(taxon, site) - Method in class net.maizegenetics.dna.snp.genotypecall.ProjectionGenotypeCallTable
 
genotype(taxon, site) - Method in interface net.maizegenetics.dna.snp.GenotypeTable
Returns diploid value (genotype) for a given taxon and site.
genotype(taxon, chromosome, physicalPosition) - Method in interface net.maizegenetics.dna.snp.GenotypeTable
Returns diploid values for given taxon, chromosome, and physical position. The chromosome and physical position should map to an unique site.
genotype(taxon, site) - Method in class net.maizegenetics.dna.snp.MergedGenotypeTable
 
genotype(taxon, chromosome, physicalPosition) - Method in class net.maizegenetics.dna.snp.MergedGenotypeTable
 
genotype(taxon, site) - Method in class net.maizegenetics.dna.snp.TOPMGenotypeTable
 
genotype(taxon, chromosome, physicalPosition) - Method in class net.maizegenetics.dna.snp.TOPMGenotypeTable
 
genotype(obs, site) - Method in class net.maizegenetics.phenotype.GenotypePhenotype
 
genotype(theGenotype) - Method in class net.maizegenetics.phenotype.GenotypePhenotypeBuilder
 
GENOTYPE_BLOCK_SIZE - Static variable in class net.maizegenetics.analysis.avro.AvroConstants
 
GENOTYPE_BLOCK_SIZE - Static variable in class net.maizegenetics.dna.snp.genotypecall.GOBIIAvroGenotypeCallTable
 
GENOTYPE_TABLE_ANNOTATIONS - Static variable in interface net.maizegenetics.dna.snp.GenotypeTable
 
GenotypeAdditiveSite - Class in net.maizegenetics.analysis.modelfitter
GenotypeAdditiveSite is an AdditiveSite that takes a byte[] array of genotypes as input and converts them to a double[] array. It codes the homozygous major as 2, homozygous minor as 0 and het as 1. It then subtracts the mean value from all elements of the array and sets missing to zero (now the mean). For efficient storage, the values of 0,1,2,3 are stored in a byte array which indexes the double values.
GenotypeAdditiveSite(site, chr, pos, id, selectionCriterion, genotype, majorAllele, majorAlleleFrequency) - Constructor for class net.maizegenetics.analysis.modelfitter.GenotypeAdditiveSite
 
genotypeAllSites(taxon) - Method in class net.maizegenetics.dna.snp.CombineGenotypeTable
 
genotypeAllSites(taxon) - Method in class net.maizegenetics.dna.snp.CoreGenotypeTable
 
genotypeAllSites(taxon) - Method in interface net.maizegenetics.dna.snp.genotypecall.GenotypeCallTable
Returns sequence of diploid allele values for all sites for given taxon. Each value in array is what would be returned by genotype().
genotypeAllSites(taxon) - Method in class net.maizegenetics.dna.snp.genotypecall.GOBIIAvroGenotypeCallTable
 
genotypeAllSites(taxon) - Method in interface net.maizegenetics.dna.snp.GenotypeTable
Returns sequence of diploid allele values for all sites for given taxon. Each value in array is what would be returned by genotype().
genotypeAllSites(taxon) - Method in class net.maizegenetics.dna.snp.MergedGenotypeTable
 
genotypeAllSites(taxon) - Method in class net.maizegenetics.dna.snp.TOPMGenotypeTable
 
genotypeAllTaxa(site) - Method in class net.maizegenetics.dna.snp.CombineGenotypeTable
 
genotypeAllTaxa(site) - Method in class net.maizegenetics.dna.snp.CoreGenotypeTable
 
genotypeAllTaxa(site) - Method in interface net.maizegenetics.dna.snp.GenotypeTable
Returns sequence of diploid allele values for all taxa for given site. Each value in array is what would be returned by genotype().
genotypeAllTaxa(site) - Method in class net.maizegenetics.dna.snp.MergedGenotypeTable
 
genotypeAllTaxa(site) - Method in class net.maizegenetics.dna.snp.TOPMGenotypeTable
 
genotypeAllTaxa(site) - Method in class net.maizegenetics.phenotype.GenotypePhenotype
 
genotypeArray(taxon, site) - Method in class net.maizegenetics.dna.snp.CombineGenotypeTable
 
genotypeArray(taxon, site) - Method in class net.maizegenetics.dna.snp.CoreGenotypeTable
 
genotypeArray(taxon, site) - Method in interface net.maizegenetics.dna.snp.genotypecall.GenotypeCallTable
Returns diploid values for given taxon and site. Same values as genotype(), except two values are already separated into two bytes.
genotypeArray(taxon, site) - Method in class net.maizegenetics.dna.snp.genotypecall.MergedGenotypeCallTable
 
genotypeArray(taxon, site) - Method in interface net.maizegenetics.dna.snp.GenotypeTable
Returns diploid values for given taxon and site. Same values as genotype(), except two values are already separated into two bytes.
genotypeArray(taxon, site) - Method in class net.maizegenetics.dna.snp.MergedGenotypeTable
 
genotypeArray(taxon, site) - Method in class net.maizegenetics.dna.snp.TOPMGenotypeTable
 
genotypeAsString(chrom, position) - Method in interface net.maizegenetics.dna.map.GenomeSequence
Returns the haplotype allele value in a String for the specified physical position on the specified chromosome
genotypeAsString(chrom, positionObject) - Method in interface net.maizegenetics.dna.map.GenomeSequence
Returns the haplotype allele value in a String for the specified physical position on the specified chromosome
genotypeAsString(chrom, startSite, endSite) - Method in interface net.maizegenetics.dna.map.GenomeSequence
Returns a string of haplotype allele values for the specified physical start and physical end positions on the specified chromosome.
genotypeAsString(taxon, site) - Method in class net.maizegenetics.dna.snp.CombineGenotypeTable
 
genotypeAsString(site, value) - Method in class net.maizegenetics.dna.snp.CombineGenotypeTable
 
genotypeAsString(taxon, site) - Method in class net.maizegenetics.dna.snp.CoreGenotypeTable
 
genotypeAsString(site, value) - Method in class net.maizegenetics.dna.snp.CoreGenotypeTable
 
genotypeAsString(taxon, site) - Method in class net.maizegenetics.dna.snp.genotypecall.CombineGenotypeCallTable
 
genotypeAsString(taxon, site) - Method in class net.maizegenetics.dna.snp.genotypecall.DifferenceGenotypeCallTable
 
genotypeAsString(taxon, site) - Method in interface net.maizegenetics.dna.snp.genotypecall.GenotypeCallTable
Returns string representation of diploid values returned by genotype() for given taxon and site. The default implementation separates The two allele values with a colon (:) delimiter. Nucleotide data will be represented by a single letter IUPAC code.
genotypeAsString(site, value) - Method in interface net.maizegenetics.dna.snp.genotypecall.GenotypeCallTable
Returns String representation of allele value at site.
genotypeAsString(taxon, site) - Method in class net.maizegenetics.dna.snp.genotypecall.GOBIIAvroGenotypeCallTable
 
genotypeAsString(taxon, site) - Method in class net.maizegenetics.dna.snp.genotypecall.GOBIIGenotypeCallTable
 
genotypeAsString(taxon, site) - Method in class net.maizegenetics.dna.snp.genotypecall.HybridGenotypeCallTable
 
genotypeAsString(taxon, site) - Method in class net.maizegenetics.dna.snp.genotypecall.LineIndexHapmapGenotypeCallTable
 
genotypeAsString(taxon, site) - Method in class net.maizegenetics.dna.snp.genotypecall.MaskGenotypeCallTable
 
genotypeAsString(taxon, site) - Method in class net.maizegenetics.dna.snp.genotypecall.MergedGenotypeCallTable
 
genotypeAsString(taxon, site) - Method in class net.maizegenetics.dna.snp.genotypecall.ProjectionGenotypeCallTable
 
genotypeAsString(taxon, site) - Method in interface net.maizegenetics.dna.snp.GenotypeTable
Returns string representation of diploid values returned by genotype() for given taxon and site. The default implementation separates The two allele values with a colon (:) delimiter. Nucleotide data will be represented by a single letter IUPAC code.
genotypeAsString(site, value) - Method in interface net.maizegenetics.dna.snp.GenotypeTable
Returns String representation of allele value at site.
genotypeAsString(taxon, site) - Method in class net.maizegenetics.dna.snp.MergedGenotypeTable
 
genotypeAsString(site, value) - Method in class net.maizegenetics.dna.snp.MergedGenotypeTable
 
genotypeAsString(taxon, site) - Method in class net.maizegenetics.dna.snp.TOPMGenotypeTable
 
genotypeAsString(site, value) - Method in class net.maizegenetics.dna.snp.TOPMGenotypeTable
 
genotypeAsStringArray(taxon, site) - Method in class net.maizegenetics.dna.snp.CombineGenotypeTable
 
genotypeAsStringArray(taxon, site) - Method in class net.maizegenetics.dna.snp.CoreGenotypeTable
 
genotypeAsStringArray(taxon, site) - Method in interface net.maizegenetics.dna.snp.genotypecall.GenotypeCallTable
Returns string representation of diploid values returned by genotypeArray() for given taxon and site. Same two allele values as genotypeAsString(), except already separated into two Strings.
genotypeAsStringArray(site, value) - Method in interface net.maizegenetics.dna.snp.genotypecall.GenotypeCallTable
Same as genotypeAsStringArray(taxon, site), except given value is converted for given site.
genotypeAsStringArray(taxon, site) - Method in interface net.maizegenetics.dna.snp.GenotypeTable
Returns string representation of diploid values returned by genotypeArray() for given taxon and site. Same two allele values as genotypeAsString(), except already separated into two Strings.
genotypeAsStringArray(taxon, site) - Method in class net.maizegenetics.dna.snp.MergedGenotypeTable
 
genotypeAsStringArray(taxon, site) - Method in class net.maizegenetics.dna.snp.TOPMGenotypeTable
 
genotypeAsStringRange(taxon, startSite, endSite) - Method in class net.maizegenetics.dna.snp.CombineGenotypeTable
 
genotypeAsStringRange(taxon, startSite, endSite) - Method in class net.maizegenetics.dna.snp.CoreGenotypeTable
 
genotypeAsStringRange(taxon, startSite, endSite) - Method in class net.maizegenetics.dna.snp.genotypecall.DifferenceGenotypeCallTable
 
genotypeAsStringRange(taxon, startSite, endSite) - Method in interface net.maizegenetics.dna.snp.genotypecall.GenotypeCallTable
Returns string representation of diploid alleles for given taxon in specified range (end site excluded). Each value in string is what would be returned by genotypeAsString().
genotypeAsStringRange(taxon, startSite, endSite) - Method in class net.maizegenetics.dna.snp.genotypecall.HybridGenotypeCallTable
 
genotypeAsStringRange(taxon, startSite, endSite) - Method in class net.maizegenetics.dna.snp.genotypecall.MaskGenotypeCallTable
 
genotypeAsStringRange(taxon, startSite, endSite) - Method in interface net.maizegenetics.dna.snp.GenotypeTable
Returns string representation of diploid alleles for given taxon in specified range (end site excluded). Each value in string is what would be returned by genotypeAsString().
genotypeAsStringRange(taxon, startSite, endSite) - Method in class net.maizegenetics.dna.snp.MergedGenotypeTable
 
genotypeAsStringRange(taxon, startSite, endSite) - Method in class net.maizegenetics.dna.snp.TOPMGenotypeTable
 
genotypeAsStringRow(taxon) - Method in class net.maizegenetics.dna.snp.CombineGenotypeTable
 
genotypeAsStringRow(taxon) - Method in class net.maizegenetics.dna.snp.CoreGenotypeTable
 
genotypeAsStringRow(taxon) - Method in interface net.maizegenetics.dna.snp.genotypecall.GenotypeCallTable
Returns string representation of diploid alleles for given taxon for all sites. Each value in string is what would be returned by genotypeAsString().
genotypeAsStringRow(taxon) - Method in interface net.maizegenetics.dna.snp.GenotypeTable
Returns string representation of diploid alleles for given taxon for all sites. Each value in string is what would be returned by genotypeAsString().
genotypeAsStringRow(taxon) - Method in class net.maizegenetics.dna.snp.MergedGenotypeTable
 
genotypeAsStringRow(taxon) - Method in class net.maizegenetics.dna.snp.TOPMGenotypeTable
 
GenotypeCallTable - Interface in net.maizegenetics.dna.snp.genotypecall
Interface for genotype calls for a table of taxa and sites. GenotypeCallTable only contain information on the genotype calls - the call table does not have the TaxaList or PositionList. The calls are diploid genotype calls stored and retrieved as bytes. Conversions to string are also provided.
GenotypeCallTableBuilder - Class in net.maizegenetics.dna.snp.genotypecall
Builder to construct a GenotypeCallTable. This builder is generally only used in complex situations, where the GenotypeTableBuilder does not suffice.
genotypeComponent() - Method in class net.maizegenetics.analysis.association.EqtlAssociationPlugin
If the genotype table contains more than one type of genotype data, choose the type to use for the analysis.
genotypeComponent(value) - Method in class net.maizegenetics.analysis.association.EqtlAssociationPlugin
Set Genotype Component. If the genotype table contains more than one type of genotype data, choose the type to use for the analysis.
genotypeForAllSites(taxon) - Method in interface net.maizegenetics.dna.snp.genotypecall.GenotypeCallTable
Get all genotypes for given taxon.
genotypeForAllSites(taxon) - Method in class net.maizegenetics.dna.snp.genotypecall.MaskGenotypeCallTable
 
genotypeForAllTaxa(site) - Method in interface net.maizegenetics.dna.snp.genotypecall.GenotypeCallTable
Get all genotypes for given site.
genotypeForAllTaxa(site) - Method in class net.maizegenetics.dna.snp.genotypecall.GOBIIAvroGenotypeCallTable
 
genotypeForAllTaxa(site) - Method in class net.maizegenetics.dna.snp.genotypecall.GOBIIGenotypeCallTable
 
genotypeForAllTaxa(site) - Method in class net.maizegenetics.dna.snp.genotypecall.LineIndexHapmapGenotypeCallTable
 
genotypeForAllTaxa(site) - Method in class net.maizegenetics.dna.snp.genotypecall.MaskGenotypeCallTable
 
genotypeForSiteRange(taxon, start, end) - Method in interface net.maizegenetics.dna.snp.genotypecall.GenotypeCallTable
Get all genotypes for given taxon from start site (inclusive) to end site (exclusive).
genotypeIndices() - Method in class net.maizegenetics.analysis.phg.ParseGVCF.GVCFLine
 
genotypeMatrix() - Method in class net.maizegenetics.dna.snp.CombineGenotypeTable
 
genotypeMatrix() - Method in class net.maizegenetics.dna.snp.CoreGenotypeTable
 
genotypeMatrix() - Method in interface net.maizegenetics.dna.snp.GenotypeTable
Returns the immutable Genotype matrix. Taxa and Positions are not part of the matrix. This method is used for copying Genotype tables, when either the Taxa or Positions have changed.
genotypeMatrix() - Method in class net.maizegenetics.dna.snp.MergedGenotypeTable
 
genotypeMatrix() - Method in class net.maizegenetics.dna.snp.TOPMGenotypeTable
 
GenotypeMergeRule - Interface in net.maizegenetics.dna.snp.genotypecall
Defines the methods for merging the calls from two taxa. The merge rules need to be defined at the level of genotypic calls and for read depth. In general if depth is available, it will be used to merge.
GenotypePhenotype - Class in net.maizegenetics.phenotype
This class holds phenotypes and genotypes for a set of Taxa.
GenotypePhenotypeBuilder - Class in net.maizegenetics.phenotype
 
genotypeRange(taxon, startSite, endSite) - Method in class net.maizegenetics.dna.snp.CombineGenotypeTable
 
genotypeRange(taxon, startSite, endSite) - Method in class net.maizegenetics.dna.snp.CoreGenotypeTable
 
genotypeRange(taxon, startSite, endSite) - Method in interface net.maizegenetics.dna.snp.genotypecall.GenotypeCallTable
Returns sequence of diploid allele values for given taxon in specified range (end site excluded). Each value in array is what would be returned by genotype().
genotypeRange(taxon, startSite, endSite) - Method in interface net.maizegenetics.dna.snp.GenotypeTable
Returns sequence of diploid allele values for given taxon in specified range (end site excluded). Each value in array is what would be returned by genotype().
genotypeRange(taxon, startSite, endSite) - Method in class net.maizegenetics.dna.snp.MergedGenotypeTable
 
genotypeRange(taxon, startSite, endSite) - Method in class net.maizegenetics.dna.snp.TOPMGenotypeTable
 
genotypes() - Method in class net.maizegenetics.analysis.phg.ParseGVCF.GVCFLine
 
GENOTYPES - Static variable in class net.maizegenetics.dna.snp.HapMapHDF5Constants
 
GENOTYPES_ALLELE_STATES - Static variable in class net.maizegenetics.util.Tassel5HDF5Constants
 
GENOTYPES_ATTRIBUTES_PATH - Static variable in class net.maizegenetics.util.Tassel5HDF5Constants
 
GENOTYPES_LOCKED - Static variable in class net.maizegenetics.util.Tassel5HDF5Constants
 
GENOTYPES_MAX_NUM_ALLELES - Static variable in class net.maizegenetics.util.Tassel5HDF5Constants
 
GENOTYPES_MODULE - Static variable in class net.maizegenetics.util.Tassel5HDF5Constants
 
GENOTYPES_NUM_TAXA - Static variable in class net.maizegenetics.util.Tassel5HDF5Constants
 
GENOTYPES_RETAIN_RARE_ALLELES - Static variable in class net.maizegenetics.util.Tassel5HDF5Constants
 
GENOTYPES_SCORE_TYPE - Static variable in class net.maizegenetics.util.Tassel5HDF5Constants
 
genotypesToUnphasedSorted(genotypes) - Static method in class net.maizegenetics.stats.linearmodels.ModelEffectUtils
 
GenotypeSummaryPlugin - Class in net.maizegenetics.analysis.data
 
GenotypeSummaryPlugin() - Constructor for class net.maizegenetics.analysis.data.GenotypeSummaryPlugin
 
GenotypeSummaryPlugin(parentFrame, isInteractive) - Constructor for class net.maizegenetics.analysis.data.GenotypeSummaryPlugin
 
genotypeTable() - Method in class net.maizegenetics.analysis.association.FastMultithreadedAssociationPlugin
If the genotype table contains more than one type of genotype data, choose the type to use for the analysis.
genotypeTable(value) - Method in class net.maizegenetics.analysis.association.FastMultithreadedAssociationPlugin
Set Genotype Component. If the genotype table contains more than one type of genotype data, choose the type to use for the analysis.
genotypeTable() - Method in class net.maizegenetics.analysis.association.FixedEffectLMPlugin
If the genotype table contains more than one type of genotype data, choose the type to use for the analysis.
genotypeTable(value) - Method in class net.maizegenetics.analysis.association.FixedEffectLMPlugin
Set Genotype Component. If the genotype table contains more than one type of genotype data, choose the type to use for the analysis.
genotypeTable(genotypeTable) - Static method in class net.maizegenetics.analysis.avro.ImportAvro
 
genotypeTable() - Method in class net.maizegenetics.analysis.modelfitter.StepwiseAdditiveModelFitterPlugin
If the genotype table contains more than one type of genotype data, choose the type to use for the analysis.
genotypeTable(value) - Method in class net.maizegenetics.analysis.modelfitter.StepwiseAdditiveModelFitterPlugin
Set Genotype Component. If the genotype table contains more than one type of genotype data, choose the type to use for the analysis.
GenotypeTable - Interface in net.maizegenetics.dna.snp
A representation of the SNP and indel variation for a set of taxa and genomic positions.
genotypeTable() - Method in class net.maizegenetics.phenotype.GenotypePhenotype
 
genotypeTable() - Method in class net.maizegenetics.plugindef.PluginParameter.Builder
 
GenotypeTable.ALLELE_SORT_TYPE - Enum in net.maizegenetics.dna.snp
This defines the possible allele scope types.
GenotypeTable.GENOTYPE_TABLE_COMPONENT - Enum in net.maizegenetics.dna.snp
Possible Components of a Genotype Table.
GenotypeTableBuilder - Class in net.maizegenetics.dna.snp
Builder for GenotypeTables. New genotypeTables are built from a minimum of TaxaList, PositionList, and GenotypeCallTable. Depth and Scores are optional features of GenotypeTables.
GenotypeTableMask - Interface in net.maizegenetics.gui
 
GenotypeTableMask.MaskType - Enum in net.maizegenetics.gui
This defines the type of mask. reference - Mask created using taxon as reference. imputed - Mask created to identify imputed values. compared = Mask created to identify differences between two alignments.
GenotypeTableMaskBoolean - Class in net.maizegenetics.gui
 
GenotypeTableMaskBoolean(align, mask, name, type) - Constructor for class net.maizegenetics.gui.GenotypeTableMaskBoolean
 
GenotypeTableMaskBoolean(align, mask, name, color, type) - Constructor for class net.maizegenetics.gui.GenotypeTableMaskBoolean
 
GenotypeTableMaskGeneticDistance - Class in net.maizegenetics.gui
 
GenotypeTableMaskReference - Class in net.maizegenetics.gui
 
genotypeTableToDosageByteArray(genotype, useRef) - Static method in class net.maizegenetics.plugindef.GenerateRCode
This converts a genotype table to a double dimension dosage byte array.
genotypeTableToPositionListOfArrays(positions) - Static method in class net.maizegenetics.plugindef.GenerateRCode
This converts the given position list to a @class GenerateRCode.PositionVectors
genotypeTableToPositionListOfArrays(genotype) - Static method in class net.maizegenetics.plugindef.GenerateRCode
This converts the position list of the given genotype table to a @class GenerateRCode.PositionVectors
genotypeTableToSampleNameArray(genotype) - Static method in class net.maizegenetics.plugindef.GenerateRCode
This converts the taxa of the specified genotype table to an array of taxa name strings.
genotypeTableToSampleNameArray(taxa) - Static method in class net.maizegenetics.plugindef.GenerateRCode
This converts the taxa list to an array of taxa name strings.
GenotypeTableUtils - Class in net.maizegenetics.dna.snp
Utility methods for comparing, sorting, and counting genotypes.
GenotypeToAdditiveValuesPlugin - Class in net.maizegenetics.analysis.data
 
GenotypeToAdditiveValuesPlugin(parentFrame, isInteractive) - Constructor for class net.maizegenetics.analysis.data.GenotypeToAdditiveValuesPlugin
 
GenusKey - Static variable in class net.maizegenetics.taxa.Taxon
Standard key for a genus of the taxon
get(index) - Method in class net.maizegenetics.analysis.avro.GenericArrayPositions
 
get(index) - Method in class net.maizegenetics.analysis.avro.GenericArrayTaxa
 
get(key) - Method in class net.maizegenetics.analysis.avro.GenericMapAnnotations
 
get(key) - Method in class net.maizegenetics.analysis.avro.GenericRecordChromosome
 
get(i) - Method in class net.maizegenetics.analysis.avro.GenericRecordChromosome
 
get(key) - Method in class net.maizegenetics.analysis.avro.GenericRecordGenotype
 
get(i) - Method in class net.maizegenetics.analysis.avro.GenericRecordGenotype
 
get(key) - Method in class net.maizegenetics.analysis.avro.GenericRecordGenotypeTable
 
get(i) - Method in class net.maizegenetics.analysis.avro.GenericRecordGenotypeTable
 
get(key) - Method in class net.maizegenetics.analysis.avro.GenericRecordPosition
 
get(i) - Method in class net.maizegenetics.analysis.avro.GenericRecordPosition
 
get(key) - Method in class net.maizegenetics.analysis.avro.GenericRecordTaxon
 
get(i) - Method in class net.maizegenetics.analysis.avro.GenericRecordTaxon
 
get(index) - Method in class net.maizegenetics.analysis.clustering.HaplotypeCluster
 
get(taxon, site) - Method in class net.maizegenetics.dna.snp.AbstractMaskMatrix
 
get(index) - Method in class net.maizegenetics.dna.snp.FilterList
 
get(index) - Method in class net.maizegenetics.dna.snp.genotypecall.ListStatsFilterSite
 
get(index) - Method in class net.maizegenetics.dna.snp.genotypecall.ListStatsFilterTaxa
 
get(index) - Method in class net.maizegenetics.dna.snp.genotypecall.ListStatsSite
 
get(index) - Method in class net.maizegenetics.dna.snp.genotypecall.ListStatsTaxa
 
get(taxon, site) - Method in class net.maizegenetics.dna.snp.genotypecall.MaskedGenotypes
 
get(taxon, site) - Method in interface net.maizegenetics.dna.snp.MaskMatrix
 
get(taxon, site) - Method in class net.maizegenetics.dna.snp.MaskMatrixBuilder
 
get(taxon, site) - Method in class net.maizegenetics.dna.snp.MaskSiteMatrix
 
get(taxon, site) - Method in class net.maizegenetics.dna.snp.MaskTaxaMatrix
 
get(row, col) - Method in class net.maizegenetics.matrixalgebra.Matrix.BlasDoubleMatrix
 
get(row, col) - Method in class net.maizegenetics.matrixalgebra.Matrix.ColtDoubleMatrix
 
get(row, col) - Method in interface net.maizegenetics.matrixalgebra.Matrix.DoubleMatrix
The row and column coordinates are not checked to make sure they are in the matrix
get(row, col) - Method in class net.maizegenetics.matrixalgebra.Matrix.EJMLDoubleMatrix
 
get(index) - Method in interface net.maizegenetics.util.BitSet
Returns true or false for the specified bit index.
get(index) - Method in interface net.maizegenetics.util.BitSet
Returns true or false for the specified bit index
get(index) - Method in class net.maizegenetics.util.db.DefaultDBTuple
 
get(index) - Method in class net.maizegenetics.util.OpenBitSet
Returns true or false for the specified bit index.
get(index) - Method in class net.maizegenetics.util.OpenBitSet
Returns true or false for the specified bit index
get(row, column) - Method in interface net.maizegenetics.util.SuperByteMatrix
Gets value at given row and column.
get(row, column) - Method in class net.maizegenetics.util.SuperByteMatrixMultiple
 
get(row, column) - Method in class net.maizegenetics.util.SuperByteMatrixSingle
 
get(row, column) - Method in class net.maizegenetics.util.SuperByteMatrixSingleValue
 
get(row, column) - Method in class net.maizegenetics.util.SuperByteMatrixTranspose
 
get(index) - Method in class net.maizegenetics.util.UnmodifiableBitSet
 
get(index) - Method in class net.maizegenetics.util.UnmodifiableBitSet
 
getA() - Method in class net.maizegenetics.stats.linearmodels.SweepFast
 
getActualPostions() - Method in class net.maizegenetics.analysis.chart.TableReportManhattanDataset
 
getActualSNPID() - Method in class net.maizegenetics.dna.map.GeneralPosition
 
getActualSNPID() - Method in interface net.maizegenetics.dna.map.Position
Returns SNP ID only if assigned. getSNPID() returns a default if not assigned.
getAdjacentSiteIndexRange(siteIndex, siteNum) - Method in class net.maizegenetics.analysis.gbs.SimpleGenotypeSBit
 
getAdjusted(toAdjust, adjustmentFactor) - Static method in class net.maizegenetics.stats.math.OrderEnumerator.Utils
 
getAdjusted(toAdjust, adjustmentFactor) - Static method in class net.maizegenetics.stats.math.OrthogonalHints.Utils
 
getAdjustedFactory(toAdjust, adjustmentFactor) - Static method in class net.maizegenetics.stats.math.OrderEnumerator.Utils
 
getAdjustmentMatrix() - Method in class net.maizegenetics.analysis.association.CompressedDoubleMatrix
 
getAlignerFromName(name) - Static method in enum net.maizegenetics.dna.map.TagMappingInfoV3.Aligner
 
getAlignerFromValue(value) - Static method in enum net.maizegenetics.dna.map.TagMappingInfoV3.Aligner
 
getAlignment() - Method in class net.maizegenetics.analysis.popgen.LinkageDisequilibrium
Returns an annotated aligment if one was used for this LD this could be used to access information of locus position
getAlignment() - Method in class net.maizegenetics.gui.AbstractGenotypeTableMask
 
getAlignment() - Method in interface net.maizegenetics.gui.GenotypeTableMask
 
getAlignment() - Method in class net.maizegenetics.tassel.SeqViewerPanel
 
getAlignmentRetainRareAlleles() - Static method in class net.maizegenetics.prefs.TasselPrefs
 
getAllAllelesTaxaDistForSNP() - Method in class net.maizegenetics.dna.tag.RepGenSQLite
 
getAllAllelesTaxaDistForSNP() - Method in class net.maizegenetics.dna.tag.TagDataSQLite
 
getAllAllelesTaxaDistForSNPEntries() - Method in class net.maizegenetics.dna.tag.RepGenSQLite
 
getAllAllelesTaxaDistForSNPEntries() - Method in class net.maizegenetics.dna.tag.TagDataSQLite
 
getAllAnnotationEntries() - Method in interface net.maizegenetics.util.GeneralAnnotation
 
getAllAnnotationEntries() - Method in class net.maizegenetics.util.GeneralAnnotationStorage
 
getAllColumns(row) - Method in interface net.maizegenetics.util.SuperByteMatrix
Get all values for given row.
getAllColumns(row) - Method in class net.maizegenetics.util.SuperByteMatrixMultiple
 
getAllColumns(row) - Method in class net.maizegenetics.util.SuperByteMatrixSingle
 
getAllColumns(row) - Method in class net.maizegenetics.util.SuperByteMatrixSingleValue
 
getAllColumns(row) - Method in class net.maizegenetics.util.SuperByteMatrixTranspose
 
getAllCountsForTagTissue(tag, tissue) - Method in interface net.maizegenetics.dna.tag.TagData
 
getAllCountsForTagTissue(tag, tissue) - Method in class net.maizegenetics.dna.tag.TagDataSQLite
 
getAllCountsForTaxonTissue(taxon, tissue) - Method in interface net.maizegenetics.dna.tag.TagData
 
getAllCountsForTaxonTissue(taxon, tissue) - Method in class net.maizegenetics.dna.tag.TagDataSQLite
 
getAllCountsForTissue(tissue) - Method in interface net.maizegenetics.dna.tag.TagData
 
getAllCountsForTissue(tissue) - Method in class net.maizegenetics.dna.tag.TagDataSQLite
 
getAllele(alleleType) - Method in class net.maizegenetics.dna.map.GeneralPosition
 
getAllele(alleleType) - Method in interface net.maizegenetics.dna.map.Position
Return the allele specified by alleleType, if unknown Alignment.Unknown is return
getAlleleDepthsInTaxa() - Method in class net.maizegenetics.dna.map.TagLocus
 
getAlleleMap() - Method in interface net.maizegenetics.dna.tag.RepGenData
Provides an iterator that goes through all tags with non-empty alleleMaps.
getAlleleMap() - Method in class net.maizegenetics.dna.tag.RepGenSQLite
 
getAlleleMap() - Method in interface net.maizegenetics.dna.tag.TagData
Provides an iterator that goes through all tags with non-empty alleleMaps.
getAlleleMap() - Method in class net.maizegenetics.dna.tag.TagDataSQLite
 
getAlleleProbabilityInstance(numTaxa, numSites, taxaList) - Static method in class net.maizegenetics.dna.snp.score.AlleleProbabilityBuilder
 
getAlleles(data, site) - Static method in class net.maizegenetics.dna.snp.GenotypeTableUtils
 
getAlleles(data, site) - Static method in class net.maizegenetics.dna.snp.GenotypeTableUtils
 
getAlleles(tag) - Method in interface net.maizegenetics.dna.tag.RepGenData
Provides all SNP allele calls associated with a given tag.
getAlleles(tag) - Method in class net.maizegenetics.dna.tag.RepGenSQLite
 
getAlleles(tag) - Method in interface net.maizegenetics.dna.tag.TagData
Provides all SNP allele calls associated with a given tag.
getAlleles(tag) - Method in class net.maizegenetics.dna.tag.TagDataSQLite
 
getAllelesAtSite(site) - Method in class net.maizegenetics.analysis.clustering.HaplotypeCluster
 
getAllelesSortedByFrequency(site) - Method in class net.maizegenetics.dna.snp.genotypecall.AlleleFreqCache
 
getAllelesSortedByFrequency(data) - Static method in class net.maizegenetics.dna.snp.GenotypeTableUtils
This sorts alleles by frequency. Each cell in the given array contains a diploid value which is separated and counted individually. Resulting double dimension array holds alleles (bytes) in result[0]. And the counts are in result[1]. Counts haploid values twice and diploid values once. Higher ploids are not supported.
getAllelesSortedByFrequency(data, site) - Static method in class net.maizegenetics.dna.snp.GenotypeTableUtils
This sorts alleles in a given site by frequency. Each cell in the given array contains a diploid value which is separated and counted individually. Resulting double dimension array holds alleles (bytes) in result[0]. And the counts are in result[1]. Counts haploid values twice and diploid values once. Higher ploids are not supported.
getAllelesSortedByFrequency(data, site) - Static method in class net.maizegenetics.dna.snp.GenotypeTableUtils
 
getAllelesSortedByFrequency(alignment, site) - Static method in class net.maizegenetics.dna.snp.GenotypeTableUtils
 
getAllelesTagTaxaDistForSNP(position) - Method in interface net.maizegenetics.dna.tag.RepGenData
For a given snp position, Returns a Map of Allele with its associated Tag/TaxaDistribution
getAllelesTagTaxaDistForSNP(position) - Method in class net.maizegenetics.dna.tag.RepGenSQLite
 
getAllelesTagTaxaDistForSNP(position) - Method in interface net.maizegenetics.dna.tag.TagData
For a given snp position, Returns a Map of Allele with its associated Tag/TaxaDistribution
getAllelesTagTaxaDistForSNP(position) - Method in class net.maizegenetics.dna.tag.TagDataSQLite
 
getAlleleStates(data, maxNumAlleles) - Static method in class net.maizegenetics.dna.snp.GenotypeTableUtils
 
getAllelesTaxaDistForSNP(position) - Method in class net.maizegenetics.dna.tag.TagDataSQLite
 
getAllNonRefTagAlignments(minscore) - Method in interface net.maizegenetics.dna.tag.RepGenData
Map of all non-ref tags and their alignments This method calls getTagAlignmentsForTags(). All tag-tag alignments are return
getAllNonRefTagAlignments(minscore) - Method in class net.maizegenetics.dna.tag.RepGenSQLite
 
getAllRefTagAlignments(minscore) - Method in interface net.maizegenetics.dna.tag.RepGenData
Map of all alignments for reference tags This returns reftag to reftag alignments.
getAllRefTagAlignments(minscore) - Method in class net.maizegenetics.dna.tag.RepGenSQLite
 
getAllRows(column) - Method in interface net.maizegenetics.util.SuperByteMatrix
Get all values for give column.
getAllRows(column) - Method in class net.maizegenetics.util.SuperByteMatrixMultiple
 
getAllRows(column) - Method in class net.maizegenetics.util.SuperByteMatrixSingle
 
getAllRows(column) - Method in class net.maizegenetics.util.SuperByteMatrixSingleValue
 
getAllRows(column) - Method in class net.maizegenetics.util.SuperByteMatrixTranspose
 
getAllTagsTaxaMap() - Method in interface net.maizegenetics.dna.tag.RepGenData
Return all tag/taxadistribution stored in database. Returns a Hashmap of tag.taxadistributions
getAllTagsTaxaMap() - Method in class net.maizegenetics.dna.tag.RepGenSQLite
 
getAllTagsTaxaMap() - Method in interface net.maizegenetics.dna.tag.TagData
Return all tag/taxadistribution stored in database. Returns a Hashmap of tag.taxadistributions
getAllTagsTaxaMap() - Method in class net.maizegenetics.dna.tag.TagDataSQLite
 
getAllTaxa(group1, group2) - Static method in class net.maizegenetics.taxa.TaxaListUtils
Union joins the specified taxa.
getAllTaxa(groups) - Static method in class net.maizegenetics.taxa.TaxaListUtils
 
getAllTaxa(lists, sorted) - Static method in class net.maizegenetics.taxa.TaxaListUtils
Union joins the specified taxa.
getAllTaxaNames(reader) - Static method in class net.maizegenetics.util.HDF5Utils
 
getAllTissue() - Method in interface net.maizegenetics.dna.tag.TagData
Return the set of tissue
getAllTissue() - Method in class net.maizegenetics.dna.tag.TagDataSQLite
 
getAllTraits() - Method in class net.maizegenetics.dna.pd.FolderParser
 
getAlternateTagMappingInfo(index, mapIndex) - Method in class net.maizegenetics.dna.map.TagsOnPhysMapHDF5
 
getAlternating(primary, secondary) - Static method in class net.maizegenetics.stats.math.OrderEnumerator.Utils
 
getAlternatingFactory(primary, secondary) - Static method in class net.maizegenetics.stats.math.OrderEnumerator.Utils
 
getAltsForRef(ref) - Static method in class net.maizegenetics.analysis.gobii.GOBII_IFLUtils
 
getAltsFromLine(mline, ref, isVCF, tabPos) - Static method in class net.maizegenetics.analysis.gobii.GOBII_IFLUtils
 
getAncestor() - Method in class net.maizegenetics.analysis.gbs.neobio.Factor
Returns this factor's ancestor factor.
getAncestorSerialNumber() - Method in class net.maizegenetics.analysis.gbs.neobio.Factor
This method is a shorthand to return the serial number of this factor's ancestor. Note that it does not check if this factor has an ancestor or not, therefore, if it is called on the root factor, a NullPointerException is raised.
getAndClear(index) - Method in interface net.maizegenetics.util.BitSet
Clears a bit and returns the previous value. The index should be less than the BitSet size.
getAndClear(index) - Method in class net.maizegenetics.util.OpenBitSet
 
getAndClear(index) - Method in class net.maizegenetics.util.UnmodifiableBitSet
 
getAndSet(index) - Method in interface net.maizegenetics.util.BitSet
Sets a bit and returns the previous value. The index should be less than the BitSet size.
getAndSet(index) - Method in interface net.maizegenetics.util.BitSet
Sets a bit and returns the previous value. The index should be less than the BitSet size.
getAndSet(index) - Method in class net.maizegenetics.util.OpenBitSet
Sets a bit and returns the previous value. The index should be less than the OpenBitSet size.
getAndSet(index) - Method in class net.maizegenetics.util.OpenBitSet
Sets a bit and returns the previous value. The index should be less than the OpenBitSet size.
getAndSet(index) - Method in class net.maizegenetics.util.UnmodifiableBitSet
 
getAndSet(index) - Method in class net.maizegenetics.util.UnmodifiableBitSet
 
getAnnotation() - Method in class net.maizegenetics.dna.map.Chromosome
 
getAnnotation() - Method in class net.maizegenetics.dna.map.GeneralPosition
 
getAnnotation(key) - Method in class net.maizegenetics.dna.map.GenomeFeature
Get any annotation based on its key. If this feature lacks that annotation, it returns 'NA'
getAnnotation() - Method in interface net.maizegenetics.dna.map.Position
 
getAnnotation() - Method in class net.maizegenetics.taxa.Taxon
 
getAnnotationAsMap() - Method in interface net.maizegenetics.util.GeneralAnnotation
 
getAnnotationAsMap() - Method in class net.maizegenetics.util.GeneralAnnotationStorage
 
getAnnotationKeys() - Method in interface net.maizegenetics.util.GeneralAnnotation
Returns all keys
getAnnotationKeys() - Method in class net.maizegenetics.util.GeneralAnnotationStorage
 
getAnnotationTypes() - Method in class net.maizegenetics.dna.pd.SiteAnnotation
Obtain complete listing of all annotations types available. Examples: Minor Allele Frequency
getAnnotationValue(annotationType) - Method in class net.maizegenetics.dna.pd.SiteAnnotation
 
getAnovaReport() - Method in class net.maizegenetics.analysis.modelfitter.StepwiseAdditiveModelFitter
 
getAnovaReport() - Method in class net.maizegenetics.analysis.modelfitter.StepwiseOLSModelFitter
 
getAnovaReportWithCI() - Method in class net.maizegenetics.analysis.modelfitter.StepwiseAdditiveModelFitter
 
getAnovaReportWithCI() - Method in class net.maizegenetics.analysis.modelfitter.StepwiseOLSModelFitter
 
getAttribute(name) - Method in interface net.maizegenetics.taxa.tree.AttributeNode
 
getAttribute(name) - Method in class net.maizegenetics.taxa.tree.SimpleNode
 
getAttribute(node, name) - Method in class net.maizegenetics.taxa.tree.SimpleTree
 
getAttribute(node, name) - Method in interface net.maizegenetics.taxa.tree.Tree
 
getAttributeNames() - Method in interface net.maizegenetics.taxa.tree.AttributeNode
 
getAttributeNames() - Method in class net.maizegenetics.taxa.tree.SimpleNode
 
getAttributesStr(delimiter) - Method in class net.maizegenetics.dna.map.TagGWASMapInfo
 
getAverageAnnotation(annoName) - Method in interface net.maizegenetics.util.GeneralAnnotation
Returns average annotation for a given annotation key
getAverageAnnotation(annoName) - Method in class net.maizegenetics.util.GeneralAnnotationStorage
 
getBackwardRead() - Method in class net.maizegenetics.dna.read.PERead
Return backward read
getBarCodeCount() - Method in class net.maizegenetics.analysis.gbs.ParseBarcodeRead
Returns the number of barcodes for the flowcell and lane
getBarcodeString() - Method in class net.maizegenetics.analysis.gbs.Barcode
 
getBarLength() - Method in class net.maizegenetics.analysis.gbs.Barcode
 
getBarWithOverHangLength() - Method in class net.maizegenetics.analysis.gbs.Barcode
 
getBarWOverHang() - Method in class net.maizegenetics.analysis.gbs.Barcode
 
getBarWOverHangLong() - Method in class net.maizegenetics.analysis.gbs.Barcode
 
getBaseGenotypeTable() - Method in class net.maizegenetics.dna.snp.genotypecall.ProjectionGenotypeCallTable
Returns the high density base genotypeTable of the projection genotypeTable.
getBaseline(c, width, height) - Method in class net.maizegenetics.gui.VerticalLabelUI
 
getBaselineResizeBehavior(c) - Method in class net.maizegenetics.gui.VerticalLabelUI
 
getBaseModel() - Method in class net.maizegenetics.analysis.modelfitter.AbstractForwardRegression
 
getBasename(str) - Static method in class net.maizegenetics.util.Utils
Returns the base name of a string delimited with periods (i.e. Java Class).
getBaseQuality(index, phredScale) - Method in class net.maizegenetics.dna.read.Read
Return quality value of base
getBestMapIndex(tagIndex) - Method in class net.maizegenetics.dna.map.TagsOnPhysicalMapV3
 
getBeta() - Method in class net.maizegenetics.stats.EMMA.EMMAforDoubleMatrix
 
getBeta() - Method in class net.maizegenetics.stats.linearmodels.SweepFast
 
getBeta() - Method in class net.maizegenetics.stats.linearmodels.SweepFastLinearModel
 
getBeta() - Method in class net.maizegenetics.stats.linearmodels.SweepFastNestedModel
 
getBiasAlternating(primary, secondary) - Static method in class net.maizegenetics.stats.math.OrderEnumerator.Utils
 
getBiasAlternatingFactory(primary, secondary) - Static method in class net.maizegenetics.stats.math.OrderEnumerator.Utils
 
getBins() - Method in class net.maizegenetics.analysis.chart.ChartDisplayPlugin
 
getBit(index) - Method in interface net.maizegenetics.util.BitSet
Returns 1 if the bit is set, 0 if not. The index should be less than the BitSet size
getBit(index) - Method in class net.maizegenetics.util.OpenBitSet
returns 1 if the bit is set, 0 if not. The index should be less than the OpenBitSet size
getBit(index) - Method in class net.maizegenetics.util.UnmodifiableBitSet
 
getBits() - Method in interface net.maizegenetics.util.BitSet
Expert: returns the long[] storing the bits
getBits(startWord, endWord) - Method in interface net.maizegenetics.util.BitSet
Expert: returns the long[] storing the bits from start to end
getBits(index) - Method in interface net.maizegenetics.util.BitSet
Expert: returns 64 bits at index.
getBits() - Method in class net.maizegenetics.util.OpenBitSet
Expert: returns the long[] storing the bits
getBits(index) - Method in class net.maizegenetics.util.OpenBitSet
 
getBits(startWord, endWord) - Method in class net.maizegenetics.util.OpenBitSet
 
getBits() - Method in class net.maizegenetics.util.UnmodifiableBitSet
 
getBits(startWord, endWord) - Method in class net.maizegenetics.util.UnmodifiableBitSet
 
getBits(index) - Method in class net.maizegenetics.util.UnmodifiableBitSet
 
getBitSet() - Method in class net.maizegenetics.gui.SelectFromAvailableDialog.SelectedListModel
 
getBlockChr() - Method in class net.maizegenetics.analysis.gbs.TagBlockPosition
 
getBlockChr(index) - Method in class net.maizegenetics.analysis.gbs.TagBlockPosition
 
getBlockIndex(tagIndex) - Method in class net.maizegenetics.dna.tag.AbstractTagsHDF5
Returns the block index based on the tag index in a full list
getBlockNum() - Method in class net.maizegenetics.dna.tag.AbstractTagsHDF5
Returns the number of block
getBlockPos() - Method in class net.maizegenetics.analysis.gbs.TagBlockPosition
 
getBlockPos(index) - Method in class net.maizegenetics.analysis.gbs.TagBlockPosition
 
getBlockSize() - Method in class net.maizegenetics.dna.tag.AbstractTagsHDF5
Returns the size of HDF5 block
getBlockWithMinMinorCount(mjT, mnT, focusBlock, minMinorCnt, minMajorCnt) - Static method in class net.maizegenetics.analysis.imputation.FILLINImputationUtils
Given a start 64 site block, it expands to the left and right until it hits the minimum Minor Site count or MajorSiteCount in the target taxon
getBlues(effect, restricted) - Method in class net.maizegenetics.stats.linearmodels.SweepFastLinearModel
 
getBlup() - Method in class net.maizegenetics.stats.EMMA.EMMAforDoubleMatrix
 
getBlups() - Method in class net.maizegenetics.analysis.association.RegRidgeEmmaDoubleMatrix
 
getBMSDB() - Static method in class net.maizegenetics.prefs.TasselPrefs
 
getBMSHost() - Static method in class net.maizegenetics.prefs.TasselPrefs
 
getBMSUser() - Static method in class net.maizegenetics.prefs.TasselPrefs
 
getBoolean(key) - Method in class net.maizegenetics.util.ArgsEngine
Gets the option.
getBooleanPref(path, key, def) - Static method in class net.maizegenetics.prefs.TasselPrefs
 
getBottomPanel() - Method in class net.maizegenetics.gui.SelectFromAvailableDialog
 
getBottomPanel() - Method in class net.maizegenetics.gui.SelectFromAvailableSitesDialog
 
getBoxcoxAttributesStr(lamdas, delimiter) - Method in class net.maizegenetics.dna.map.TagGWASMapInfo
 
getBranchLength() - Method in interface net.maizegenetics.taxa.tree.Node
Get the length of the branch attaching this node to its parent.
getBranchLength() - Method in class net.maizegenetics.taxa.tree.SimpleNode
Get the length of the branch attaching this node to its parent.
getBranchLengthSE() - Method in interface net.maizegenetics.taxa.tree.Node
Get the length SE of the branch attaching this node to its parent.
getBranchLengthSE() - Method in class net.maizegenetics.taxa.tree.SimpleNode
Get the length SE of the branch attaching this node to its parent.
getBufferedOutputStream(filename) - Static method in class net.maizegenetics.util.Utils
 
getBufferedReader(inSourceName) - Static method in class net.maizegenetics.util.Utils
 
getBufferedReader(inSourceName, bufSize) - Static method in class net.maizegenetics.util.Utils
 
getBufferedReader(file, bufSize) - Static method in class net.maizegenetics.util.Utils
 
getBufferedWriter(filename) - Static method in class net.maizegenetics.util.Utils
 
getBufferedWriter(filename, append) - Static method in class net.maizegenetics.util.Utils
 
getBufferedWriter(file) - Static method in class net.maizegenetics.util.Utils
 
getBufferedWriter(file, append) - Static method in class net.maizegenetics.util.Utils
 
getBuilder(tagSet) - Static method in class net.maizegenetics.analysis.rna.FindMatchByWordHash
 
getBuilder(existingHDF5File) - Static method in class net.maizegenetics.dna.snp.GenotypeTableBuilder
Returns a builder to an existing, unfinished HDF5 genotypes file. Can be used if you want to add/modify annotations, etc, and/or call build() to finalize it
getBuilder(hapmapFile) - Static method in class net.maizegenetics.dna.snp.io.BuilderFromHapMap
 
getBuilder(hapmapFile, listener) - Static method in class net.maizegenetics.dna.snp.io.BuilderFromHapMap
 
getBuilder(pedfile, mapfile, listener) - Static method in class net.maizegenetics.dna.snp.io.BuilderFromPLINK
 
getBuilder(infile) - Static method in class net.maizegenetics.dna.snp.io.BuilderFromVCF
Create a builder for loading a VCF file into memory
getBuilder(infile, listener) - Static method in class net.maizegenetics.dna.snp.io.BuilderFromVCF
Create a builder for loading a VCF file into memory
getBuilder() - Static method in class net.maizegenetics.util.GeneralAnnotationStorage
 
getButtonName() - Method in class net.maizegenetics.analysis.association.EqtlAssociationPlugin
 
getButtonName() - Method in class net.maizegenetics.analysis.association.FastMultithreadedAssociationPlugin
 
getButtonName() - Method in class net.maizegenetics.analysis.association.FixedEffectLMPlugin
 
getButtonName() - Method in class net.maizegenetics.analysis.association.GenomicSelectionPlugin
 
getButtonName() - Method in class net.maizegenetics.analysis.association.MLMPlugin
 
getButtonName() - Method in class net.maizegenetics.analysis.association.RidgeRegressionEmmaPlugin
 
getButtonName() - Method in class net.maizegenetics.analysis.association.WeightedMLMPlugin
 
getButtonName() - Method in class net.maizegenetics.analysis.b4r.GetPhenotypeFromB4RPlugin
 
getButtonName() - Method in class net.maizegenetics.analysis.chart.ChartDisplayPlugin
Button name for this plugin to be used in buttons, etc.
getButtonName() - Method in class net.maizegenetics.analysis.chart.ManhattanDisplayPlugin
Button name for this plugin to be used in buttons, etc.
getButtonName() - Method in class net.maizegenetics.analysis.chart.QQDisplayPlugin
Button name for this plugin to be used in buttons, etc.
getButtonName() - Method in class net.maizegenetics.analysis.chart.TableDisplayPlugin
Button name for this plugin to be used in buttons, etc.
getButtonName() - Method in class net.maizegenetics.analysis.data.AddReferenceAlleleToHDF5Plugin
 
getButtonName() - Method in class net.maizegenetics.analysis.data.AddReferenceToGenotypePlugin
 
getButtonName() - Method in class net.maizegenetics.analysis.data.AdjustPhasingPlugin
 
getButtonName() - Method in class net.maizegenetics.analysis.data.BuildUnfinishedHDF5GenotypesPlugin
 
getButtonName() - Method in class net.maizegenetics.analysis.data.CombineDataSetsPlugin
 
getButtonName() - Method in class net.maizegenetics.analysis.data.ConvertAlignmentCoordinatesPlugin
 
getButtonName() - Method in class net.maizegenetics.analysis.data.CountAssociationsPlugin
 
getButtonName() - Method in class net.maizegenetics.analysis.data.CreateHybridGenotypesPlugin
 
getButtonName() - Method in class net.maizegenetics.analysis.data.ExportMultiplePlugin
Button name for this plugin to be used in buttons, etc.
getButtonName() - Method in class net.maizegenetics.analysis.data.ExportPlugin
Button name for this plugin to be used in buttons, etc.
getButtonName() - Method in class net.maizegenetics.analysis.data.ExtractHapmapSubsetPlugin
 
getButtonName() - Method in class net.maizegenetics.analysis.data.FeatureListToPositionsPlugin
 
getButtonName() - Method in class net.maizegenetics.analysis.data.FileLoadPlugin
Button name for this plugin to be used in buttons, etc.
getButtonName() - Method in class net.maizegenetics.analysis.data.FindInversionsPlugin
 
getButtonName() - Method in class net.maizegenetics.analysis.data.GenomeAnnosDBQueryToPositionListPlugin
 
getButtonName() - Method in class net.maizegenetics.analysis.data.GenosToABHPlugin
 
getButtonName() - Method in class net.maizegenetics.analysis.data.GenotypeSummaryPlugin
 
getButtonName() - Method in class net.maizegenetics.analysis.data.GenotypeToAdditiveValuesPlugin
 
getButtonName() - Method in class net.maizegenetics.analysis.data.GetPositionListPlugin
 
getButtonName() - Method in class net.maizegenetics.analysis.data.GetTaxaListPlugin
 
getButtonName() - Method in class net.maizegenetics.analysis.data.HDF5SummaryPlugin
 
getButtonName() - Method in class net.maizegenetics.analysis.data.HetsToUnknownPlugin
 
getButtonName() - Method in class net.maizegenetics.analysis.data.IdentityRecognitionPlugin
 
getButtonName() - Method in class net.maizegenetics.analysis.data.IndelsToUnknownPlugin
 
getButtonName() - Method in class net.maizegenetics.analysis.data.IntersectionAlignmentPlugin
Button name for this plugin to be used in buttons, etc.
getButtonName() - Method in class net.maizegenetics.analysis.data.KmerCountingPlugin
 
getButtonName() - Method in class net.maizegenetics.analysis.data.LIXPlugin
 
getButtonName() - Method in class net.maizegenetics.analysis.data.MaskGenotypePlugin
 
getButtonName() - Method in class net.maizegenetics.analysis.data.MeanR2FromLDPlugin
 
getButtonName() - Method in class net.maizegenetics.analysis.data.MemoryUsagePlugin
 
getButtonName() - Method in class net.maizegenetics.analysis.data.MergeAlignmentsSameSitesPlugin
 
getButtonName() - Method in class net.maizegenetics.analysis.data.MergeGenotypeTablesPlugin
 
getButtonName() - Method in class net.maizegenetics.analysis.data.MergeGenotypeTablesPluginV2
 
getButtonName() - Method in class net.maizegenetics.analysis.data.MergeHDF5GenotypesSameSitesPlugin
 
getButtonName() - Method in class net.maizegenetics.analysis.data.MergeRenameDeleteTaxaPlugin
 
getButtonName() - Method in class net.maizegenetics.analysis.data.PassThroughPlugin
 
getButtonName() - Method in class net.maizegenetics.analysis.data.PlinkLoadPlugin
Button name for this plugin to be used in buttons, etc.
getButtonName() - Method in class net.maizegenetics.analysis.data.PrincipalComponentsPlugin
 
getButtonName() - Method in class net.maizegenetics.analysis.data.ProjectionLoadPlugin
Button name for this plugin to be used in buttons, etc.
getButtonName() - Method in class net.maizegenetics.analysis.data.ProjectPcsAndRunModelSelectionPlugin
Button name for this plugin to be used in buttons, etc.
getButtonName() - Method in class net.maizegenetics.analysis.data.SeparatePlugin
Button name for this plugin to be used in buttons, etc.
getButtonName() - Method in class net.maizegenetics.analysis.data.SetLowDepthGenosToMissingPlugin
 
getButtonName() - Method in class net.maizegenetics.analysis.data.SortGenotypeFilePlugin
 
getButtonName() - Method in class net.maizegenetics.analysis.data.SortTaxaAlphabeticallyPlugin
 
getButtonName() - Method in class net.maizegenetics.analysis.data.SplitHDF5ByChromosomePlugin
 
getButtonName() - Method in class net.maizegenetics.analysis.data.SubtractGenotypesPlugin
 
getButtonName() - Method in class net.maizegenetics.analysis.data.SynonymizerPlugin
Button name for this plugin to be used in buttons, etc.
getButtonName() - Method in class net.maizegenetics.analysis.data.ThinSitesByPositionPlugin
 
getButtonName() - Method in class net.maizegenetics.analysis.data.UnionAlignmentPlugin
Button name for this plugin to be used in buttons, etc.
getButtonName() - Method in class net.maizegenetics.analysis.distance.AddDistanceMatrixPlugin
 
getButtonName() - Method in class net.maizegenetics.analysis.distance.AMatrixPlugin
 
getButtonName() - Method in class net.maizegenetics.analysis.distance.DistanceMatrixPlugin
Button name for this plugin to be used in buttons, etc.
getButtonName() - Method in class net.maizegenetics.analysis.distance.DistanceMatrixRangesPlugin
Button name for this plugin to be used in buttons, etc.
getButtonName() - Method in class net.maizegenetics.analysis.distance.HMatrixPlugin
 
getButtonName() - Method in class net.maizegenetics.analysis.distance.KinshipPlugin
 
getButtonName() - Method in class net.maizegenetics.analysis.distance.MultiDimensionalScalingPlugin
 
getButtonName() - Method in class net.maizegenetics.analysis.distance.RemoveNaNFromDistanceMatrixPlugin
 
getButtonName() - Method in class net.maizegenetics.analysis.distance.SubtractDistanceMatrixPlugin
 
getButtonName() - Method in class net.maizegenetics.analysis.distance.VCAPScanPlugin
 
getButtonName() - Method in class net.maizegenetics.analysis.filter.FilterAlignmentPlugin
Button name for this plugin to be used in buttons, etc.
getButtonName() - Method in class net.maizegenetics.analysis.filter.FilterDataSetPlugin
 
getButtonName() - Method in class net.maizegenetics.analysis.filter.FilterSiteBuilderPlugin
 
getButtonName() - Method in class net.maizegenetics.analysis.filter.FilterSiteNamePlugin
Deprecated.
Button name for this plugin to be used in buttons, etc.
getButtonName() - Method in class net.maizegenetics.analysis.filter.FilterSubsetPlugin
Button name for this plugin to be used in buttons, etc.
getButtonName() - Method in class net.maizegenetics.analysis.filter.FilterTaxaBuilderPlugin
 
getButtonName() - Method in class net.maizegenetics.analysis.filter.FilterTaxaPropertiesPlugin
Button name for this plugin to be used in buttons, etc.
getButtonName() - Method in class net.maizegenetics.analysis.filter.FilterTraitsPlugin
 
getButtonName() - Method in class net.maizegenetics.analysis.gbs.AnnotateTOPMwSAMPlugin
 
getButtonName() - Method in class net.maizegenetics.analysis.gbs.BinaryToTextPlugin
 
getButtonName() - Method in class net.maizegenetics.analysis.gbs.CompareGenosBetweenHapMapFilesPlugin
 
getButtonName() - Method in class net.maizegenetics.analysis.gbs.ContigPETagCountPlugin
 
getButtonName() - Method in class net.maizegenetics.analysis.gbs.DiscoverySNPCallerPlugin
 
getButtonName() - Method in class net.maizegenetics.analysis.gbs.FastqToPETagCountPlugin
 
getButtonName() - Method in class net.maizegenetics.analysis.gbs.FastqToTagCountPlugin
 
getButtonName() - Method in class net.maizegenetics.analysis.gbs.FastqToTBTPlugin
 
getButtonName() - Method in class net.maizegenetics.analysis.gbs.KeepSpecifiedReadsinFastqPlugin
 
getButtonName() - Method in class net.maizegenetics.analysis.gbs.KeepSpecifiedSitesInTOPMPlugin
 
getButtonName() - Method in class net.maizegenetics.analysis.gbs.KmerToTagCountPlugin
 
getButtonName() - Method in class net.maizegenetics.analysis.gbs.KmerToTBTPlugin
 
getButtonName() - Method in class net.maizegenetics.analysis.gbs.MergeDuplicateSNPsPlugin
 
getButtonName() - Method in class net.maizegenetics.analysis.gbs.MergeMultipleTagCountPlugin
 
getButtonName() - Method in class net.maizegenetics.analysis.gbs.MergeMultipleTOPMPlugin
 
getButtonName() - Method in class net.maizegenetics.analysis.gbs.MergePETagCountPlugin
 
getButtonName() - Method in class net.maizegenetics.analysis.gbs.MergeTagsByTaxaFilesByRowPlugin
 
getButtonName() - Method in class net.maizegenetics.analysis.gbs.MergeTagsByTaxaFilesPlugin
 
getButtonName() - Method in class net.maizegenetics.analysis.gbs.ModifyTBTHDF5Plugin
 
getButtonName() - Method in class net.maizegenetics.analysis.gbs.pana.PanAAddPosToTagMapPlugin
 
getButtonName() - Method in class net.maizegenetics.analysis.gbs.pana.PanABuildPivotTBTPlugin
 
getButtonName() - Method in class net.maizegenetics.analysis.gbs.pana.PanABuildTagBlockPosPlugin
 
getButtonName() - Method in class net.maizegenetics.analysis.gbs.pana.PanABuildTagGWASMapPlugin
 
getButtonName() - Method in class net.maizegenetics.analysis.gbs.pana.PanABuildTrainingSetPlugin
 
getButtonName() - Method in class net.maizegenetics.analysis.gbs.pana.PanAFilteringTagMapPlugin
 
getButtonName() - Method in class net.maizegenetics.analysis.gbs.pana.PanAH5ToAnchorPlugin
 
getButtonName() - Method in class net.maizegenetics.analysis.gbs.pana.PanAMergeMappingResultPlugin
 
getButtonName() - Method in class net.maizegenetics.analysis.gbs.pana.PanAModelTrainingPlugin
 
getButtonName() - Method in class net.maizegenetics.analysis.gbs.pana.PanAPredictionPlugin
 
getButtonName() - Method in class net.maizegenetics.analysis.gbs.pana.PanAReadDigestPlugin
 
getButtonName() - Method in class net.maizegenetics.analysis.gbs.pana.PanAReadToKmerPlugin
 
getButtonName() - Method in class net.maizegenetics.analysis.gbs.pana.PanASamToMultiPositionTOPMPlugin
 
getButtonName() - Method in class net.maizegenetics.analysis.gbs.pana.PanASplitTagBlockPosPlugin
 
getButtonName() - Method in class net.maizegenetics.analysis.gbs.pana.PanASplitTBTPlugin
 
getButtonName() - Method in class net.maizegenetics.analysis.gbs.pana.PanATagGWASMappingPlugin
 
getButtonName() - Method in class net.maizegenetics.analysis.gbs.pana.PanATagMapToFastaPlugin
 
getButtonName() - Method in class net.maizegenetics.analysis.gbs.ProductionPipeline
 
getButtonName() - Method in class net.maizegenetics.analysis.gbs.ProductionSNPCallerPlugin
 
getButtonName() - Method in class net.maizegenetics.analysis.gbs.QseqToPETagCountPlugin
 
getButtonName() - Method in class net.maizegenetics.analysis.gbs.QseqToTagCountPlugin
 
getButtonName() - Method in class net.maizegenetics.analysis.gbs.QseqToTBTPlugin
 
getButtonName() - Method in class net.maizegenetics.analysis.gbs.repgen.RampSeqAlignFromBlastTags
 
getButtonName() - Method in class net.maizegenetics.analysis.gbs.repgen.RepGenAlignerPlugin
 
getButtonName() - Method in class net.maizegenetics.analysis.gbs.repgen.RepGenLDAnalysisPlugin
 
getButtonName() - Method in class net.maizegenetics.analysis.gbs.repgen.RepGenLoadSeqToDBPlugin
 
getButtonName() - Method in class net.maizegenetics.analysis.gbs.repgen.RepGenPhase2AlignerPlugin
 
getButtonName() - Method in class net.maizegenetics.analysis.gbs.repgen.RGBSProductionSNPCallerPlugin
 
getButtonName() - Method in class net.maizegenetics.analysis.gbs.SAMConverterPlugin
 
getButtonName() - Method in class net.maizegenetics.analysis.gbs.SAMWGMapConverterPlugin
 
getButtonName() - Method in class net.maizegenetics.analysis.gbs.SeqToTBTHDF5Plugin
 
getButtonName() - Method in class net.maizegenetics.analysis.gbs.TagAgainstAnchorPlugin
 
getButtonName() - Method in class net.maizegenetics.analysis.gbs.TagCountToFastqPlugin
 
getButtonName() - Method in class net.maizegenetics.analysis.gbs.TextToBinaryPlugin
 
getButtonName() - Method in class net.maizegenetics.analysis.gbs.TOPMSummaryPlugin
 
getButtonName() - Method in class net.maizegenetics.analysis.gbs.UTagCountToTagPairPlugin
 
getButtonName() - Method in class net.maizegenetics.analysis.gbs.UTagPairToTOPMPlugin
 
getButtonName() - Method in class net.maizegenetics.analysis.gbs.v2.DiscoverySNPCallerPluginV2
 
getButtonName() - Method in class net.maizegenetics.analysis.gbs.v2.GBSSeqToTagDBPlugin
 
getButtonName() - Method in class net.maizegenetics.analysis.gbs.v2.GetTagSequenceFromDBPlugin
 
getButtonName() - Method in class net.maizegenetics.analysis.gbs.v2.GetTagTaxaDistFromDBPlugin
 
getButtonName() - Method in class net.maizegenetics.analysis.gbs.v2.ProductionSNPCallerPluginV2
 
getButtonName() - Method in class net.maizegenetics.analysis.gbs.v2.SAMToGBSdbPlugin
 
getButtonName() - Method in class net.maizegenetics.analysis.gbs.v2.SNPCutPosTagVerificationPlugin
 
getButtonName() - Method in class net.maizegenetics.analysis.gbs.v2.SNPQualityProfilerPlugin
 
getButtonName() - Method in class net.maizegenetics.analysis.gbs.v2.TagExportToFastqPlugin
 
getButtonName() - Method in class net.maizegenetics.analysis.gbs.v2.UpdateSNPPositionQualityPlugin
 
getButtonName() - Method in class net.maizegenetics.analysis.gobii.GOBIIPlugin
 
getButtonName() - Method in class net.maizegenetics.analysis.gobii.GWAS_IFLPlugin
 
getButtonName() - Method in class net.maizegenetics.analysis.gobii.HapBreakpoints_IFLFilePlugin
 
getButtonName() - Method in class net.maizegenetics.analysis.gobii.MarkerDNARun_IFLFilePlugin
 
getButtonName() - Method in class net.maizegenetics.analysis.gobii.MonetDB_IFLFilePlugin
 
getButtonName() - Method in class net.maizegenetics.analysis.gobii.PreProcessGOBIIMappingFilePlugin
 
getButtonName() - Method in class net.maizegenetics.analysis.gobii.SplitFile_IFLFilePlugin
 
getButtonName() - Method in class net.maizegenetics.analysis.imputation.CallParentAllelesPlugin
 
getButtonName() - Method in class net.maizegenetics.analysis.imputation.ClusterGenotypesPlugin
 
getButtonName() - Method in class net.maizegenetics.analysis.imputation.FILLINFindHaplotypesPlugin
 
getButtonName() - Method in class net.maizegenetics.analysis.imputation.FILLINImputationPlugin
 
getButtonName() - Method in class net.maizegenetics.analysis.imputation.FindMergeHaplotypesPlugin
 
getButtonName() - Method in class net.maizegenetics.analysis.imputation.FSFHapImputationPlugin
 
getButtonName() - Method in class net.maizegenetics.analysis.imputation.ImputationAccuracyPlugin
 
getButtonName() - Method in class net.maizegenetics.analysis.imputation.ImputeProgenyStatesPlugin
 
getButtonName() - Method in class net.maizegenetics.analysis.imputation.LDKNNiImputationHetV2Plugin
 
getButtonName() - Method in class net.maizegenetics.analysis.imputation.LDKNNiImputationHetV3Plugin
 
getButtonName() - Method in class net.maizegenetics.analysis.imputation.LDKNNiImputationPlugin
 
getButtonName() - Method in class net.maizegenetics.analysis.imputation.MergeBreakpointFilesPlugin
 
getButtonName() - Method in class net.maizegenetics.analysis.imputation.ParentPhasingPlugin
 
getButtonName() - Method in class net.maizegenetics.analysis.imputation.RandomGenotypeImputationPlugin
 
getButtonName() - Method in class net.maizegenetics.analysis.imputation.ReImputeUpdatedTaxaByFILLINPlugin
 
getButtonName() - Method in class net.maizegenetics.analysis.imputation.RemoveIndelsForBeaglePlugin
 
getButtonName() - Method in class net.maizegenetics.analysis.imputation.ViterbiAlgorithmPlugin
 
getButtonName() - Method in class net.maizegenetics.analysis.imputation.WritePopulationAlignmentPlugin
 
getButtonName() - Method in class net.maizegenetics.analysis.ListPluginParameters
 
getButtonName() - Method in class net.maizegenetics.analysis.ListPlugins
 
getButtonName() - Method in class net.maizegenetics.analysis.modelfitter.AdditiveSiteStorePlugin
 
getButtonName() - Method in class net.maizegenetics.analysis.modelfitter.ResamplingGWASPlugin
 
getButtonName() - Method in class net.maizegenetics.analysis.modelfitter.StepwiseAdditiveModelFitterPlugin
 
getButtonName() - Method in class net.maizegenetics.analysis.modelfitter.StepwiseOLSModelFitterPlugin
 
getButtonName() - Method in class net.maizegenetics.analysis.monetdb.ColumnsToBinaryFullGenomeTablePlugin
 
getButtonName() - Method in class net.maizegenetics.analysis.monetdb.ColumnsToBinarySNPOnlyTablePlugin
 
getButtonName() - Method in class net.maizegenetics.analysis.numericaltransform.AvgPhenotypeByTaxaPlugin
 
getButtonName() - Method in class net.maizegenetics.analysis.numericaltransform.BoxCoxTransformationPlugin
 
getButtonName() - Method in class net.maizegenetics.analysis.numericaltransform.ImputationPlugin
 
getButtonName() - Method in class net.maizegenetics.analysis.numericaltransform.NumericalGenotypePlugin
 
getButtonName() - Method in class net.maizegenetics.analysis.numericaltransform.SubtractPhenotypeByTaxaPlugin
 
getButtonName() - Method in class net.maizegenetics.analysis.numericaltransform.TransformDataPlugin
 
getButtonName() - Method in class net.maizegenetics.analysis.popgen.LinkageDiseqDisplayPlugin
Button name for this plugin to be used in buttons, etc.
getButtonName() - Method in class net.maizegenetics.analysis.popgen.LinkageDisequilibriumPlugin
Button name for this plugin to be used in buttons, etc.
getButtonName() - Method in class net.maizegenetics.analysis.popgen.SequenceDiversityPlugin
 
getButtonName() - Method in class net.maizegenetics.analysis.rna.LoadRNAContigsToGBSDBPlugin
 
getButtonName() - Method in class net.maizegenetics.analysis.rna.RNADeMultiplexProductionPlugin
 
getButtonName() - Method in class net.maizegenetics.analysis.rna.RNADeMultiPlexSeqToDBPlugin
 
getButtonName() - Method in class net.maizegenetics.analysis.tree.ArchaeopteryxPlugin
 
getButtonName() - Method in class net.maizegenetics.analysis.tree.ConvertTreeNamesPlugin
 
getButtonName() - Method in class net.maizegenetics.analysis.tree.CreateTreePlugin
Button name for this plugin to be used in buttons, etc.
getButtonName() - Method in class net.maizegenetics.analysis.tree.MergeTreesPlugin
 
getButtonName() - Method in class net.maizegenetics.analysis.tree.RemoveBranchLengthsPlugin
 
getButtonName() - Method in class net.maizegenetics.analysis.tree.SubsetTreePlugin
 
getButtonName() - Method in class net.maizegenetics.analysis.workflow.WorkflowPlugin
 
getButtonName() - Method in interface net.maizegenetics.plugindef.Plugin
Button name for this plugin to be used in buttons, etc.
getButtonName() - Method in class net.maizegenetics.tassel.PreferencesDialog
 
getButtonName() - Method in class net.maizegenetics.tassel.ShowParameterCachePlugin
 
getButtonName() - Method in class net.maizegenetics.tassel.TasselLogging
 
getButtonName() - Method in class net.maizegenetics.util.ConvertOldFastqToModernFormatPlugin
 
getByteSeqFromLong(val) - Static method in class net.maizegenetics.dna.BaseEncoder
Returns the byte class NucleotideAlignmentConstants representation used by TASSEL for the 2-bit encoded long.
getByteSeqFromLong(valA) - Static method in class net.maizegenetics.dna.BaseEncoder
Returns the byte class NucleotideAlignmentConstants representation used by TASSEL for the 2-bit encoded long.
getCacheKey(taxon, site) - Static method in class net.maizegenetics.analysis.avro.AvroConstants
 
getCacheKey(taxon, site) - Static method in class net.maizegenetics.dna.snp.genotypecall.GOBIIAvroGenotypeCallTable
 
getCallAtVariableSiteForTag(site, tagIndex) - Method in class net.maizegenetics.dna.map.TagLocus
 
getCancelButton() - Method in class net.maizegenetics.gui.SelectFromAvailableDialog
 
getCar() - Method in class net.maizegenetics.util.db.Pair
 
getCdr() - Method in class net.maizegenetics.util.db.Pair
 
getCellRenderingType() - Method in class net.maizegenetics.tassel.SeqViewerPanel
 
getCensoredMajorityHaplotype(maxMinorFreq, maxMinorCount) - Method in class net.maizegenetics.analysis.clustering.HaplotypeCluster
This returns the majority haplotype for sites with either minor allele frequency below maxMinorFreq or minor allele count less than or equal to maxMinorCount. Missing is returned at sites not meeting the stated criteria.
getChart() - Method in class net.maizegenetics.analysis.chart.BasicChartPanel
 
getChartMode() - Method in class net.maizegenetics.analysis.chart.ChartDisplayPlugin
 
getChecked(row, col) - Method in class net.maizegenetics.matrixalgebra.Matrix.BlasDoubleMatrix
 
getChecked(row, col) - Method in class net.maizegenetics.matrixalgebra.Matrix.ColtDoubleMatrix
 
getChecked(row, col) - Method in interface net.maizegenetics.matrixalgebra.Matrix.DoubleMatrix
The row and column coordinates are checked to make sure they fall in the matrix. If not an error is generated.
getChecked(row, col) - Method in class net.maizegenetics.matrixalgebra.Matrix.EJMLDoubleMatrix
 
getChecksum(filename, protocol) - Static method in class net.maizegenetics.util.CheckSum
Allows user to specify the protocol, e.g. MD5, SHA-1, SHA-256
getChecksumForString(str, protocol) - Static method in class net.maizegenetics.util.CheckSum
Allows user to specify the protocol, e.g. MD5, SHA-1, SHA-256
getChild(n) - Method in interface net.maizegenetics.taxa.tree.Node
get child node
getChild(n) - Method in class net.maizegenetics.taxa.tree.SimpleNode
get child node
getChildCount() - Method in interface net.maizegenetics.taxa.tree.Node
Returns the number of children this node has.
getChildCount() - Method in class net.maizegenetics.taxa.tree.SimpleNode
Returns the number of children this node has.
getChr() - Method in class net.maizegenetics.analysis.data.MeanR2FromLDPlugin.AccumulateR2
 
getChr(index) - Method in class net.maizegenetics.analysis.gbs.SimpleGenotypeSBit
 
getChr(tagIndex, mappingIndex) - Method in class net.maizegenetics.dna.map.PETagsOnPhysicalMapV3
Return chromosome of a mapping
getChrB(index) - Method in class net.maizegenetics.dna.map.AbstractPETagsOnPhysicalMap
 
getChrContig(index) - Method in class net.maizegenetics.dna.map.AbstractPETagsOnPhysicalMap
 
getChrF(index) - Method in class net.maizegenetics.dna.map.AbstractPETagsOnPhysicalMap
 
getChrIndex(chr) - Method in class net.maizegenetics.analysis.gbs.SimpleGenotypeSBit
 
getChromFromLine(mline, isVCF, tabPos) - Static method in class net.maizegenetics.analysis.gobii.GOBII_IFLUtils
 
getChromosome(index) - Method in class net.maizegenetics.dna.map.AbstractTagsOnPhysicalMap
 
getChromosome() - Method in class net.maizegenetics.dna.map.DonorHaplotypes
 
getChromosome() - Method in class net.maizegenetics.dna.map.GeneralPosition
 
getChromosome() - Method in interface net.maizegenetics.dna.map.Position
Return the locus (generally a chromosome) of a site
getChromosome() - Method in class net.maizegenetics.dna.map.TagLocus
 
getChromosome(index) - Method in interface net.maizegenetics.dna.map.TOPMInterface
Returns chromosome at give tag index.
getChromosomeIndex(intChrName) - Method in class net.maizegenetics.dna.map.AbstractTagsOnPhysicalMap
 
getChromosomeIndex(intChrName) - Method in interface net.maizegenetics.dna.map.TOPMInterface
Finds the index in the myChromosomes[] (length = # of chromosomes) corresponding to the provided int version of the chromosome name
getChromosomeNumber(siteIndex) - Method in class net.maizegenetics.analysis.gbs.SimpleGenotypeSBit
 
getChromosomeNumber() - Method in class net.maizegenetics.dna.map.Chromosome
Returns the integer value of the chromosome (if name is not a number then Integer.MAX_VALUE is returned)
getChromosomes() - Method in class net.maizegenetics.dna.map.AbstractTagsOnPhysicalMap
 
getChromosomes() - Method in interface net.maizegenetics.dna.map.TOPMInterface
Returns an array whose values are the distinct chromosomes in this file, as stored in the chromosome[] array. The indices are arbitrary.
getChromosomesFromCutPositions() - Method in interface net.maizegenetics.dna.tag.RepGenData
Return all chromosomes stored in database. Returns a list of distinct chromsome objects from the cutPosition table
getChromosomesFromCutPositions() - Method in class net.maizegenetics.dna.tag.RepGenSQLite
 
getChromosomesFromCutPositions() - Method in interface net.maizegenetics.dna.tag.TagData
Return all chromosomes stored in database. Returns a list of distinct chromsome objects from the cutPosition table
getChromosomesFromCutPositions() - Method in class net.maizegenetics.dna.tag.TagDataSQLite
 
getChroms() - Method in class net.maizegenetics.analysis.chart.TableReportManhattanDataset
 
getChrPosMap() - Method in interface net.maizegenetics.dna.map.GVCFGenomeSequence
 
getChunkNum() - Method in class net.maizegenetics.analysis.gbs.SimpleGenotypeSBit
Return the total number of chunks
getChunkNum(chunkSize) - Method in class net.maizegenetics.analysis.gbs.TagAgainstAnchor
Return the number of chunks at current chunkSize
getChunkNum(tbtHDF5, chunkSize) - Static method in class net.maizegenetics.analysis.gbs.TagAgainstAnchor
Pre-calculate number of chunks when qsub genetic mapping
getChunkNum(tbtHDF5, chunkSize) - Static method in class net.maizegenetics.analysis.gbs.TagAgainstAnchorHypothesis
Pre-calculate number of chunks when qsub genetic mapping
getChunkNum() - Method in class net.maizegenetics.dna.map.TagsOnPhysicalMapV3
Return the total number of chunks
getChunkSize() - Method in class net.maizegenetics.analysis.gbs.SimpleGenotypeSBit
Return the chunk size (Number of tags in gt chunk)
getChunkSize() - Method in class net.maizegenetics.dna.map.TagsOnPhysicalMapV3
Return the chunk size (Number of tags in a chunk)
getCitation() - Method in class net.maizegenetics.analysis.association.EqtlAssociationPlugin
 
getCitation() - Method in class net.maizegenetics.analysis.association.GenomicSelectionPlugin
 
getCitation() - Method in class net.maizegenetics.analysis.association.WeightedMLMPlugin
 
getCitation() - Method in class net.maizegenetics.analysis.b4r.GetPhenotypeFromB4RPlugin
 
getCitation() - Method in class net.maizegenetics.analysis.data.FindInversionsPlugin
 
getCitation() - Method in class net.maizegenetics.analysis.data.GenosToABHPlugin
 
getCitation() - Method in class net.maizegenetics.analysis.data.SetLowDepthGenosToMissingPlugin
 
getCitation() - Method in class net.maizegenetics.analysis.data.ThinSitesByPositionPlugin
 
getCitation() - Method in class net.maizegenetics.analysis.distance.AMatrixPlugin
 
getCitation() - Method in class net.maizegenetics.analysis.distance.HMatrixPlugin
 
getCitation() - Method in class net.maizegenetics.analysis.gbs.UTagCountToTagPairPlugin
 
getCitation() - Method in class net.maizegenetics.analysis.imputation.FILLINFindHaplotypesPlugin
 
getCitation() - Method in class net.maizegenetics.analysis.imputation.FILLINImputationPlugin
 
getCitation() - Method in class net.maizegenetics.analysis.imputation.FSFHapImputationPlugin
 
getCitation() - Method in class net.maizegenetics.analysis.imputation.LDKNNiImputationHetV2Plugin
 
getCitation() - Method in class net.maizegenetics.analysis.imputation.LDKNNiImputationHetV3Plugin
 
getCitation() - Method in class net.maizegenetics.analysis.imputation.LDKNNiImputationPlugin
 
getCitation() - Method in class net.maizegenetics.analysis.modelfitter.StepwiseOLSModelFitterPlugin
 
getCitation() - Method in class net.maizegenetics.analysis.numericaltransform.AvgPhenotypeByTaxaPlugin
 
getCitation() - Method in class net.maizegenetics.analysis.numericaltransform.BoxCoxTransformationPlugin
 
getCitation() - Method in class net.maizegenetics.analysis.numericaltransform.SubtractPhenotypeByTaxaPlugin
 
getCitation() - Method in class net.maizegenetics.analysis.workflow.WorkflowPlugin
 
getCitation() - Method in class net.maizegenetics.plugindef.AbstractPlugin
 
getCitation() - Method in interface net.maizegenetics.plugindef.Plugin
Returns Citation for this plugin.
getClade(i) - Method in class net.maizegenetics.taxa.tree.CladeSystem
get clade
getClade(idGroup, internalNode, clade) - Static method in class net.maizegenetics.taxa.tree.CladeSystem
get clade for internal node
getClade(root, clade) - Static method in class net.maizegenetics.taxa.tree.RootedTreeUtils
 
getCladeArray() - Method in class net.maizegenetics.taxa.tree.CladeSystem
get clade array
getCladeCount() - Method in class net.maizegenetics.taxa.tree.CladeSystem
get number of clades
getClades(idGroup, tree) - Static method in class net.maizegenetics.taxa.tree.CladeSystem
creates a clade system from a tree (using a pre-specified order of sequences)
getClades(tree) - Static method in class net.maizegenetics.taxa.tree.CladeSystem
creates a clade system from a tree (using tree-induced order of sequences)
getCladeSystems(trees) - Static method in class net.maizegenetics.taxa.tree.CladeSystem
 
getClickedOK() - Method in class net.maizegenetics.analysis.filter.FilterTraitsDialog
 
getClonedDistances() - Method in class net.maizegenetics.taxa.distance.DistanceMatrix
Returns the distances as a 2-dimensional array of doubles. Matrix is cloned first so it can be altered freely.
getClosedRangesAsPositions(bedfile) - Static method in class net.maizegenetics.dna.snp.io.ReadBedfile
Function that returns the 1-based closed Position ranges from a BED file as a RangeSet of Positions. NOTE: getRanges(bedFile) will be called which will shift the start in the BED file up by 1. Because of this the ranges returned will be 1-based Closed(Inclusive-Inclusive). This is NOT returning ranges in BED specification(0-based Inclusive-Exclusive).
getClosestIndex(fromIndex, exclusion) - Method in class net.maizegenetics.taxa.distance.DistanceMatrix
 
getClusterList() - Method in class net.maizegenetics.analysis.clustering.HaplotypeClusterer
 
getClusterReport() - Method in class net.maizegenetics.analysis.imputation.BiparentalHaplotypeFinder
 
getClusters(rbt) - Method in class net.maizegenetics.analysis.gbs.Clusters
 
getClusters(tbt) - Method in class net.maizegenetics.analysis.gbs.Clusters
 
getClusterScores() - Method in class net.maizegenetics.analysis.clustering.HaplotypeClusterer
After the initial cluster formation a Haplotype score equals the 1 / (number of clusters to which it belongs). Merging does not update the cluster score.
getClusterSizes() - Method in class net.maizegenetics.analysis.clustering.HaplotypeClusterer
 
getCmFromPosition(chromosome, position) - Method in class net.maizegenetics.analysis.imputation.AGPMap
 
getCode() - Method in enum net.maizegenetics.analysis.gbs.AnnotateTOPM.EvidenceType
 
getCollapsedPETagCounts() - Method in class net.maizegenetics.dna.tag.PETagCounts
Collapse the PETagCounts and return a new collapsed PETagCounts object
getColor() - Method in class net.maizegenetics.gui.AbstractGenotypeTableMask
 
getColor() - Method in interface net.maizegenetics.gui.GenotypeTableMask
 
getColStart() - Method in class net.maizegenetics.analysis.gbs.neobio.PairwiseAlignment
Returns the matrix column position where the paired alignment starts
getColumnClass(columnIndex) - Method in class net.maizegenetics.gui.TableReportNoPagingTableModel
 
getColumnCount() - Method in class net.maizegenetics.analysis.popgen.DiversityAnalyses
 
getColumnCount() - Method in class net.maizegenetics.analysis.popgen.LinkageDisequilibrium
 
getColumnCount() - Method in class net.maizegenetics.dna.map.PositionListTableReport
 
getColumnCount() - Method in class net.maizegenetics.dna.map.TOPMTableReport
 
getColumnCount() - Method in class net.maizegenetics.dna.snp.FilterTableReport
 
getColumnCount() - Method in class net.maizegenetics.gui.AlignmentTableModel
 
getColumnCount() - Method in class net.maizegenetics.gui.TableReportNoPagingTableModel
 
getColumnCount() - Method in class net.maizegenetics.phenotype.CorePhenotype
 
getColumnCount() - Method in class net.maizegenetics.phenotype.FilterPhenotype
 
getColumnCount() - Method in class net.maizegenetics.phenotype.GenotypePhenotype
 
getColumnCount() - Method in class net.maizegenetics.taxa.distance.DistanceMatrix
 
getColumnCount() - Method in class net.maizegenetics.taxa.IdentifierSynonymizer
 
getColumnCount() - Method in class net.maizegenetics.taxa.TaxaListTableReport
 
getColumnCount() - Method in class net.maizegenetics.util.HDF5TableReport
 
getColumnCount() - Method in class net.maizegenetics.util.SimpleTableReport
 
getColumnCount() - Method in interface net.maizegenetics.util.TableReport
Get the number of the columns
getColumnName(col) - Method in class net.maizegenetics.gui.AlignmentTableModel
 
getColumnName(col) - Method in class net.maizegenetics.gui.TableReportNoPagingTableModel
 
getColumnName(col) - Method in class net.maizegenetics.taxa.distance.DistanceMatrix
 
getColumnNameType() - Method in class net.maizegenetics.gui.AlignmentTableModel
 
getColumnObject(columnIndex) - Method in class net.maizegenetics.gui.TableReportNoPagingTableModel
 
getColumnRange(row, start, end) - Method in interface net.maizegenetics.util.SuperByteMatrix
Get values for given row from start column (inclusive) to end column (exclusive).
getColumnRange(row, start, end) - Method in class net.maizegenetics.util.SuperByteMatrixMultiple
 
getColumnRange(row, start, end) - Method in class net.maizegenetics.util.SuperByteMatrixSingle
 
getColumnRange(row, start, end) - Method in class net.maizegenetics.util.SuperByteMatrixSingleValue
 
getColumnRange(row, start, end) - Method in class net.maizegenetics.util.SuperByteMatrixTranspose
 
getColumnWidth() - Method in class net.maizegenetics.gui.AlignmentTableModel
 
getCombined(first, numberOfFirstParameters, second, numberOfSecondParameters) - Static method in class net.maizegenetics.stats.math.OrthogonalHints.Utils
 
getComment() - Method in class net.maizegenetics.plugindef.Datum
 
getCommonAlleles() - Method in class net.maizegenetics.dna.map.TagLocus
 
getCommonTaxa(group1, group2) - Static method in class net.maizegenetics.taxa.TaxaListUtils
Intersect joins the specified taxa.
getCommonTaxa(groups) - Static method in class net.maizegenetics.taxa.TaxaListUtils
Intersect joins the specified taxa.
getCommonTaxa(groups, sorted) - Static method in class net.maizegenetics.taxa.TaxaListUtils
Intersect joins the specified taxa.
getCompatibleTypes() - Method in class net.maizegenetics.phenotype.CategoricalAttribute
 
getCompatibleTypes() - Method in class net.maizegenetics.phenotype.NumericAttribute
 
getCompatibleTypes() - Method in interface net.maizegenetics.phenotype.PhenotypeAttribute
 
getCompatibleTypes() - Method in class net.maizegenetics.phenotype.TaxaAttribute
 
getComplementBase(base) - Static method in class net.maizegenetics.dna.BaseEncoder
Returns reverse complement for a sequence.
getCompressedMatrix(km) - Method in class net.maizegenetics.analysis.association.CompressedDoubleMatrix
 
getCompressedZ(originalZ) - Method in class net.maizegenetics.analysis.association.CompressedDoubleMatrix
 
getCompressedZKZ(Z, km) - Method in class net.maizegenetics.analysis.association.CompressedDoubleMatrix
 
getConcatenatedName(theTDS) - Method in class net.maizegenetics.analysis.data.UnionAlignmentPlugin
 
getConcatenatedTextAnnotations() - Method in interface net.maizegenetics.util.GeneralAnnotation
 
getConcatenatedTextAnnotations() - Method in class net.maizegenetics.util.GeneralAnnotationStorage
 
getConfigFile() - Static method in class net.maizegenetics.prefs.TasselPrefs
 
getConsecutiveRegions() - Method in interface net.maizegenetics.dna.map.GVCFGenomeSequence
 
getConstant(index) - Static method in class net.maizegenetics.stats.math.OrderEnumerator.Utils
 
getConstantFactory(index) - Static method in class net.maizegenetics.stats.math.OrderEnumerator.Utils
 
getContig(index) - Method in class net.maizegenetics.dna.tag.AbstractPETags
 
getContig(index) - Method in interface net.maizegenetics.dna.tag.PETags
Return the contig of PE tag
getContigCount() - Method in class net.maizegenetics.dna.tag.AbstractPETags
 
getContigCount() - Method in interface net.maizegenetics.dna.tag.PETags
Return total number of PE contigs
getContigLength(index) - Method in class net.maizegenetics.dna.tag.AbstractPETags
 
getContigLength(index) - Method in interface net.maizegenetics.dna.tag.PETags
Return the length of a contig
getContigLengthInLong(index) - Method in class net.maizegenetics.dna.tag.AbstractPETags
 
getContigLengthInLong(index) - Method in interface net.maizegenetics.dna.tag.PETags
Return the contig length in Long primitive data type
getCopy() - Method in class net.maizegenetics.analysis.modelfitter.AddPlusDomModelEffect
 
getCopy() - Method in class net.maizegenetics.stats.linearmodels.CovariateModelEffect
 
getCopy() - Method in class net.maizegenetics.stats.linearmodels.FactorModelEffect
 
getCopy() - Method in interface net.maizegenetics.stats.linearmodels.ModelEffect
 
getCopy() - Method in class net.maizegenetics.stats.linearmodels.NestedCovariateModelEffect
 
getCopy() - Method in class net.maizegenetics.taxa.tree.SimpleTree
 
getCopy() - Method in interface net.maizegenetics.taxa.tree.Tree
 
getCorrelationsForTags(tags) - Method in interface net.maizegenetics.dna.tag.RepGenData
Grab correlations for specified tags
getCorrelationsForTags(tags) - Method in class net.maizegenetics.dna.tag.RepGenSQLite
 
getCount(x, y) - Method in class net.maizegenetics.taxa.distance.DistanceMatrixWithCounts
 
getCountOfHaplotypesNotInThisCluster(cluster) - Method in class net.maizegenetics.analysis.clustering.HaplotypeCluster
Counts the number of Haplotypes in cluster that are not also in this cluster
getCovariate() - Method in interface net.maizegenetics.analysis.modelfitter.AdditiveSite
 
getCovariate(subset) - Method in interface net.maizegenetics.analysis.modelfitter.AdditiveSite
 
getCovariate() - Method in class net.maizegenetics.analysis.modelfitter.GenotypeAdditiveSite
 
getCovariate(subset) - Method in class net.maizegenetics.analysis.modelfitter.GenotypeAdditiveSite
 
getCovariate() - Method in class net.maizegenetics.analysis.modelfitter.RefProbAdditiveSite
 
getCovariate(subset) - Method in class net.maizegenetics.analysis.modelfitter.RefProbAdditiveSite
 
getCovariate() - Method in class net.maizegenetics.stats.linearmodels.CovariateModelEffect
 
getCovariateNoReindex() - Method in class net.maizegenetics.analysis.modelfitter.GenotypeAdditiveSite
 
getCovariateNoReindex(subset) - Method in class net.maizegenetics.analysis.modelfitter.GenotypeAdditiveSite
 
getCovariateWithReindex() - Method in class net.maizegenetics.analysis.modelfitter.GenotypeAdditiveSite
 
getCovariateWithReindex(subset) - Method in class net.maizegenetics.analysis.modelfitter.GenotypeAdditiveSite
 
getCreator() - Method in class net.maizegenetics.plugindef.DataSet
 
getCumlativeP(a, b, c, d) - Method in class net.maizegenetics.stats.statistics.FisherExact
Calculates the one-tail P-value for the Fisher Exact test. Determines whether to calculate the right- or left- tail, thereby always returning the smallest p-value.
getCurrentBlockIndex() - Method in class net.maizegenetics.dna.tag.AbstractTagsHDF5
Returns current block index
getCurrentIndex() - Method in class net.maizegenetics.dna.tag.AbstractTagsHDF5
Returns current index
getCurrentIndexWithinBlock() - Method in class net.maizegenetics.dna.tag.AbstractTagsHDF5
Returns current index relative to current block
getCurrentSize() - Method in class net.maizegenetics.dna.tag.TagCountMutable
 
getCustomCompression() - Method in class net.maizegenetics.analysis.association.MLMPlugin
 
getCustomCompression() - Method in class net.maizegenetics.analysis.association.WeightedMLMPlugin
 
getCutPosForStrandTagTaxaMap(chromosome, firstPosition, lastPosition, strand) - Method in interface net.maizegenetics.dna.tag.RepGenData
For a given snp position, Returns a Map of Allele with its associated Tag/TaxaDistribution Differs from getCutPositionTagTaxaMap() in that it now specifies on which strand the returned tags must appear.
getCutPosForStrandTagTaxaMap(chromosome, firstPosition, lastPosition, direction) - Method in class net.maizegenetics.dna.tag.RepGenSQLite
 
getCutPosForStrandTagTaxaMap(chromosome, firstPosition, lastPosition, strand) - Method in interface net.maizegenetics.dna.tag.TagData
For a given snp position, Returns a Map of Allele with its associated Tag/TaxaDistribution Differs from getCutPositionTagTaxaMap() in that it now specifies on which strand the returned tags must appear.
getCutPosForStrandTagTaxaMap(chromosome, firstPosition, lastPosition, direction) - Method in class net.maizegenetics.dna.tag.TagDataSQLite
 
getCutPositionTagTaxaMap(chromosome, firstPosition, lastPosition) - Method in interface net.maizegenetics.dna.tag.RepGenData
Map of positions and with associated map of Tags and their taxa distribution and their alignment direction. Warning: This can be a very large data structure for entire chromosomes. Only the best positions are returned.
getCutPositionTagTaxaMap(chromosome, firstPosition, lastPosition) - Method in class net.maizegenetics.dna.tag.RepGenSQLite
 
getCutPositionTagTaxaMap(chromosome, firstPosition, lastPosition) - Method in interface net.maizegenetics.dna.tag.TagData
Map of positions and with associated map of Tags and their taxa distribution and their alignment direction. Warning: This can be a very large data structure for entire chromosomes. Only the best positions are returned.
getCutPositionTagTaxaMap(chromosome, firstPosition, lastPosition) - Method in class net.maizegenetics.dna.tag.TagDataSQLite
 
getDARwinFilenames(base) - Static method in class net.maizegenetics.taxa.distance.DistanceMatrixUtils
Get DARwin file names.
getData() - Method in class net.maizegenetics.analysis.gbs.neobio.Trie
Returns the data associated with this node.
getData(i) - Method in class net.maizegenetics.plugindef.DataSet
 
getData() - Method in class net.maizegenetics.plugindef.Datum
 
getDataList() - Method in class net.maizegenetics.tassel.DataTreePanel
 
getDataOfType(theClass) - Method in class net.maizegenetics.plugindef.DataSet
 
getDataOfType(classes) - Method in class net.maizegenetics.plugindef.DataSet
 
getDataOfTypeWithName(classes, names) - Method in class net.maizegenetics.plugindef.DataSet
 
getDataOutputStream(filename, bufSize) - Static method in class net.maizegenetics.util.Utils
 
getDataSet(list, creator) - Static method in class net.maizegenetics.plugindef.DataSet
Combines multiple data sets.
getDataSet(data) - Static method in class net.maizegenetics.plugindef.DataSet
 
getDataSet() - Method in class net.maizegenetics.plugindef.DataSet
 
getDataSource() - Static method in class net.maizegenetics.util.db.LambdaTuplesContext
 
getDataTreePanel() - Method in class net.maizegenetics.tassel.TASSELMainFrame
 
getDataType() - Method in class net.maizegenetics.plugindef.Datum
 
getDataWithName(name) - Method in class net.maizegenetics.plugindef.DataSet
 
getDataWithName(names) - Method in class net.maizegenetics.plugindef.DataSet
 
getDcoP(index) - Method in class net.maizegenetics.dna.map.TagsOnPhysicalMap
 
getDcoP(tagIndex) - Method in class net.maizegenetics.dna.map.TagsOnPhysicalMapV3
 
getDcoP(index) - Method in class net.maizegenetics.dna.map.TagsOnPhysMapHDF5
 
getDcoP(index) - Method in interface net.maizegenetics.dna.map.TOPMInterface
Round(Log2(P))
getDecimalString(number, width) - Method in class net.maizegenetics.util.FormattedOutput
Returns a decimal string representation of a number with constrained width.
getDefaultRendering(table, value, isSelected, hasFocus, row, col) - Method in class net.maizegenetics.gui.AlignmentTableCellRenderer
 
getDefaultValue(n) - Method in class net.maizegenetics.taxa.tree.MultiParameterized
 
getDefaultValue(n) - Method in interface net.maizegenetics.taxa.tree.Parameterized
get default value of parameter
getDefaultValue(n) - Method in class net.maizegenetics.taxa.tree.Parameterized.Null
 
getDefaultValue(n) - Method in class net.maizegenetics.taxa.tree.Parameterized.ParameterizedBase
 
getDefaultValue(n) - Method in class net.maizegenetics.taxa.tree.Parameterized.ParameterizedUser
 
getDelimiter() - Method in class net.maizegenetics.analysis.chart.TableDisplayPlugin
 
getDelta() - Method in class net.maizegenetics.stats.EMMA.EMMAforDoubleMatrix
 
getDepthMasksRendering(table, value, isSelected, hasFocus, row, col) - Method in class net.maizegenetics.gui.AlignmentTableCellRenderer
 
getDepthMatrixForEncodedDepths(input) - Static method in class net.maizegenetics.dna.tag.TaxaDistBuilder
 
getDescription() - Method in class net.maizegenetics.dna.read.Read
Return description of read
getDescription() - Method in class net.maizegenetics.util.BasicFileFilter
 
getDesiredIndices() - Method in class net.maizegenetics.gui.SelectFromAvailableDialog
 
getDfError() - Method in class net.maizegenetics.stats.EMMA.EMMAforDoubleMatrix
 
getDfMarker() - Method in class net.maizegenetics.stats.EMMA.EMMAforDoubleMatrix
 
getDfModel() - Method in class net.maizegenetics.stats.EMMA.EMMAforDoubleMatrix
 
getDiagonalMatrix(diag) - Static method in class net.maizegenetics.matrixalgebra.Matrix.BlasDoubleMatrix
 
getDiagonalPrefix(block) - Method in class net.maizegenetics.analysis.gbs.neobio.CrochemoreLandauZivUkelson
This method is a shorthand to retrieve the diagonal prefix of a block from the block table.
getDimensionOfA() - Method in class net.maizegenetics.stats.linearmodels.SweepFast
 
getDiploidsSortedByFrequency(alignment, site) - Static method in class net.maizegenetics.dna.snp.GenotypeTableUtils
 
getDiploidValue(a, b) - Static method in class net.maizegenetics.dna.snp.GenotypeTableUtils
Combines two allele values into one diploid value. Assumed phased.
getDiploidValuePhased(a, b) - Static method in class net.maizegenetics.dna.snp.GenotypeTableUtils
Combines two allele values into one diploid value. Assumed phased.
getDiploidValues(genotype) - Static method in class net.maizegenetics.dna.snp.GenotypeTableUtils
Separates diploid allele value into it's two values.
getDirectory(str) - Static method in class net.maizegenetics.util.Utils
Returns just the directory with the filename removed.
getDistance(hap0, hap1) - Static method in class net.maizegenetics.analysis.clustering.Haplotype
 
getDistance(hap0, hap1) - Static method in class net.maizegenetics.analysis.clustering.Haplotype
 
getDistance(row, col) - Method in class net.maizegenetics.taxa.distance.DistanceMatrix
 
getDistanceMatrix(alignment) - Static method in class net.maizegenetics.analysis.distance.DistanceMatrixPlugin
 
getDistanceMatrix(alignment, listener) - Static method in class net.maizegenetics.analysis.distance.DistanceMatrixPlugin
 
getDistances() - Method in class net.maizegenetics.taxa.distance.DistanceMatrix
Returns the distances as a 2-dimensional array of doubles (in the actual array used to store the distances)
getDistanceToRoot(node) - Static method in class net.maizegenetics.taxa.tree.NodeUtils
determine distance to root
getDivergence(tagIndex, mappingIndex) - Method in class net.maizegenetics.dna.map.PETagsOnPhysicalMapV3
Return divergence of a mapping
getDivergence(index) - Method in class net.maizegenetics.dna.map.TagsOnPhysicalMap
 
getDivergence(tagIndex) - Method in class net.maizegenetics.dna.map.TagsOnPhysicalMapV3
Blast doesn't have divergence, so it always return Byte.MIN_VALUE of Blast hits
getDivergence(index) - Method in class net.maizegenetics.dna.map.TagsOnPhysMapHDF5
 
getDivergence(index) - Method in interface net.maizegenetics.dna.map.TOPMInterface
Returns Divergence
getDivergenceOfTag(tagIndex) - Method in class net.maizegenetics.dna.map.TagLocus
 
getDnasampleName() - Method in class net.maizegenetics.analysis.gobii.MarkerDNARun_IFLFilePlugin.HmpTaxaData
 
getDomainBounds(includeInterval) - Method in class net.maizegenetics.analysis.chart.TableReportManhattanDataset
 
getDomainLowerBound(includeInterval) - Method in class net.maizegenetics.analysis.chart.TableReportManhattanDataset
 
getDomainUpperBound(includeInterval) - Method in class net.maizegenetics.analysis.chart.TableReportManhattanDataset
 
getDonorHaplotypes(taxon) - Method in class net.maizegenetics.dna.snp.genotypecall.ProjectionGenotypeCallTable
 
getDoublePref(path, key, def) - Static method in class net.maizegenetics.prefs.TasselPrefs
 
getDPrime(r, c) - Method in class net.maizegenetics.analysis.popgen.LinkageDisequilibrium
Returns D' estimate for a given pair of numSites
getEffectSize() - Method in class net.maizegenetics.analysis.modelfitter.AddPlusDomModelEffect
 
getEffectSize() - Method in class net.maizegenetics.stats.linearmodels.CovariateModelEffect
 
getEffectSize() - Method in class net.maizegenetics.stats.linearmodels.FactorModelEffect
 
getEffectSize() - Method in interface net.maizegenetics.stats.linearmodels.ModelEffect
 
getEffectSize() - Method in class net.maizegenetics.stats.linearmodels.NestedCovariateModelEffect
 
getEigenvalue(i) - Method in class net.maizegenetics.matrixalgebra.decomposition.BlasEigenvalueDecomposition
 
getEigenvalue(i) - Method in class net.maizegenetics.matrixalgebra.decomposition.ColtEigenvalueDecomposition
 
getEigenvalue(i) - Method in interface net.maizegenetics.matrixalgebra.decomposition.EigenvalueDecomposition
 
getEigenvalue(i) - Method in class net.maizegenetics.matrixalgebra.decomposition.EJMLEigenvalueDecomposition
 
getEigenvalue(i) - Method in class net.maizegenetics.matrixalgebra.decomposition.SymmetricEigenvalueDecomposition
 
getEigenvalue(index) - Method in class net.maizegenetics.stats.PCA.ClassicMds
 
getEigenvalueDecomposition() - Method in class net.maizegenetics.matrixalgebra.Matrix.BlasDoubleMatrix
 
getEigenvalueDecomposition() - Method in class net.maizegenetics.matrixalgebra.Matrix.ColtDoubleMatrix
 
getEigenvalueDecomposition() - Method in interface net.maizegenetics.matrixalgebra.Matrix.DoubleMatrix
 
getEigenvalueDecomposition() - Method in class net.maizegenetics.matrixalgebra.Matrix.EJMLDoubleMatrix
 
getEigenvalueMatrix() - Method in class net.maizegenetics.matrixalgebra.decomposition.BlasEigenvalueDecomposition
 
getEigenvalueMatrix() - Method in class net.maizegenetics.matrixalgebra.decomposition.ColtEigenvalueDecomposition
 
getEigenvalueMatrix() - Method in interface net.maizegenetics.matrixalgebra.decomposition.EigenvalueDecomposition
 
getEigenvalueMatrix() - Method in class net.maizegenetics.matrixalgebra.decomposition.EJMLEigenvalueDecomposition
 
getEigenvalueMatrix() - Method in class net.maizegenetics.matrixalgebra.decomposition.SymmetricEigenvalueDecomposition
 
getEigenvalueMatrix() - Method in class net.maizegenetics.stats.PCA.PrinComp
 
getEigenvalues() - Method in class net.maizegenetics.matrixalgebra.decomposition.BlasEigenvalueDecomposition
 
getEigenvalues() - Method in class net.maizegenetics.matrixalgebra.decomposition.ColtEigenvalueDecomposition
 
getEigenvalues() - Method in interface net.maizegenetics.matrixalgebra.decomposition.EigenvalueDecomposition
 
getEigenvalues() - Method in class net.maizegenetics.matrixalgebra.decomposition.EJMLEigenvalueDecomposition
 
getEigenvalues() - Method in class net.maizegenetics.matrixalgebra.decomposition.SymmetricEigenvalueDecomposition
 
getEigenValues() - Method in class net.maizegenetics.stats.PCA.PrinComp
 
getEigenValuesAsColumnVector() - Method in class net.maizegenetics.stats.PCA.PrinComp
 
getEigenvectors() - Method in class net.maizegenetics.matrixalgebra.decomposition.BlasEigenvalueDecomposition
 
getEigenvectors() - Method in class net.maizegenetics.matrixalgebra.decomposition.ColtEigenvalueDecomposition
 
getEigenvectors() - Method in interface net.maizegenetics.matrixalgebra.decomposition.EigenvalueDecomposition
 
getEigenvectors() - Method in class net.maizegenetics.matrixalgebra.decomposition.EJMLEigenvalueDecomposition
 
getEigenvectors() - Method in class net.maizegenetics.matrixalgebra.decomposition.SymmetricEigenvalueDecomposition
 
getEigenVectors() - Method in class net.maizegenetics.stats.PCA.PrinComp
 
getEigenvectorsAs1dArray() - Method in class net.maizegenetics.matrixalgebra.decomposition.SymmetricEigenvalueDecomposition
 
getElementAt(index) - Method in class net.maizegenetics.gui.AbstractAvailableListModel
 
getElementAt(index) - Method in class net.maizegenetics.gui.SelectFromAvailableDialog.SelectedListModel
 
getElementAt(index) - Method in class net.maizegenetics.gui.TableRowHeaderListModel
Returns the value at the specified index.
getElementCount() - Method in class net.maizegenetics.analysis.popgen.DiversityAnalyses
 
getElementCount() - Method in class net.maizegenetics.analysis.popgen.LinkageDisequilibrium
 
getElementCount() - Method in class net.maizegenetics.dna.map.PositionListTableReport
 
getElementCount() - Method in class net.maizegenetics.dna.map.TOPMTableReport
 
getElementCount() - Method in class net.maizegenetics.dna.snp.FilterTableReport
 
getElementCount() - Method in class net.maizegenetics.phenotype.CorePhenotype
 
getElementCount() - Method in class net.maizegenetics.phenotype.FilterPhenotype
 
getElementCount() - Method in class net.maizegenetics.phenotype.GenotypePhenotype
 
getElementCount() - Method in class net.maizegenetics.taxa.distance.DistanceMatrix
 
getElementCount() - Method in class net.maizegenetics.taxa.IdentifierSynonymizer
 
getElementCount() - Method in class net.maizegenetics.taxa.TaxaListTableReport
 
getElementCount() - Method in class net.maizegenetics.util.HDF5TableReport
 
getElementCount() - Method in class net.maizegenetics.util.SimpleTableReport
 
getElementCount() - Method in interface net.maizegenetics.util.TableReport
Get the total number of elements in the dataset. Elements = rowCount * columnCount;
getEnd() - Method in class net.maizegenetics.analysis.data.MeanR2FromLDPlugin.AccumulateR2
 
getEnd() - Method in class net.maizegenetics.analysis.filter.FilterAlignmentPlugin
 
getEndPos() - Method in class net.maizegenetics.analysis.filter.FilterAlignmentPlugin
 
getEndPosition() - Method in class net.maizegenetics.dna.map.DonorHaplotypes
 
getEndPosition(index) - Method in class net.maizegenetics.dna.map.TagsOnPhysicalMap
 
getEndPosition(tagIndex) - Method in class net.maizegenetics.dna.map.TagsOnPhysicalMapV3
EndPosition of PEEnd1 is probably not the EndPosition of the tag
getEndPosition(index) - Method in class net.maizegenetics.dna.map.TagsOnPhysMapHDF5
 
getEndPosition(index) - Method in interface net.maizegenetics.dna.map.TOPMInterface
Returns End Position of Tag
getEnterLimit() - Method in class net.maizegenetics.stats.linearmodels.LinearModelForStepwiseRegression
 
getEnzyme(key) - Method in class net.maizegenetics.analysis.gbs.v2.EnzymeList
Get the Enzyme by the section name
Replaces the previous new GBSEnzyme(String enzyme)
getErrorCode() - Method in exception net.maizegenetics.util.db.DataAccessException
 
getErrordf() - Method in class net.maizegenetics.stats.linearmodels.PartitionedLinearModel
 
getErrorRate() - Method in class net.maizegenetics.analysis.popgen.DonorHypoth
 
getErrorSS() - Method in class net.maizegenetics.stats.linearmodels.PartitionedLinearModel
 
getErrorSSdf() - Method in class net.maizegenetics.stats.linearmodels.SweepFastNestedModel
 
getEvidence(tagIndex) - Method in class net.maizegenetics.dna.map.TagsOnPhysicalMapV3
Return the evidence
getExceptionCauses(exception) - Static method in class net.maizegenetics.util.ExceptionUtils
This gets an exception's cause history. Only the message text is included (e.g. the exception's class names are not output).
getExceptionCausesWithClassNames(exception) - Static method in class net.maizegenetics.util.ExceptionUtils
This gets an exception's cause history.
getExistingHDF5Instance(reader) - Static method in class net.maizegenetics.dna.snp.score.HDF5AlleleDepthBuilder
AlleleDepth is returned for an immutable HDF5 file
getExitLimit() - Method in class net.maizegenetics.stats.linearmodels.LinearModelForStepwiseRegression
 
getExportPluginExportDiploids() - Static method in class net.maizegenetics.prefs.TasselPrefs
 
getExportPluginIncludeTaxaAnnotations() - Static method in class net.maizegenetics.prefs.TasselPrefs
 
getExtension() - Method in class net.maizegenetics.util.BasicFileFilter
 
getExternalNode(i) - Method in class net.maizegenetics.taxa.tree.SimpleTree
Returns the ith external node.
getExternalNode(i) - Method in interface net.maizegenetics.taxa.tree.Tree
 
getExternalNodeCount() - Method in class net.maizegenetics.taxa.tree.SimpleTree
Returns the number of external nodes.
getExternalNodeCount() - Method in interface net.maizegenetics.taxa.tree.Tree
 
getExternalNodes(root, store) - Static method in class net.maizegenetics.taxa.tree.NodeUtils
Appends all external nodes from tree defined by root to Vector store
getExternalNodes(root) - Static method in class net.maizegenetics.taxa.tree.NodeUtils
Obtains all external nodes from tree defined by root and returns as an array
getF() - Method in class net.maizegenetics.stats.linearmodels.PartitionedLinearModel
 
getFactorModelEffect() - Method in class net.maizegenetics.stats.linearmodels.NestedCovariateModelEffect
 
getFeatureFromId(id) - Method in class net.maizegenetics.dna.map.GenomeFeatureMap
 
getFeatureIdFromGffAttributes(attributes) - Static method in class net.maizegenetics.dna.map.GenomeFeatureBuilder
Parse a GFF attribute field to identify the name of the current GenomeFeature. Looks for 'ID=' and 'Name=' fields
getFeaturesAtLocation(chrom, position) - Method in class net.maizegenetics.dna.map.GenomeFeatureMap
Get a HashSet of class GenomeFeatures at a specified genome location
getFeaturesAtLocation(chrom, position) - Method in class net.maizegenetics.dna.map.GenomeFeatureMap
Get a HashSet of class GenomeFeatures at a specified genome location Takes chromsome as a String for ones like "Pt", "scaffold487", etc.
getFeaturesInRange(chrom, start, end) - Method in class net.maizegenetics.dna.map.GenomeFeatureMap
Get a HashSet of class GenomeFeatures at a specified genome location. Takes chromsome as a String for ones like "Pt", "scaffold487", etc.
getFeaturesInRange(chrom, start, end) - Method in class net.maizegenetics.dna.map.GenomeFeatureMap
Get a HashSet of class GenomeFeatures at a specified genome location. Takes chromsome as a String for ones like "Pt", "scaffold487", etc.
getFeaturesOfType(type) - Method in class net.maizegenetics.dna.map.GenomeFeatureMap
Get all class GenomeFeatures of a specified type
getFile(chromosome, trait) - Method in class net.maizegenetics.dna.pd.FolderParser
 
getFileChoice(data, datumArray) - Method in class net.maizegenetics.analysis.data.SynonymizerPlugin
 
getFilename(str) - Static method in class net.maizegenetics.util.Utils
This returns the filename only. Preceding directories are removed and everything after last . is removed.
getFilename(str, suffix) - Static method in class net.maizegenetics.util.Utils
This returns the filename only. Preceding directories are removed and suffix. If suffix not found, then everything after last . is removed.
getFileReadyForClosing() - Method in class net.maizegenetics.dna.map.TagsOnPhysicalMapV3
 
getFileReadyForClosing() - Method in class net.maizegenetics.dna.map.TagsOnPhysMapHDF5
 
getFileReadyForClosing() - Method in interface net.maizegenetics.dna.tag.TagsByTaxa
In implementations that use a RandomAccessFile for storage, this clears the RAM buffer of any remaining data, writes it to the file on disk, and closes the file.
getFileReadyForClosing() - Method in class net.maizegenetics.dna.tag.TagsByTaxaByte
 
getFileReadyForClosing() - Method in class net.maizegenetics.dna.tag.TagsByTaxaByteFileMap
 
getFileReadyForClosing() - Method in class net.maizegenetics.dna.tag.TagsByTaxaByteFileMapSeq
 
getFileReadyForClosing() - Method in class net.maizegenetics.dna.tag.TagsByTaxaByteHDF5TagGroups
 
getFileReadyForClosing() - Method in class net.maizegenetics.dna.tag.TagsByTaxaByteHDF5TaxaGroups
 
getFileReadyForClosing() - Method in class net.maizegenetics.dna.tag.TagsByTaxaShort
 
getFilterAlignPluginMaxFreq() - Static method in class net.maizegenetics.prefs.TasselPrefs
 
getFilterAlignPluginMinCount() - Static method in class net.maizegenetics.prefs.TasselPrefs
 
getFilterAlignPluginMinFreq() - Static method in class net.maizegenetics.prefs.TasselPrefs
 
getFilterBitSet() - Method in interface net.maizegenetics.dna.map.GVCFGenomeSequence
 
getFilteredInstance(genotype, translate) - Static method in class net.maizegenetics.dna.snp.genotypecall.GenotypeCallTableBuilder
 
getFilteredInstance(alleleDepth, filter) - Static method in class net.maizegenetics.dna.snp.score.AlleleDepthBuilder
 
getFilteredInstance(base, translate) - Static method in class net.maizegenetics.dna.snp.score.AlleleDepthBuilder
This creates a filtered AlleleDepth.
getFilteredInstance(base, translate) - Static method in class net.maizegenetics.dna.snp.score.AlleleProbabilityBuilder
 
getFilteredInstance(base, translate) - Static method in class net.maizegenetics.dna.snp.score.DosageBuilder
 
getFilteredInstance(base, translate) - Static method in class net.maizegenetics.dna.snp.score.ReferenceProbabilityBuilder
 
getFilterTaxaPropsMaxHetFreq() - Static method in class net.maizegenetics.prefs.TasselPrefs
 
getFilterTaxaPropsMinHetFreq() - Static method in class net.maizegenetics.prefs.TasselPrefs
 
getFilterTaxaPropsMinNotMissingFreq() - Static method in class net.maizegenetics.prefs.TasselPrefs
 
getFirstCommonAncestor(nodes) - Static method in class net.maizegenetics.taxa.tree.NodeUtils
For a set of nodes in the tree returns the common ancestor closest to all nodes (most recent common ancestor)
getFirstCommonAncestor(nodeOne, nodeTwo) - Static method in class net.maizegenetics.taxa.tree.NodeUtils
For two nodes in the tree returns the common ancestor closest to both nodes (most recent common ancestor)
getFirstGeneticPosition(chromosome) - Method in class net.maizegenetics.analysis.imputation.AGPMap
 
getFirstLowQualityPos(quality, minQual) - Static method in class net.maizegenetics.dna.BaseEncoder
Returns the position of the first low quality positions based on a quality fastq (?) string.
getFirstLowQualityPos(quality, minQual, qualBase) - Static method in class net.maizegenetics.dna.BaseEncoder
Returns the position of the first low quality positions based on a quality fastq (?) string.
getFlankingMarkerIndices(chromosome, geneticPosition) - Method in class net.maizegenetics.analysis.imputation.AGPMap
 
getFloatStorageFeatures() - Method in class net.maizegenetics.dna.tag.AbstractTagsHDF5
Returns default deflation level of float and double See class Tassel5HDF5Constants
getFocusEndSite() - Method in class net.maizegenetics.analysis.popgen.DonorHypoth
 
getFocusStartSite() - Method in class net.maizegenetics.analysis.popgen.DonorHypoth
 
getForwardRead() - Method in class net.maizegenetics.dna.read.PERead
Return forward read
getFp() - Method in class net.maizegenetics.stats.linearmodels.PartitionedLinearModel
 
getFpFromModelSS(modelss) - Method in class net.maizegenetics.stats.linearmodels.LinearModelForStepwiseRegression
 
getFullModelSSdf() - Method in class net.maizegenetics.stats.linearmodels.SweepFastLinearModel
 
getFullyQualifiedClassNames(simpleName) - Static method in class net.maizegenetics.util.Utils
 
getFullyQualifiedResourceNames(filename) - Static method in class net.maizegenetics.util.Utils
This returns a set of fully qualified resource names that match the specified filename.
getGappedSequence1() - Method in class net.maizegenetics.analysis.gbs.neobio.PairwiseAlignment
Returns the first gapped sequence.
getGappedSequence2() - Method in class net.maizegenetics.analysis.gbs.neobio.PairwiseAlignment
Returns the second gapped sequence.
getGChr(index) - Method in class net.maizegenetics.dna.map.TagsOnGeneticMap
Return chromosome of genetic position
getGEBVsAsDoubleMatrix() - Method in class net.maizegenetics.analysis.association.RegRidgeEmmaDoubleMatrix
 
getGenericStorageFeatures() - Method in class net.maizegenetics.dna.tag.AbstractTagsHDF5
Returns default deflation level of String and Class See class Tassel5HDF5Constants
getGeneticDistanceMasksRendering(table, value, isSelected, hasFocus, row, col) - Method in class net.maizegenetics.gui.AlignmentTableCellRenderer
 
getGeneticMappingInfo(tagIndex, geneticMapIndex) - Method in class net.maizegenetics.dna.map.TagsOnPhysicalMapV3
Return tag genetic mapping information of a tag in one genetic map
getGeneticMappingInfoGW(tagIndex) - Method in class net.maizegenetics.dna.map.TagsOnPhysicalMapV3
 
getGeneticPos(markerIndex) - Method in class net.maizegenetics.analysis.imputation.AGPMap
 
getGenotypeAfterUpdatingMissing() - Method in class net.maizegenetics.analysis.association.AbstractFixedEffectLM
updates the genotype after missingObsForSite has changed
getGenotypeAfterUpdatingMissing() - Method in class net.maizegenetics.analysis.association.AlleleProbabilityFELM
 
getGenotypeAfterUpdatingMissing() - Method in class net.maizegenetics.analysis.association.DiscreteSitesFELM
 
getGenotypeAfterUpdatingMissing() - Method in class net.maizegenetics.analysis.association.ReferenceProbabilityFELM
 
getGenotypeAndUpdateMissing(missingObsBeforeSite) - Method in class net.maizegenetics.analysis.association.AbstractFixedEffectLM
 
getGenotypeAndUpdateMissing(missingObsBeforeSite) - Method in class net.maizegenetics.analysis.association.AlleleProbabilityFELM
 
getGenotypeAndUpdateMissing(missingObsBeforeSite) - Method in class net.maizegenetics.analysis.association.DiscreteSitesFELM
 
getGenotypeAndUpdateMissing(missingObsBeforeSite) - Method in class net.maizegenetics.analysis.association.ReferenceProbabilityFELM
 
getGenotypeCopyInstance(genotypeTable) - Static method in class net.maizegenetics.dna.snp.GenotypeTableBuilder
Creates a GenotypeTable with in-memory instance of GenotypeCallTable. Primarily needed for performance critical situations like imputation.
getGenotypesCallsPath(taxon) - Static method in class net.maizegenetics.util.Tassel5HDF5Constants
 
getGenotypesDepthPath(taxon) - Static method in class net.maizegenetics.util.Tassel5HDF5Constants
Deprecated. 
getGenotypesPedigreePath(taxon) - Static method in class net.maizegenetics.util.Tassel5HDF5Constants
 
getGenotypesSiteScorePath(taxon, siteScoreType) - Static method in class net.maizegenetics.util.Tassel5HDF5Constants
 
getGlobalMAF() - Method in class net.maizegenetics.dna.map.GeneralPosition
 
getGlobalMAF() - Method in interface net.maizegenetics.dna.map.Position
Return the minor allele frequency in a global scope
getGlobalSiteCoverage() - Method in class net.maizegenetics.dna.map.GeneralPosition
 
getGlobalSiteCoverage() - Method in interface net.maizegenetics.dna.map.Position
Returns the proportion of genotypes scored at a given site
getGOBIIDB() - Static method in class net.maizegenetics.prefs.TasselPrefs
 
getGOBIIUser() - Static method in class net.maizegenetics.prefs.TasselPrefs
 
getGPos(index) - Method in class net.maizegenetics.dna.map.TagsOnGeneticMap
Return site of genetic position
getGRMFilenames(base) - Static method in class net.maizegenetics.taxa.distance.DistanceMatrixUtils
Get Genetic Relationship Matrix (grm) file names.
getGroups(numberOfGroups) - Method in class net.maizegenetics.taxa.tree.TreeClusters
For a given number of groups this function returns the group membership for each taxon.
getGroups(height) - Method in class net.maizegenetics.taxa.tree.TreeClusters
This function returns taxa group membership when the tree is cut at the designated height.
getGVCFPositions() - Method in interface net.maizegenetics.dna.map.GVCFGenomeSequence
 
getGWASResult(trait) - Method in class net.maizegenetics.dna.pd.SiteAnnotation
Obtain GWAS result value for given trait
getGWASTraits() - Method in class net.maizegenetics.dna.pd.SiteAnnotation
Obtain complete listing of all available traits for which GWAS traits may be available
getHaplotype() - Method in class net.maizegenetics.analysis.clustering.HaplotypeCluster
The common haplotype of this cluster. The type is determined by the field ReturnHaplotype.
getHaplotypeAsString() - Method in class net.maizegenetics.analysis.clustering.HaplotypeCluster
The common haplotype of this cluster. The type is determined by the field ReturnHaplotype.
getHaplotypeList() - Method in class net.maizegenetics.analysis.clustering.HaplotypeCluster
 
getHaplotypeNucleotide(value) - Static method in class net.maizegenetics.dna.snp.NucleotideAlignmentConstants
Returns the Nucleotide String for the given haploid allele value.
getHDF5Alleles(reader, allele) - Static method in class net.maizegenetics.util.HDF5Utils
 
getHDF5AncestralAlleles(reader) - Static method in class net.maizegenetics.util.HDF5Utils
 
getHDF5AncestralAlleles(reader, startSite, numSites) - Static method in class net.maizegenetics.util.HDF5Utils
 
getHDF5GenotypesCalls(reader, taxon) - Static method in class net.maizegenetics.util.HDF5Utils
 
getHDF5GenotypesDepth(reader, taxon) - Static method in class net.maizegenetics.util.HDF5Utils
 
getHDF5GenotypeSiteScores(reader, taxon, siteScoreType) - Static method in class net.maizegenetics.util.HDF5Utils
 
getHDF5GenotypeTaxaNumber(reader) - Static method in class net.maizegenetics.util.HDF5Utils
 
getHDF5NucleotideInstance(writer, numSites) - Static method in class net.maizegenetics.dna.snp.score.HDF5AlleleDepthBuilder
AlleleDepthBuilder is created and depths are stored in a HDF5 file. setDepth methods are used to set the depths. Finish the building with build()
getHDF5PositionNumber(reader) - Static method in class net.maizegenetics.util.HDF5Utils
 
getHDF5ReferenceAlleles(reader) - Static method in class net.maizegenetics.util.HDF5Utils
 
getHDF5ReferenceAlleles(reader, startSite, numSites) - Static method in class net.maizegenetics.util.HDF5Utils
 
getHDF5TagCount(reader) - Static method in class net.maizegenetics.util.HDF5Utils
 
getHDF5TagLengthInLong(reader) - Static method in class net.maizegenetics.util.HDF5Utils
 
getHDF5TaxaNumTaxa(reader) - Static method in class net.maizegenetics.util.HDF5Utils
 
getHetTreatment() - Method in class net.maizegenetics.analysis.popgen.LinkageDisequilibriumPlugin
 
getHomozygousInstance(genotype) - Static method in class net.maizegenetics.dna.snp.GenotypeTableBuilder
 
getHorizontalCenter() - Method in class net.maizegenetics.gui.AlignmentTableModel
 
getHorizontalPageSize() - Method in class net.maizegenetics.gui.AlignmentTableModel
 
getIBSDistance(iMajor, iMinor, jMajor, jMinor) - Static method in class net.maizegenetics.taxa.distance.DistanceMatrixUtils
Calculates the IBS distance between two taxa with bitsets for for major and minor allele
getIBSDistance(iMajor, iMinor, jMajor, jMinor) - Static method in class net.maizegenetics.taxa.distance.DistanceMatrixUtils
 
getIcon() - Method in class net.maizegenetics.analysis.association.EqtlAssociationPlugin
 
getIcon() - Method in class net.maizegenetics.analysis.association.FastMultithreadedAssociationPlugin
 
getIcon() - Method in class net.maizegenetics.analysis.association.FixedEffectLMPlugin
 
getIcon() - Method in class net.maizegenetics.analysis.association.GenomicSelectionPlugin
 
getIcon() - Method in class net.maizegenetics.analysis.association.MLMPlugin
 
getIcon() - Method in class net.maizegenetics.analysis.association.RidgeRegressionEmmaPlugin
 
getIcon() - Method in class net.maizegenetics.analysis.association.WeightedMLMPlugin
 
getIcon() - Method in class net.maizegenetics.analysis.b4r.GetPhenotypeFromB4RPlugin
 
getIcon() - Method in class net.maizegenetics.analysis.chart.ChartDisplayPlugin
Icon for this plugin to be used in buttons, etc.
getIcon() - Method in class net.maizegenetics.analysis.chart.ManhattanDisplayPlugin
Icon for this plugin to be used in buttons, etc.
getIcon() - Method in class net.maizegenetics.analysis.chart.QQDisplayPlugin
Icon for this plugin to be used in buttons, etc.
getIcon() - Method in class net.maizegenetics.analysis.chart.TableDisplayPlugin
Icon for this plugin to be used in buttons, etc.
getIcon() - Method in class net.maizegenetics.analysis.data.AddReferenceAlleleToHDF5Plugin
 
getIcon() - Method in class net.maizegenetics.analysis.data.AddReferenceToGenotypePlugin
 
getIcon() - Method in class net.maizegenetics.analysis.data.AdjustPhasingPlugin
 
getIcon() - Method in class net.maizegenetics.analysis.data.BuildUnfinishedHDF5GenotypesPlugin
 
getIcon() - Method in class net.maizegenetics.analysis.data.CombineDataSetsPlugin
 
getIcon() - Method in class net.maizegenetics.analysis.data.ConvertAlignmentCoordinatesPlugin
 
getIcon() - Method in class net.maizegenetics.analysis.data.CountAssociationsPlugin
 
getIcon() - Method in class net.maizegenetics.analysis.data.CreateHybridGenotypesPlugin
 
getIcon() - Method in class net.maizegenetics.analysis.data.ExportMultiplePlugin
Icon for this plugin to be used in buttons, etc.
getIcon() - Method in class net.maizegenetics.analysis.data.ExportPlugin
Icon for this plugin to be used in buttons, etc.
getIcon() - Method in class net.maizegenetics.analysis.data.ExtractHapmapSubsetPlugin
 
getIcon() - Method in class net.maizegenetics.analysis.data.FeatureListToPositionsPlugin
 
getIcon() - Method in class net.maizegenetics.analysis.data.FileLoadPlugin
Icon for this plugin to be used in buttons, etc.
getIcon() - Method in class net.maizegenetics.analysis.data.FindInversionsPlugin
 
getIcon() - Method in class net.maizegenetics.analysis.data.GenomeAnnosDBQueryToPositionListPlugin
 
getIcon() - Method in class net.maizegenetics.analysis.data.GenosToABHPlugin
 
getIcon() - Method in class net.maizegenetics.analysis.data.GenotypeSummaryPlugin
 
getIcon() - Method in class net.maizegenetics.analysis.data.GenotypeToAdditiveValuesPlugin
 
getIcon() - Method in class net.maizegenetics.analysis.data.GetPositionListPlugin
 
getIcon() - Method in class net.maizegenetics.analysis.data.GetTaxaListPlugin
 
getIcon() - Method in class net.maizegenetics.analysis.data.HDF5SummaryPlugin
 
getIcon() - Method in class net.maizegenetics.analysis.data.HetsToUnknownPlugin
 
getIcon() - Method in class net.maizegenetics.analysis.data.IdentityRecognitionPlugin
 
getIcon() - Method in class net.maizegenetics.analysis.data.IndelsToUnknownPlugin
 
getIcon() - Method in class net.maizegenetics.analysis.data.IntersectionAlignmentPlugin
Icon for this plugin to be used in buttons, etc.
getIcon() - Method in class net.maizegenetics.analysis.data.KmerCountingPlugin
 
getIcon() - Method in class net.maizegenetics.analysis.data.LIXPlugin
 
getIcon() - Method in class net.maizegenetics.analysis.data.MaskGenotypePlugin
 
getIcon() - Method in class net.maizegenetics.analysis.data.MeanR2FromLDPlugin
 
getIcon() - Method in class net.maizegenetics.analysis.data.MemoryUsagePlugin
 
getIcon() - Method in class net.maizegenetics.analysis.data.MergeAlignmentsSameSitesPlugin
 
getIcon() - Method in class net.maizegenetics.analysis.data.MergeGenotypeTablesPlugin
 
getIcon() - Method in class net.maizegenetics.analysis.data.MergeGenotypeTablesPluginV2
 
getIcon() - Method in class net.maizegenetics.analysis.data.MergeHDF5GenotypesSameSitesPlugin
 
getIcon() - Method in class net.maizegenetics.analysis.data.MergeRenameDeleteTaxaPlugin
 
getIcon() - Method in class net.maizegenetics.analysis.data.PassThroughPlugin
 
getIcon() - Method in class net.maizegenetics.analysis.data.PlinkLoadPlugin
Icon for this plugin to be used in buttons, etc.
getIcon() - Method in class net.maizegenetics.analysis.data.PrincipalComponentsPlugin
 
getIcon() - Method in class net.maizegenetics.analysis.data.ProjectionLoadPlugin
Icon for this plugin to be used in buttons, etc.
getIcon() - Method in class net.maizegenetics.analysis.data.ProjectPcsAndRunModelSelectionPlugin
Icon for this plugin to be used in buttons, etc.
getIcon() - Method in class net.maizegenetics.analysis.data.SeparatePlugin
Icon for this plugin to be used in buttons, etc.
getIcon() - Method in class net.maizegenetics.analysis.data.SetLowDepthGenosToMissingPlugin
 
getIcon() - Method in class net.maizegenetics.analysis.data.SortGenotypeFilePlugin
 
getIcon() - Method in class net.maizegenetics.analysis.data.SortTaxaAlphabeticallyPlugin
 
getIcon() - Method in class net.maizegenetics.analysis.data.SplitHDF5ByChromosomePlugin
 
getIcon() - Method in class net.maizegenetics.analysis.data.SubtractGenotypesPlugin
 
getIcon() - Method in class net.maizegenetics.analysis.data.SynonymizerPlugin
Icon for this plugin to be used in buttons, etc.
getIcon() - Method in class net.maizegenetics.analysis.data.ThinSitesByPositionPlugin
 
getIcon() - Method in class net.maizegenetics.analysis.data.UnionAlignmentPlugin
Icon for this plugin to be used in buttons, etc.
getIcon() - Method in class net.maizegenetics.analysis.distance.AddDistanceMatrixPlugin
 
getIcon() - Method in class net.maizegenetics.analysis.distance.AMatrixPlugin
 
getIcon() - Method in class net.maizegenetics.analysis.distance.DistanceMatrixPlugin
Icon for this plugin to be used in buttons, etc.
getIcon() - Method in class net.maizegenetics.analysis.distance.DistanceMatrixRangesPlugin
Icon for this plugin to be used in buttons, etc.
getIcon() - Method in class net.maizegenetics.analysis.distance.HMatrixPlugin
 
getIcon() - Method in class net.maizegenetics.analysis.distance.KinshipPlugin
 
getIcon() - Method in class net.maizegenetics.analysis.distance.MultiDimensionalScalingPlugin
 
getIcon() - Method in class net.maizegenetics.analysis.distance.RemoveNaNFromDistanceMatrixPlugin
 
getIcon() - Method in class net.maizegenetics.analysis.distance.SubtractDistanceMatrixPlugin
 
getIcon() - Method in class net.maizegenetics.analysis.distance.VCAPScanPlugin
 
getIcon() - Method in class net.maizegenetics.analysis.filter.FilterAlignmentPlugin
Icon for this plugin to be used in buttons, etc.
getIcon() - Method in class net.maizegenetics.analysis.filter.FilterDataSetPlugin
 
getIcon() - Method in class net.maizegenetics.analysis.filter.FilterSiteBuilderPlugin
 
getIcon() - Method in class net.maizegenetics.analysis.filter.FilterSiteNamePlugin
Deprecated.
Icon for this plugin to be used in buttons, etc.
getIcon() - Method in class net.maizegenetics.analysis.filter.FilterSubsetPlugin
Icon for this plugin to be used in buttons, etc.
getIcon() - Method in class net.maizegenetics.analysis.filter.FilterTaxaBuilderPlugin
 
getIcon() - Method in class net.maizegenetics.analysis.filter.FilterTaxaPropertiesPlugin
Icon for this plugin to be used in buttons, etc.
getIcon() - Method in class net.maizegenetics.analysis.filter.FilterTraitsPlugin
 
getIcon() - Method in class net.maizegenetics.analysis.gbs.AnnotateTOPMwSAMPlugin
 
getIcon() - Method in class net.maizegenetics.analysis.gbs.BinaryToTextPlugin
 
getIcon() - Method in class net.maizegenetics.analysis.gbs.CompareGenosBetweenHapMapFilesPlugin
 
getIcon() - Method in class net.maizegenetics.analysis.gbs.ContigPETagCountPlugin
 
getIcon() - Method in class net.maizegenetics.analysis.gbs.DiscoverySNPCallerPlugin
 
getIcon() - Method in class net.maizegenetics.analysis.gbs.FastqToPETagCountPlugin
 
getIcon() - Method in class net.maizegenetics.analysis.gbs.FastqToTagCountPlugin
 
getIcon() - Method in class net.maizegenetics.analysis.gbs.FastqToTBTPlugin
 
getIcon() - Method in class net.maizegenetics.analysis.gbs.KeepSpecifiedReadsinFastqPlugin
 
getIcon() - Method in class net.maizegenetics.analysis.gbs.KeepSpecifiedSitesInTOPMPlugin
 
getIcon() - Method in class net.maizegenetics.analysis.gbs.KmerToTagCountPlugin
 
getIcon() - Method in class net.maizegenetics.analysis.gbs.KmerToTBTPlugin
 
getIcon() - Method in class net.maizegenetics.analysis.gbs.MergeDuplicateSNPsPlugin
 
getIcon() - Method in class net.maizegenetics.analysis.gbs.MergeMultipleTagCountPlugin
 
getIcon() - Method in class net.maizegenetics.analysis.gbs.MergeMultipleTOPMPlugin
 
getIcon() - Method in class net.maizegenetics.analysis.gbs.MergePETagCountPlugin
 
getIcon() - Method in class net.maizegenetics.analysis.gbs.MergeTagsByTaxaFilesByRowPlugin
 
getIcon() - Method in class net.maizegenetics.analysis.gbs.MergeTagsByTaxaFilesPlugin
 
getIcon() - Method in class net.maizegenetics.analysis.gbs.ModifyTBTHDF5Plugin
 
getIcon() - Method in class net.maizegenetics.analysis.gbs.pana.PanAAddPosToTagMapPlugin
 
getIcon() - Method in class net.maizegenetics.analysis.gbs.pana.PanABuildPivotTBTPlugin
 
getIcon() - Method in class net.maizegenetics.analysis.gbs.pana.PanABuildTagBlockPosPlugin
 
getIcon() - Method in class net.maizegenetics.analysis.gbs.pana.PanABuildTagGWASMapPlugin
 
getIcon() - Method in class net.maizegenetics.analysis.gbs.pana.PanABuildTrainingSetPlugin
 
getIcon() - Method in class net.maizegenetics.analysis.gbs.pana.PanAFilteringTagMapPlugin
 
getIcon() - Method in class net.maizegenetics.analysis.gbs.pana.PanAH5ToAnchorPlugin
 
getIcon() - Method in class net.maizegenetics.analysis.gbs.pana.PanAMergeMappingResultPlugin
 
getIcon() - Method in class net.maizegenetics.analysis.gbs.pana.PanAModelTrainingPlugin
 
getIcon() - Method in class net.maizegenetics.analysis.gbs.pana.PanAPredictionPlugin
 
getIcon() - Method in class net.maizegenetics.analysis.gbs.pana.PanAReadDigestPlugin
 
getIcon() - Method in class net.maizegenetics.analysis.gbs.pana.PanAReadToKmerPlugin
 
getIcon() - Method in class net.maizegenetics.analysis.gbs.pana.PanASamToMultiPositionTOPMPlugin
 
getIcon() - Method in class net.maizegenetics.analysis.gbs.pana.PanASplitTagBlockPosPlugin
 
getIcon() - Method in class net.maizegenetics.analysis.gbs.pana.PanASplitTBTPlugin
 
getIcon() - Method in class net.maizegenetics.analysis.gbs.pana.PanATagGWASMappingPlugin
 
getIcon() - Method in class net.maizegenetics.analysis.gbs.pana.PanATagMapToFastaPlugin
 
getIcon() - Method in class net.maizegenetics.analysis.gbs.ProductionPipeline
 
getIcon() - Method in class net.maizegenetics.analysis.gbs.ProductionSNPCallerPlugin
 
getIcon() - Method in class net.maizegenetics.analysis.gbs.QseqToPETagCountPlugin
 
getIcon() - Method in class net.maizegenetics.analysis.gbs.QseqToTagCountPlugin
 
getIcon() - Method in class net.maizegenetics.analysis.gbs.QseqToTBTPlugin
 
getIcon() - Method in class net.maizegenetics.analysis.gbs.repgen.RampSeqAlignFromBlastTags
 
getIcon() - Method in class net.maizegenetics.analysis.gbs.repgen.RepGenAlignerPlugin
 
getIcon() - Method in class net.maizegenetics.analysis.gbs.repgen.RepGenLDAnalysisPlugin
 
getIcon() - Method in class net.maizegenetics.analysis.gbs.repgen.RepGenLoadSeqToDBPlugin
 
getIcon() - Method in class net.maizegenetics.analysis.gbs.repgen.RepGenPhase2AlignerPlugin
 
getIcon() - Method in class net.maizegenetics.analysis.gbs.repgen.RGBSProductionSNPCallerPlugin
 
getIcon() - Method in class net.maizegenetics.analysis.gbs.SAMConverterPlugin
 
getIcon() - Method in class net.maizegenetics.analysis.gbs.SAMWGMapConverterPlugin
 
getIcon() - Method in class net.maizegenetics.analysis.gbs.SeqToTBTHDF5Plugin
 
getIcon() - Method in class net.maizegenetics.analysis.gbs.TagAgainstAnchorPlugin
 
getIcon() - Method in class net.maizegenetics.analysis.gbs.TagCountToFastqPlugin
 
getIcon() - Method in class net.maizegenetics.analysis.gbs.TextToBinaryPlugin
 
getIcon() - Method in class net.maizegenetics.analysis.gbs.TOPMSummaryPlugin
 
getIcon() - Method in class net.maizegenetics.analysis.gbs.UTagCountToTagPairPlugin
 
getIcon() - Method in class net.maizegenetics.analysis.gbs.UTagPairToTOPMPlugin
 
getIcon() - Method in class net.maizegenetics.analysis.gbs.v2.DiscoverySNPCallerPluginV2
 
getIcon() - Method in class net.maizegenetics.analysis.gbs.v2.GBSSeqToTagDBPlugin
 
getIcon() - Method in class net.maizegenetics.analysis.gbs.v2.GetTagSequenceFromDBPlugin
 
getIcon() - Method in class net.maizegenetics.analysis.gbs.v2.GetTagTaxaDistFromDBPlugin
 
getIcon() - Method in class net.maizegenetics.analysis.gbs.v2.ProductionSNPCallerPluginV2
 
getIcon() - Method in class net.maizegenetics.analysis.gbs.v2.SAMToGBSdbPlugin
 
getIcon() - Method in class net.maizegenetics.analysis.gbs.v2.SNPCutPosTagVerificationPlugin
 
getIcon() - Method in class net.maizegenetics.analysis.gbs.v2.SNPQualityProfilerPlugin
 
getIcon() - Method in class net.maizegenetics.analysis.gbs.v2.TagExportToFastqPlugin
 
getIcon() - Method in class net.maizegenetics.analysis.gbs.v2.UpdateSNPPositionQualityPlugin
 
getIcon() - Method in class net.maizegenetics.analysis.gobii.GOBIIPlugin
 
getIcon() - Method in class net.maizegenetics.analysis.gobii.GWAS_IFLPlugin
 
getIcon() - Method in class net.maizegenetics.analysis.gobii.HapBreakpoints_IFLFilePlugin
 
getIcon() - Method in class net.maizegenetics.analysis.gobii.MarkerDNARun_IFLFilePlugin
 
getIcon() - Method in class net.maizegenetics.analysis.gobii.MonetDB_IFLFilePlugin
 
getIcon() - Method in class net.maizegenetics.analysis.gobii.PreProcessGOBIIMappingFilePlugin
 
getIcon() - Method in class net.maizegenetics.analysis.gobii.SplitFile_IFLFilePlugin
 
getIcon() - Method in class net.maizegenetics.analysis.imputation.CallParentAllelesPlugin
 
getIcon() - Method in class net.maizegenetics.analysis.imputation.ClusterGenotypesPlugin
 
getIcon() - Method in class net.maizegenetics.analysis.imputation.FILLINFindHaplotypesPlugin
 
getIcon() - Method in class net.maizegenetics.analysis.imputation.FILLINImputationPlugin
 
getIcon() - Method in class net.maizegenetics.analysis.imputation.FindMergeHaplotypesPlugin
 
getIcon() - Method in class net.maizegenetics.analysis.imputation.FSFHapImputationPlugin
 
getIcon() - Method in class net.maizegenetics.analysis.imputation.ImputationAccuracyPlugin
 
getIcon() - Method in class net.maizegenetics.analysis.imputation.ImputeProgenyStatesPlugin
 
getIcon() - Method in class net.maizegenetics.analysis.imputation.LDKNNiImputationHetV2Plugin
 
getIcon() - Method in class net.maizegenetics.analysis.imputation.LDKNNiImputationHetV3Plugin
 
getIcon() - Method in class net.maizegenetics.analysis.imputation.LDKNNiImputationPlugin
 
getIcon() - Method in class net.maizegenetics.analysis.imputation.MergeBreakpointFilesPlugin
 
getIcon() - Method in class net.maizegenetics.analysis.imputation.ParentPhasingPlugin
 
getIcon() - Method in class net.maizegenetics.analysis.imputation.RandomGenotypeImputationPlugin
 
getIcon() - Method in class net.maizegenetics.analysis.imputation.ReImputeUpdatedTaxaByFILLINPlugin
 
getIcon() - Method in class net.maizegenetics.analysis.imputation.RemoveIndelsForBeaglePlugin
 
getIcon() - Method in class net.maizegenetics.analysis.imputation.ViterbiAlgorithmPlugin
 
getIcon() - Method in class net.maizegenetics.analysis.imputation.WritePopulationAlignmentPlugin
 
getIcon() - Method in class net.maizegenetics.analysis.ListPluginParameters
 
getIcon() - Method in class net.maizegenetics.analysis.ListPlugins
 
getIcon() - Method in class net.maizegenetics.analysis.modelfitter.AdditiveSiteStorePlugin
 
getIcon() - Method in class net.maizegenetics.analysis.modelfitter.ResamplingGWASPlugin
 
getIcon() - Method in class net.maizegenetics.analysis.modelfitter.StepwiseAdditiveModelFitterPlugin
 
getIcon() - Method in class net.maizegenetics.analysis.modelfitter.StepwiseOLSModelFitterPlugin
 
getIcon() - Method in class net.maizegenetics.analysis.monetdb.ColumnsToBinaryFullGenomeTablePlugin
 
getIcon() - Method in class net.maizegenetics.analysis.monetdb.ColumnsToBinarySNPOnlyTablePlugin
 
getIcon() - Method in class net.maizegenetics.analysis.numericaltransform.AvgPhenotypeByTaxaPlugin
 
getIcon() - Method in class net.maizegenetics.analysis.numericaltransform.BoxCoxTransformationPlugin
 
getIcon() - Method in class net.maizegenetics.analysis.numericaltransform.ImputationPlugin
 
getIcon() - Method in class net.maizegenetics.analysis.numericaltransform.NumericalGenotypePlugin
 
getIcon() - Method in class net.maizegenetics.analysis.numericaltransform.SubtractPhenotypeByTaxaPlugin
 
getIcon() - Method in class net.maizegenetics.analysis.numericaltransform.TransformDataPlugin
 
getIcon() - Method in class net.maizegenetics.analysis.popgen.LinkageDiseqDisplayPlugin
Icon for this plugin to be used in buttons, etc.
getIcon() - Method in class net.maizegenetics.analysis.popgen.LinkageDisequilibriumPlugin
Icon for this plugin to be used in buttons, etc.
getIcon() - Method in class net.maizegenetics.analysis.popgen.SequenceDiversityPlugin
 
getIcon() - Method in class net.maizegenetics.analysis.rna.LoadRNAContigsToGBSDBPlugin
 
getIcon() - Method in class net.maizegenetics.analysis.rna.RNADeMultiplexProductionPlugin
 
getIcon() - Method in class net.maizegenetics.analysis.rna.RNADeMultiPlexSeqToDBPlugin
 
getIcon() - Method in class net.maizegenetics.analysis.tree.ArchaeopteryxPlugin
 
getIcon() - Method in class net.maizegenetics.analysis.tree.ConvertTreeNamesPlugin
 
getIcon() - Method in class net.maizegenetics.analysis.tree.CreateTreePlugin
Icon for this plugin to be used in buttons, etc.
getIcon() - Method in class net.maizegenetics.analysis.tree.MergeTreesPlugin
 
getIcon() - Method in class net.maizegenetics.analysis.tree.RemoveBranchLengthsPlugin
 
getIcon() - Method in class net.maizegenetics.analysis.tree.SubsetTreePlugin
 
getIcon() - Method in class net.maizegenetics.analysis.workflow.WorkflowPlugin
 
getIcon() - Method in interface net.maizegenetics.plugindef.Plugin
Icon for this plugin to be used in buttons, etc.
getIcon() - Method in class net.maizegenetics.tassel.PreferencesDialog
 
getIcon() - Method in class net.maizegenetics.tassel.ShowParameterCachePlugin
 
getIcon() - Method in class net.maizegenetics.tassel.TasselLogging
 
getIcon() - Method in class net.maizegenetics.util.ConvertOldFastqToModernFormatPlugin
 
getId() - Method in class net.maizegenetics.analysis.data.MeanR2FromLDPlugin.AccumulateR2
 
getID() - Method in class net.maizegenetics.analysis.modelfitter.AddPlusDomModelEffect
 
getID() - Method in class net.maizegenetics.dna.read.Read
Return ID of read
getID() - Method in class net.maizegenetics.stats.linearmodels.CovariateModelEffect
 
getID() - Method in class net.maizegenetics.stats.linearmodels.FactorModelEffect
 
getID() - Method in interface net.maizegenetics.stats.linearmodels.ModelEffect
 
getID() - Method in class net.maizegenetics.stats.linearmodels.NestedCovariateModelEffect
 
getIdCorrelation(id) - Static method in class net.maizegenetics.analysis.imputation.NucleotideImputationUtils
 
getIdentifier() - Method in interface net.maizegenetics.taxa.tree.Node
Returns the identifier for this node.
getIdentifier() - Method in class net.maizegenetics.taxa.tree.SimpleNode
Returns the identifier for this node.
getIdentityMatrix(dim) - Static method in class net.maizegenetics.matrixalgebra.Matrix.BlasDoubleMatrix
 
getIdGroup() - Method in class net.maizegenetics.taxa.tree.CladeSystem
get idGroup
getIdGroup() - Method in class net.maizegenetics.taxa.tree.SplitSystem
get idGroup
getIfHasEvidence(type, ifEvidence) - Method in enum net.maizegenetics.analysis.gbs.AnnotateTOPM.EvidenceType
 
getIfHasGeneticMapping() - Method in class net.maizegenetics.dna.map.TagsOnPhysicalMapV3
Return if the file has genetic mapping test result
getIfHasGeneticMappingGW() - Method in class net.maizegenetics.dna.map.TagsOnPhysicalMapV3
Return if the file has genome wide genetic mapping annotation
getIfHasMapping() - Method in class net.maizegenetics.dna.map.TagsOnPhysicalMapV3
Return if the file has alignment mapping annotation
getIfPAV(index) - Method in class net.maizegenetics.dna.map.TagsOnGeneticMap
Return if this tag is PAV
getImageHeight() - Method in class net.maizegenetics.analysis.chart.AbstractDisplayPlugin
 
getImageWidth() - Method in class net.maizegenetics.analysis.chart.AbstractDisplayPlugin
 
getIncludedSitesBasedOnFreqIgnoreMissing(aa, minimumProportion, maximumProportion, minimumCount) - Static method in class net.maizegenetics.dna.snp.GenotypeTableUtils
get sites to be included based on minimum frequency (the count of good bases, INCLUDING GAPS) and based on the proportion of good sites (INCLUDING GAPS) different from consensus
getIncludedTraits() - Method in class net.maizegenetics.analysis.filter.FilterTraitsDialog
 
getIncrementalSSdf(effect) - Method in class net.maizegenetics.stats.linearmodels.SweepFastLinearModel
 
getIndex() - Method in enum net.maizegenetics.analysis.gbs.AnnotateTOPM.EvidenceType
 
getIndex() - Method in enum net.maizegenetics.dna.snp.score.SiteScore.SITE_SCORE_TYPE
 
getIndex() - Method in class net.maizegenetics.stats.linearmodels.BasicLevel
 
getIndexOfTaxaName(taxon) - Method in class net.maizegenetics.dna.tag.AbstractTagsByTaxa
 
getIndexOfTaxaName(taxon) - Method in class net.maizegenetics.dna.tag.ReadsByTaxa
 
getIndexOfTaxaName(taxon) - Method in interface net.maizegenetics.dna.tag.TagsByTaxa
Get the index of a taxon based on its name
getIndexOfTaxaName(taxon) - Method in class net.maizegenetics.dna.tag.TagsByTaxaByteHDF5TagGroups
 
getIndexOfTaxaName(taxon) - Method in class net.maizegenetics.dna.tag.TagsByTaxaByteHDF5TaxaGroups
 
getIndicesOfSetBits() - Method in interface net.maizegenetics.util.BitSet
Return indices of set bits.
getIndicesOfSetBits() - Method in class net.maizegenetics.util.OpenBitSet
 
getIndicesOfSetBits() - Method in class net.maizegenetics.util.UnmodifiableBitSet
 
getInput() - Method in class net.maizegenetics.analysis.gbs.TextToBinaryPlugin
 
getInputs() - Method in class net.maizegenetics.plugindef.AbstractPlugin
 
getInputStream(filename) - Static method in class net.maizegenetics.util.Utils
Gets input stream for given file.
getInsertionPosition() - Method in class net.maizegenetics.dna.map.GeneralPosition
 
getInsertionPosition() - Method in interface net.maizegenetics.dna.map.Position
Return the insertion-position of a site. This will be zero for the main physical position and sequentially numbered (1, 2, 3,...) for any (if any) sites with the same net.maizegenetics.dna.map.Position$getPosition(). This will mostly be used for insertions relative to the reference.
getInstance(chromosome) - Static method in class net.maizegenetics.analysis.avro.GenericRecordChromosome
 
getInstance(genotype) - Static method in class net.maizegenetics.analysis.distance.DominanceNormalizedIBSMatrix
http://www.ncbi.nlm.nih.gov/pmc/articles/PMC4375616/pdf/main.pdf p. 378
getInstance(genotype, listener) - Static method in class net.maizegenetics.analysis.distance.DominanceNormalizedIBSMatrix
Same as other getInstance() but reports progress.
getInstance(genotype) - Static method in class net.maizegenetics.analysis.distance.DominanceRelationshipMatrix
Compute Dominance Relationship Matrix for all pairs of taxa. Missing sites are ignored.
getInstance(genotype, maxAlleles, variation, listener) - Static method in class net.maizegenetics.analysis.distance.DominanceRelationshipMatrix
Compute Dominance Relationship Matrix for all pairs of taxa. Missing sites are ignored.
getInstance(genotype) - Static method in class net.maizegenetics.analysis.distance.EndelmanDistanceMatrix
Compute Endelman Kinship Matrix. Maximum alleles per site to evaluate defaults to 2.
getInstance(genotype, maxAlleles) - Static method in class net.maizegenetics.analysis.distance.EndelmanDistanceMatrix
Compute Endelman Kinship Matrix
getInstance(genotype, listener) - Static method in class net.maizegenetics.analysis.distance.EndelmanDistanceMatrix
Compute Endelman Kinship Matrix. Maximum alleles per site to evaluate defaults to 2.
getInstance(genotype, maxAlleles, listener) - Static method in class net.maizegenetics.analysis.distance.EndelmanDistanceMatrix
Compute Endelman Kinship Matrix
getInstance(genotype) - Static method in class net.maizegenetics.analysis.distance.GCTADistanceMatrix
Compute Normalized_IBS (GCTA) kinship for all pairs of taxa. Missing sites are ignored. http://www.ncbi.nlm.nih.gov/pmc/articles/PMC3014363/pdf/main.pdf Equation-3
getInstance(genotype, listener) - Static method in class net.maizegenetics.analysis.distance.GCTADistanceMatrix
Same as other getInstance() but reports progress.
getInstance(theAlignment) - Static method in class net.maizegenetics.analysis.distance.IBSDistanceMatrix
Compute observed distances for all taxa. Missing sites are ignored.
getInstance(theAlignment, listener) - Static method in class net.maizegenetics.analysis.distance.IBSDistanceMatrix
Compute observed distances for all taxa. Missing sites are ignored.
getInstance(theAlignment, minSiteComp, listener) - Static method in class net.maizegenetics.analysis.distance.IBSDistanceMatrix
Compute observed distances for all taxa. Missing sites are ignored.
getInstance(theAlignment, minSiteComp, trueIBS, listener, useThirdState) - Static method in class net.maizegenetics.analysis.distance.IBSDistanceMatrix
Compute observed distances for all taxa. Missing sites are ignored.
getInstance(genotype) - Static method in class net.maizegenetics.analysis.distance.IBSDistanceMatrix2Alleles
 
getInstance(genotype, listener) - Static method in class net.maizegenetics.analysis.distance.IBSDistanceMatrix2Alleles
 
getInstance(genotype, minSiteComp, trueIBS, listener) - Static method in class net.maizegenetics.analysis.distance.IBSDistanceMatrix2Alleles
 
getInstance(genotype) - Static method in class net.maizegenetics.analysis.distance.IBSDistanceMatrix3Alleles
 
getInstance(genotype, listener) - Static method in class net.maizegenetics.analysis.distance.IBSDistanceMatrix3Alleles
 
getInstance(genotype, minSiteComp, trueIBS, listener) - Static method in class net.maizegenetics.analysis.distance.IBSDistanceMatrix3Alleles
 
getInstance(genotype, taxonIndex) - Static method in class net.maizegenetics.analysis.distance.IBSDistanceMatrixOneByAll
 
getInstance(genotype, taxonIndex, listener) - Static method in class net.maizegenetics.analysis.distance.IBSDistanceMatrixOneByAll
 
getInstance(genotype, taxonIndex, minSiteComp, listener) - Static method in class net.maizegenetics.analysis.distance.IBSDistanceMatrixOneByAll
 
getInstance(hdf5Filename) - Static method in class net.maizegenetics.dna.map.PositionListBuilder
Creates a new position list based on an existing HDF5 file.
getInstance(reader) - Static method in class net.maizegenetics.dna.map.PositionListBuilder
Creates a new builder based on an existing HDF5 file reader.
getInstance(numSites) - Static method in class net.maizegenetics.dna.map.PositionListBuilder
Generates a generic position list when no position information known
getInstance(positions) - Static method in class net.maizegenetics.dna.map.PositionListBuilder
Creates in memory of PositionList from the an array of positions.
getInstance(numTaxa, numSites, siteScoreType, taxaList) - Static method in class net.maizegenetics.dna.snp.byte2d.Byte2DBuilder
 
getInstance(writer, numSites, siteScoreType, taxaList) - Static method in class net.maizegenetics.dna.snp.byte2d.Byte2DBuilder
 
getInstance(reader, siteScoreType) - Static method in class net.maizegenetics.dna.snp.byte2d.Byte2DBuilder
 
getInstance(genoTables) - Static method in class net.maizegenetics.dna.snp.CombineGenotypeTable
This factory method combines given genoTables. If only one genotypeTable, then it is returned unchanged. Otherwise, this requires that each genotypeTable has the same Taxa in the same order.
getInstance(genoTables, isUnion) - Static method in class net.maizegenetics.dna.snp.CombineGenotypeTable
This factory method combines given genoTables. If only one genotypeTable, then it is returned unchanged. If isUnion equals true, a union join of the Identifiers will be used to construct the combination. Any genotypeTable not containing one of the Identifiers will return unknown value for those locations. If isUnion equals false, a intersect join of the Identifiers will be used.
getInstance(base, annoName, symbol, threshold, mode) - Static method in class net.maizegenetics.dna.snp.FilterAndMaskGVCFGenomeSequence
 
getInstance(base, taxa, positions, translate) - Static method in class net.maizegenetics.dna.snp.FilterGenotypeTable
 
getInstance(genotypes, positions, redirectSites) - Static method in class net.maizegenetics.dna.snp.FilterGenotypeTable
For use when converting between coordinate systems.
getInstance(a, subTaxaList) - Static method in class net.maizegenetics.dna.snp.FilterGenotypeTable
This returns GenotypeTable with only specified subTaxaList. Defaults to retain unknown taxa.
getInstance(genotype, subTaxaList, retainUnknownTaxa) - Static method in class net.maizegenetics.dna.snp.FilterGenotypeTable
This returns FilterGenotypeTable with only specified subTaxaList. If retainUnknownTaxa is true then Alignment will return unknown values for missing taxa.
getInstance(genotypes, subSites) - Static method in class net.maizegenetics.dna.snp.FilterGenotypeTable
 
getInstance(genotypes, subSites, includeSites) - Static method in class net.maizegenetics.dna.snp.FilterGenotypeTable
 
getInstance(a, siteNamesToKeep) - Static method in class net.maizegenetics.dna.snp.FilterGenotypeTable
 
getInstance(a, siteNamesToKeep) - Static method in class net.maizegenetics.dna.snp.FilterGenotypeTable
 
getInstance(a, subPositionList) - Static method in class net.maizegenetics.dna.snp.FilterGenotypeTable
 
getInstance(a, chromosome, startPhysicalPos, endPhysicalPos) - Static method in class net.maizegenetics.dna.snp.FilterGenotypeTable
 
getInstance(a, chromosome, startPhysicalPos, endPhysicalPos) - Static method in class net.maizegenetics.dna.snp.FilterGenotypeTable
 
getInstance(a, chromosome) - Static method in class net.maizegenetics.dna.snp.FilterGenotypeTable
 
getInstance(genotypes, startSite, endSite) - Static method in class net.maizegenetics.dna.snp.FilterGenotypeTable
Factory method that returns genotypes FilterGenotypeTable viewing sites between start site (inclusive) and end site (inclusive).
getInstance(a, startSite, endSite, includeSites) - Static method in class net.maizegenetics.dna.snp.FilterGenotypeTable
 
getInstance(genotypeCallTables) - Static method in class net.maizegenetics.dna.snp.genotypecall.CombineGenotypeCallTable
 
getInstance(numTaxa, numSites) - Static method in class net.maizegenetics.dna.snp.genotypecall.GenotypeCallTableBuilder
Get Genotype Builder given number of taxa and sites. Performance optimized for site loop inside taxon loop. Default is unphased and NucleotideAlignmentConstants.NUCLEOTIDE_ALLELES encoding.
getInstance(numTaxa, numSites, phased, record) - Static method in class net.maizegenetics.dna.snp.genotypecall.GOBIIAvroGenotypeCallTable
 
getInstance(numTaxa, numSites, phased, filename) - Static method in class net.maizegenetics.dna.snp.genotypecall.GOBIIGenotypeCallTable
 
getInstance(numTaxa, numSites, phased, isOneLetter, index, filename) - Static method in class net.maizegenetics.dna.snp.genotypecall.LineIndexHapmapGenotypeCallTable
 
getInstance(genotypeCallTables, taxonMap, positionMap) - Static method in class net.maizegenetics.dna.snp.genotypecall.MergedGenotypeCallTable
 
getInstance(alleleCounts, stats, numIndices, index) - Static method in class net.maizegenetics.dna.snp.genotypecall.Stats
 
getInstance(orig, newIndex) - Static method in class net.maizegenetics.dna.snp.genotypecall.Stats
 
getInstance(original, newGenotypes) - Static method in class net.maizegenetics.dna.snp.GenotypeTableBuilder
 
getInstance(genotype, positionList, taxaList, alleleDepth, alleleProbability, referenceProbability, dosage, annotations) - Static method in class net.maizegenetics.dna.snp.GenotypeTableBuilder
Standard approach for creating a new Alignment
getInstance(genotype, positionList, taxaList, alleleDepth) - Static method in class net.maizegenetics.dna.snp.GenotypeTableBuilder
 
getInstance(genotype, positionList, taxaList) - Static method in class net.maizegenetics.dna.snp.GenotypeTableBuilder
 
getInstance(genotype, positionList, taxaList, hdf5File) - Static method in class net.maizegenetics.dna.snp.GenotypeTableBuilder
Creates a new HDF5 file alignment based on existing Genotype, PositionList, and TaxaList.
getInstance(a, hdf5File) - Static method in class net.maizegenetics.dna.snp.GenotypeTableBuilder
Creates a new HDF5 file alignment based on an existing alignment.
getInstance(hdf5File) - Static method in class net.maizegenetics.dna.snp.GenotypeTableBuilder
 
getInstance(base, mask) - Static method in class net.maizegenetics.dna.snp.GenotypeTableBuilder
 
getInstance(paFile, baseHighDensityAlignmentFile) - Static method in class net.maizegenetics.dna.snp.io.ProjectionGenotypeIO
Returns a genotypeTable based on a projection genotype file and high density genotype table
getInstance(paFile, baseHighDensityAlignment) - Static method in class net.maizegenetics.dna.snp.io.ProjectionGenotypeIO
Returns a genotypeTable based on a projection genotype file and high density genotype table
getInstance(numTaxa, numSites, isSiteOptimized) - Static method in class net.maizegenetics.dna.snp.MaskMatrixBuilder
 
getInstance(orig) - Static method in class net.maizegenetics.dna.snp.MaskMatrixBuilder
 
getInstance(genotype, predicate) - Static method in class net.maizegenetics.dna.snp.MaskMatrixBuilder
 
getInstance(genotype, predicate) - Static method in class net.maizegenetics.dna.snp.MaskMatrixBuilder
 
getInstance(genoTables, taxaMergeRule, positionMergeRule) - Static method in class net.maizegenetics.dna.snp.MergedGenotypeTable
 
getInstance(baseAlignment, allBreakPoints) - Static method in class net.maizegenetics.dna.snp.ProjectionBuilder
 
getInstance(writer, numSites) - Static method in class net.maizegenetics.dna.snp.score.AlleleDepthBuilder
AlleleDepthBuilder is created and depths are stored in a HDF5 file. setDepth methods are used to set the depths. Finish the building with build()
getInstance(numTaxa, numSites, taxaList) - Static method in class net.maizegenetics.dna.snp.score.AlleleDepthBuilder
This returns an AlleleDepthBuilder where depths are stored in memory.
getInstance(reader) - Static method in class net.maizegenetics.dna.snp.score.AlleleDepthBuilder
This creates an AlleleDepth instance from an existing HDF5 file.
getInstance(writer, numTaxa, numSites, taxaList) - Static method in class net.maizegenetics.dna.snp.score.AlleleProbabilityBuilder
 
getInstance(reader) - Static method in class net.maizegenetics.dna.snp.score.AlleleProbabilityBuilder
 
getInstance(writer, numTaxa, numSites, taxaList) - Static method in class net.maizegenetics.dna.snp.score.DosageBuilder
 
getInstance(numTaxa, numSites, taxaList) - Static method in class net.maizegenetics.dna.snp.score.DosageBuilder
 
getInstance(reader) - Static method in class net.maizegenetics.dna.snp.score.DosageBuilder
 
getInstance(writer, numTaxa, numSites, taxaList) - Static method in class net.maizegenetics.dna.snp.score.ReferenceProbabilityBuilder
 
getInstance(numTaxa, numSites, taxaList) - Static method in class net.maizegenetics.dna.snp.score.ReferenceProbabilityBuilder
 
getInstance(reader) - Static method in class net.maizegenetics.dna.snp.score.ReferenceProbabilityBuilder
 
getInstance(translateTaxa, translateSite) - Static method in class net.maizegenetics.dna.snp.TranslateBuilder
 
getInstance(base, translate) - Static method in class net.maizegenetics.dna.snp.TranslateBuilder
 
getInstance(numBaseIndices) - Static method in class net.maizegenetics.dna.snp.TranslateIndexBuilder
 
getInstance(base) - Static method in class net.maizegenetics.dna.snp.TranslateIndexBuilder
 
getInstance(numBaseIndices, base) - Static method in class net.maizegenetics.dna.snp.TranslateIndexBuilder
 
getInstance(parentFrame) - Static method in class net.maizegenetics.gui.PrintHeapAction
 
getInstance() - Static method in class net.maizegenetics.gui.VerticalLabelUI
 
getInstance(nrows, ncols, values, columnMajor) - Static method in class net.maizegenetics.matrixalgebra.Matrix.BlasDoubleMatrix
 
getInstance(nrows, ncols, dblValue) - Static method in class net.maizegenetics.matrixalgebra.Matrix.BlasDoubleMatrix
 
getInstance() - Static method in class net.maizegenetics.plugindef.DefaultPluginListener
 
getInstance() - Static method in class net.maizegenetics.progress.ProgressPanel
 
getInstance(cme, me) - Static method in class net.maizegenetics.stats.linearmodels.NestedCovariateModelEffect
 
getInstance(covariate, me) - Static method in class net.maizegenetics.stats.linearmodels.NestedCovariateModelEffect
 
getInstance(size) - Static method in class net.maizegenetics.stats.statistics.FisherExact
Static method to get instance
getInstance(alignment, masks, dataTreePanel) - Static method in class net.maizegenetics.tassel.SeqViewerPanel
 
getInstance(topm, dataTreePanel) - Static method in class net.maizegenetics.tassel.SeqViewerPanel
 
getInstance(alignment, dataTreePanel) - Static method in class net.maizegenetics.tassel.SeqViewerPanel
 
getInstance(theTableSource) - Static method in class net.maizegenetics.tassel.TableReportPanel
 
getInstance(filter) - Static method in class net.maizegenetics.tassel.TableReportPanel
 
getInstance(topm) - Static method in class net.maizegenetics.tassel.TableReportPanel
 
getInstance(taxaList) - Static method in class net.maizegenetics.tassel.TableReportPanel
 
getInstance(positionList) - Static method in class net.maizegenetics.tassel.TableReportPanel
 
getInstance(parentFrame) - Static method in class net.maizegenetics.tassel.TasselLogging
 
getInstance(taxa) - Static method in class net.maizegenetics.taxa.distance.DistanceMatrixBuilder
 
getInstance(numTaxa) - Static method in class net.maizegenetics.taxa.distance.DistanceMatrixBuilder
 
getInstance(numTaxa) - Static method in class net.maizegenetics.taxa.TaxaListBuilder
 
getInstance() - Static method in class net.maizegenetics.util.FormattedInput
create new instance of this object (note that there is no public constructor because this class is a singleton!)
getInstance() - Static method in class net.maizegenetics.util.FormattedOutput
create instance of this class (note that there is no public constructor as this class is a singleton)
getInstance(numRows, numColumns) - Static method in class net.maizegenetics.util.SuperByteMatrixBuilder
This returns a SuperByteMatrix designed for better performance when column iteration loop inside row iteration loop.
getInstance(tableName, columnNames) - Static method in class net.maizegenetics.util.TableReportBuilder
 
getInstance(tableName, numColumns) - Static method in class net.maizegenetics.util.TableReportBuilder
 
getInstance(tableName, columnNames, filename) - Static method in class net.maizegenetics.util.TableReportBuilder
 
getInstance(bitSet) - Static method in class net.maizegenetics.util.UnmodifiableBitSet
 
getInstanceCompareAlignments(align1, align2, name, type) - Static method in class net.maizegenetics.gui.GenotypeTableMaskBoolean
 
getInstanceCompareReference(align) - Static method in class net.maizegenetics.gui.GenotypeTableMaskBoolean
 
getInstanceCompareReference(align, id) - Static method in class net.maizegenetics.gui.GenotypeTableMaskBoolean
 
getInstanceCompareReference(align, index) - Static method in class net.maizegenetics.gui.GenotypeTableMaskBoolean
 
getInstanceCompareReference(align, id) - Static method in class net.maizegenetics.gui.GenotypeTableMaskBoolean
 
getInstanceCompareReference(align, ref, name) - Static method in class net.maizegenetics.gui.GenotypeTableMaskBoolean
 
getInstanceCompareReference(align, id, distances) - Static method in class net.maizegenetics.gui.GenotypeTableMaskGeneticDistance
 
getInstanceCompareReference(align, id, distances) - Static method in class net.maizegenetics.gui.GenotypeTableMaskGeneticDistance
 
getInstanceCompareReference(align, index, distances) - Static method in class net.maizegenetics.gui.GenotypeTableMaskGeneticDistance
 
getInstanceCompareReference(align) - Static method in class net.maizegenetics.gui.GenotypeTableMaskReference
 
getInstanceCompareReference(align, id) - Static method in class net.maizegenetics.gui.GenotypeTableMaskReference
 
getInstanceCompareReference(align, id) - Static method in class net.maizegenetics.gui.GenotypeTableMaskReference
 
getInstanceCompareReference(align, index) - Static method in class net.maizegenetics.gui.GenotypeTableMaskReference
 
getInstanceCopy(genotype) - Static method in class net.maizegenetics.dna.snp.genotypecall.GenotypeCallTableBuilder
 
getInstanceCopy(matrix) - Static method in class net.maizegenetics.util.SuperByteMatrixBuilder
 
getInstanceFromModel(baseModel, dataList) - Static method in class net.maizegenetics.stats.linearmodels.SolveByOrthogonalizing
 
getInstanceFromVectors(basisVectors, dataList) - Static method in class net.maizegenetics.stats.linearmodels.SolveByOrthogonalizing
 
getInstanceMaskIndels(genotype) - Static method in class net.maizegenetics.dna.snp.GenotypeTableBuilder
 
getInstanceOnlyMajorMinor(genotype) - Static method in class net.maizegenetics.dna.snp.GenotypeTableBuilder
 
getInstanceRemoveHeterozygous(genotype) - Static method in class net.maizegenetics.dna.snp.MaskMatrixBuilder
 
getInstanceRemoveHomozygous(genotype) - Static method in class net.maizegenetics.dna.snp.MaskMatrixBuilder
 
getInstanceRemoveIDs(a, subTaxaList) - Static method in class net.maizegenetics.dna.snp.FilterGenotypeTable
Removes specified IDs.
getInstanceRemoveIndels(genotype) - Static method in class net.maizegenetics.dna.snp.MaskMatrixBuilder
 
getInstanceRemoveMinorSNPs(genotype) - Static method in class net.maizegenetics.dna.snp.MaskMatrixBuilder
 
getInstanceRemoveSiteNames(a, siteNamesToRemove) - Static method in class net.maizegenetics.dna.snp.FilterGenotypeTable
 
getInstanceRemoveSiteNames(a, siteNamesToRemove) - Static method in class net.maizegenetics.dna.snp.FilterGenotypeTable
 
getInstances(parentFrame) - Static method in class net.maizegenetics.analysis.workflow.WorkflowPlugin
 
getInstanceSingleValue(numRows, numColumns, value) - Static method in class net.maizegenetics.util.SuperByteMatrixBuilder
 
getInstanceSortTaxaAlphabetically(genotypes) - Static method in class net.maizegenetics.dna.snp.FilterGenotypeTable
 
getInstanceTaxaOrderedByGeneticDistance(genotypes, taxon) - Static method in class net.maizegenetics.dna.snp.FilterGenotypeTable
 
getInstanceTranspose(numTaxa, numSites) - Static method in class net.maizegenetics.dna.snp.genotypecall.GenotypeCallTableBuilder
Get Genotype Builder given number of taxa and sites. Performance optimized for taxon loop inside site loop. Default is unphased and NucleotideAlignmentConstants.NUCLEOTIDE_ALLELES encoding.
getInstanceTranspose(numRows, numColumns) - Static method in class net.maizegenetics.util.SuperByteMatrixBuilder
This returns a SuperByteMatrix designed for better performance when row iteration loop inside column iteration loop.
getInstanceTranspose(matrix) - Static method in class net.maizegenetics.util.SuperByteMatrixBuilder
This returns a SuperByteMatrix that performs better in the reverse row / column iteration nesting than the given matrix.
getIntegerLevels(originalLevels) - Static method in class net.maizegenetics.stats.linearmodels.ModelEffectUtils
 
getIntegerLevels(originalLevels, ids) - Static method in class net.maizegenetics.stats.linearmodels.ModelEffectUtils
 
getIntegerLevels(genotypes, ids) - Static method in class net.maizegenetics.stats.linearmodels.ModelEffectUtils
 
getIntegerLevels(originalLevels, ids) - Static method in class net.maizegenetics.stats.linearmodels.ModelEffectUtils
 
getIntegerLevels(originalLevels) - Static method in class net.maizegenetics.stats.linearmodels.ModelEffectUtils
 
getIntegerLevels(originalLevels) - Static method in class net.maizegenetics.stats.linearmodels.ModelEffectUtils
 
getIntegerLevelsSortedByGenotype(originalLevels, ids) - Static method in class net.maizegenetics.stats.linearmodels.ModelEffectUtils
 
getInternalNode(i) - Method in class net.maizegenetics.taxa.tree.SimpleTree
Returns the ith internal node.
getInternalNode(i) - Method in interface net.maizegenetics.taxa.tree.Tree
 
getInternalNodeCount(root) - Static method in class net.maizegenetics.taxa.tree.NodeUtils
 
getInternalNodeCount() - Method in class net.maizegenetics.taxa.tree.SimpleTree
Returns the number of internal nodes.
getInternalNodeCount() - Method in interface net.maizegenetics.taxa.tree.Tree
 
getInternalNodes(root, store) - Static method in class net.maizegenetics.taxa.tree.NodeUtils
Appends all internal nodes from tree defined by root to Vector store
getInternalNodes(root, includeRoot) - Static method in class net.maizegenetics.taxa.tree.NodeUtils
Obtains all internal nodes from tree defined by root and returns as an array
getInternalParameterBoundaries(parameter, storage) - Method in interface net.maizegenetics.stats.math.OrthogonalHints
A boundary is a value of a parameter for which values lower than the boundary and values higher than the boundary are better treated as two separate functions (IE, they are only piecewise connected), and minimisation should be performed over both ranges individually (and then the true minimum taken as the minimuma of the ranges)
getInternalParameterBoundaries(base, parameter) - Static method in class net.maizegenetics.stats.math.OrthogonalHints.Utils
 
getInterval(chromosome, position) - Method in class net.maizegenetics.analysis.imputation.AGPMap
 
getIntFromLong(val) - Static method in class net.maizegenetics.dna.BaseEncoder
Split a 2-bit encoded long into 2 integers.
getIntFromSeq(seq) - Static method in class net.maizegenetics.analysis.monetdb.ColumnsToBinaryUtils
 
getIntFromSeq(seq) - Static method in class net.maizegenetics.dna.BaseEncoder
Returns an int for a sequence in a String NOTE: this version leaves the padding at the FRONT of the sequence. This is to facilitate SPARK machine-learning IT is preferable to have a smaller int when creating the sequence. Padding at the end gives a larger value. Currently this is only used for monetdb encoding. The ints can be converted back to sequence by the existing getSequenceFromInt() method. User needs to know where padding was added to correctly analyze the sequence.
getIntPref(path, key, def) - Static method in class net.maizegenetics.prefs.TasselPrefs
 
getIntStorageFeatures() - Method in class net.maizegenetics.dna.tag.AbstractTagsHDF5
Returns default deflation level of boolean, byte, short, int, long, Enum See class Tassel5HDF5Constants
getInverse(exclude) - Method in class net.maizegenetics.stats.linearmodels.SymmetricMatrixInverterDM
Calculates a new inverse when rows/columns of the original matrix have been removed. Each element of exclude corresponds to a row/column of the matrix. If exclude is true, then that row/column in removed.
getInverse(exclude, size) - Method in class net.maizegenetics.stats.linearmodels.SymmetricMatrixInverterDM
Calculates a new inverse when rows/columns of the original matrix have been removed. Each element of exclude corresponds to a row/column of the matrix. If exclude is true, then that row/column in removed.
getInverseOfXtX() - Method in class net.maizegenetics.stats.linearmodels.SweepFastLinearModel
 
getInverseOfXtX() - Method in class net.maizegenetics.stats.linearmodels.SweepFastNestedModel
 
getInvH() - Method in class net.maizegenetics.stats.EMMA.EMMAforDoubleMatrix
 
getIsAccumulateResults() - Method in class net.maizegenetics.analysis.popgen.LinkageDisequilibriumPlugin
 
getItemCount(parm1) - Method in class net.maizegenetics.analysis.chart.TableReportManhattanDataset
 
getItemCount(parm1) - Method in class net.maizegenetics.analysis.chart.TableReportQQDataset
 
getItemCount(parm1) - Method in class net.maizegenetics.analysis.chart.TableReportXYDataset
 
getIterator() - Method in class net.maizegenetics.analysis.clustering.HaplotypeCluster
 
getIUPACAllele(allele) - Static method in class net.maizegenetics.analysis.gbs.DiscoverySNPCallerPlugin
 
getJavaPackages() - Static method in class net.maizegenetics.util.Utils
 
getKey(taxon, site) - Static method in class net.maizegenetics.analysis.avro.AvroConstants
 
getKey(taxon, site) - Static method in class net.maizegenetics.dna.snp.genotypecall.GOBIIAvroGenotypeCallTable
 
getKnownVariants() - Method in class net.maizegenetics.dna.map.GeneralPosition
 
getKnownVariants() - Method in interface net.maizegenetics.dna.map.Position
Returns the nature of the polymorphism {"ACTAT","-"} or {"A","C","G"} or {"100","103","106"}
getLabel(id, defaultLabel) - Method in class net.maizegenetics.taxa.tree.LabelMapping
 
getLabelCount() - Method in class net.maizegenetics.taxa.tree.CladeSystem
get number of labels
getLabelCount() - Method in class net.maizegenetics.taxa.tree.SplitSystem
get number of labels
getLabelIdentifier(id) - Method in class net.maizegenetics.taxa.tree.LabelMapping
 
getLabelInstance(label) - Static method in class net.maizegenetics.plugindef.PluginParameter
 
getLaneAnnotatedTaxaList(keyPath, fastQpath) - Static method in class net.maizegenetics.analysis.gbs.v2.GBSUtils
Returns an annotated taxaList based on a Keyfile for GBS
getLaneAnnotatedTaxaList(keyPath, fastQpath, useNew) - Static method in class net.maizegenetics.util.ConvertOldFastqToModernFormatPlugin
 
getLastGeneticPosition(chromosome) - Method in class net.maizegenetics.analysis.imputation.AGPMap
 
getLDForSitePair(rMj, rMn, cMj, cMn, minMinorCnt, minCnt, minR2, myFisherExact, site1Index, site2Index) - Static method in class net.maizegenetics.analysis.popgen.LinkageDisequilibrium
Method for estimating LD between a pair of bit sets. Since there can be tremendous missing data, minimum minor and minimum site counts ensure that meaningful results are estimated. Site indices are merely there for annotating the LDResult.
getLDType() - Method in class net.maizegenetics.analysis.popgen.LinkageDisequilibriumPlugin
 
getLeafCount(node) - Static method in class net.maizegenetics.taxa.tree.NodeUtils
Return the number of terminal leaves below this node or 1 if this is a terminal leaf.
getLeafIdGroup(tree) - Static method in class net.maizegenetics.taxa.tree.TreeUtils
get list of the identifiers of the external nodes
getLeftPrefix(block) - Method in class net.maizegenetics.analysis.gbs.neobio.CrochemoreLandauZivUkelson
This method is a shorthand to retrieve the left prefix of a block from the block table.
getLeftTailedP(a, b, c, d) - Method in class net.maizegenetics.stats.statistics.FisherExact
Calculates the left-tail P-value for the Fisher Exact test.
getLength() - Method in class net.maizegenetics.analysis.gbs.ReadBarcodeResult
 
getLength() - Method in class net.maizegenetics.analysis.gbs.ShortReadBarcodeResult
Return the length of the genomic sequence
getLength() - Method in class net.maizegenetics.dna.map.Chromosome
 
getLengthB() - Method in class net.maizegenetics.analysis.gbs.PEReadBarcodeResult
Return length of backward sequence
getLengthF() - Method in class net.maizegenetics.analysis.gbs.PEReadBarcodeResult
Return length of forward sequence
getLevelCounts() - Method in class net.maizegenetics.analysis.modelfitter.AddPlusDomModelEffect
 
getLevelCounts() - Method in class net.maizegenetics.stats.linearmodels.CovariateModelEffect
 
getLevelCounts() - Method in class net.maizegenetics.stats.linearmodels.FactorModelEffect
 
getLevelCounts() - Method in interface net.maizegenetics.stats.linearmodels.ModelEffect
 
getLevelCounts() - Method in class net.maizegenetics.stats.linearmodels.NestedCovariateModelEffect
 
getLevels() - Method in class net.maizegenetics.stats.linearmodels.FactorModelEffect
 
getLibraryID() - Method in class net.maizegenetics.analysis.gobii.MarkerDNARun_IFLFilePlugin.HmpTaxaData
 
getLinearModel() - Method in class net.maizegenetics.stats.linearmodels.LinearModelForStepwiseRegression
 
getLinearModel() - Method in class net.maizegenetics.stats.linearmodels.PartitionedLinearModel
 
getLinkageDiseqDisplayPlugin(type) - Method in class net.maizegenetics.pipeline.TasselPipeline
 
getListCellRendererComponent(list, value, index, isSelected, cellHasFocus) - Method in class net.maizegenetics.gui.RowHeaderRenderer
 
getListeners() - Method in class net.maizegenetics.plugindef.AbstractPlugin
 
getListOfTaxa(filename) - Static method in class net.maizegenetics.analysis.imputation.ImputationUtils
 
getLnLikelihood() - Method in class net.maizegenetics.stats.EMMA.EMMAforDoubleMatrix
 
getLnProbObsGivenState(state, obs) - Method in class net.maizegenetics.analysis.imputation.EmissionProbability
 
getLnProbObsGivenState(state, obs, node) - Method in class net.maizegenetics.analysis.imputation.EmissionProbability
 
getLnTransitionProbability(state1, state2) - Method in class net.maizegenetics.analysis.imputation.TransitionProbability
 
getLocale() - Static method in class net.maizegenetics.prefs.TasselPrefs
 
getLoci() - Method in class net.maizegenetics.dna.map.AbstractTagsOnPhysicalMap
 
getLoci() - Method in interface net.maizegenetics.dna.map.TOPMInterface
Returns Loci created from getChromosomes().
getLocus() - Method in class net.maizegenetics.analysis.distance.DistanceMatrixRangesPlugin
 
getLocus() - Method in class net.maizegenetics.analysis.filter.FilterAlignmentPlugin
 
getLocus(tagIndex) - Method in class net.maizegenetics.dna.map.AbstractTagsOnPhysicalMap
 
getLocus(tagIndex) - Method in interface net.maizegenetics.dna.map.TOPMInterface
Get Chromosome representing chromosome for given tag.
getLocusReport(minTaxaWithLocus, varSiteKept) - Method in class net.maizegenetics.dna.map.TagLocus
 
getLocusStr() - Method in class net.maizegenetics.analysis.filter.FilterAlignmentPlugin
 
getLogDebug() - Static method in class net.maizegenetics.prefs.TasselPrefs
 
getLogs() - Method in class net.maizegenetics.util.ChangeLog
 
getLogSendToConsole() - Static method in class net.maizegenetics.prefs.TasselPrefs
 
getLogXDim() - Static method in class net.maizegenetics.prefs.TasselPrefs
 
getLogYDim() - Static method in class net.maizegenetics.prefs.TasselPrefs
 
getLongArrayFromSeq(seq) - Static method in class net.maizegenetics.dna.BaseEncoder
 
getLongArrayFromSeq(seq, paddedLength) - Static method in class net.maizegenetics.dna.BaseEncoder
 
getLongArrayFromSeq(seq) - Static method in class net.maizegenetics.dna.tag.AbstractTag
 
getLongFromSeq(seq) - Static method in class net.maizegenetics.dna.BaseEncoder
Returns a long for a sequence in a String
getLongSeqFromByteArray(b) - Static method in class net.maizegenetics.dna.BaseEncoder
Returns the 2-bit encoded long represented by 32 bytes representing class NucleotideAlignmentConstants representation. It is padded by As if shorter than 32 bytes, -1 returned if longer than 32. The byte array values must be 0-3. If the array contains a value outside that range returns -1.
getLookupTable() - Method in class net.maizegenetics.analysis.chart.TableReportQQDataset
 
getLowerCorner() - Method in class net.maizegenetics.analysis.popgen.LinkageDiseqDisplayPlugin
 
getLowerLimit(n) - Method in class net.maizegenetics.taxa.tree.MultiParameterized
 
getLowerLimit(n) - Method in interface net.maizegenetics.taxa.tree.Parameterized
get lower parameter limit
getLowerLimit(n) - Method in class net.maizegenetics.taxa.tree.Parameterized.Null
 
getLowerLimit(n) - Method in class net.maizegenetics.taxa.tree.Parameterized.ParameterizedBase
 
getLowerLimit(n) - Method in class net.maizegenetics.taxa.tree.Parameterized.ParameterizedUser
 
getMainComponent() - Method in class net.maizegenetics.analysis.chart.BarChartPanel
 
getMainComponent() - Method in class net.maizegenetics.analysis.chart.BasicChartPanel
 
getMainComponent() - Method in class net.maizegenetics.analysis.chart.HistogramPanel
 
getMainComponent() - Method in class net.maizegenetics.analysis.chart.PieChartPanel
 
getMainComponent() - Method in class net.maizegenetics.analysis.chart.XYScatterAndLinePanel
 
getMainComponent() - Method in class net.maizegenetics.analysis.chart.XYScatterMultipleYPanel
 
getMainComponent() - Method in class net.maizegenetics.analysis.chart.XYScatterPanel
 
getMajorAlleleFromSnpset(snpset, alpha) - Static method in class net.maizegenetics.analysis.imputation.NucleotideImputationUtils
 
getMajorAlleleFromSnpset(snpset) - Static method in class net.maizegenetics.analysis.imputation.NucleotideImputationUtils
 
getMajorityHaplotype() - Method in class net.maizegenetics.analysis.clustering.HaplotypeCluster
The majority haplotype of this cluster where each site is assigned value of the major allele within the cluster.
getManhattanDistance(loc, t, nsnps) - Static method in class net.maizegenetics.analysis.imputation.ImputationUtils
 
getMapOfTaxonByAnnotation(taxaList, annotation) - Static method in class net.maizegenetics.taxa.TaxaListIOUtils
Create a Multimap of all the taxa associated with a particular annotation value.
getMapP(index) - Method in class net.maizegenetics.dna.map.TagsOnPhysicalMap
 
getMapP(tagIndex) - Method in class net.maizegenetics.dna.map.TagsOnPhysicalMapV3
 
getMapP(index) - Method in class net.maizegenetics.dna.map.TagsOnPhysMapHDF5
 
getMapP(index) - Method in interface net.maizegenetics.dna.map.TOPMInterface
 
getMappingIndicesOfAligner(alignerName) - Method in class net.maizegenetics.dna.map.TagsOnPhysicalMapV3
Return the map indices of an aligner
getMappingInfo(tagIndex, mapIndex) - Method in class net.maizegenetics.dna.map.TagsOnPhysicalMapV3
Return tag mapping information of a tag in one map
getMappingInfoChunk(tagIndex) - Method in class net.maizegenetics.dna.map.TagsOnPhysicalMapV3
Return mapping information of a while chunk, avoid issues while multi threads are trying to get TMI info, specifically for hypothesis genetic mapping
getMappingNum(index) - Method in class net.maizegenetics.dna.map.PETagsOnPhysicalMapV3
Return the number of mapping (multiple alignments)
getMappingNum() - Method in class net.maizegenetics.dna.map.TagsOnPhysicalMapV3
Return number of mapping result
getMapSize() - Method in class net.maizegenetics.analysis.popgen.LinkageDisequilibriumMinimapComponent
Returns map size
getMarginalSSdf(effect) - Method in class net.maizegenetics.stats.linearmodels.SweepFastLinearModel
 
getMarker(series, item) - Method in class net.maizegenetics.analysis.chart.TableReportManhattanDataset
 
getMarkerEffectReport() - Method in class net.maizegenetics.analysis.modelfitter.StepwiseAdditiveModelFitter
 
getMarkerEffectReport() - Method in class net.maizegenetics.analysis.modelfitter.StepwiseOLSModelFitter
 
getMarkerEffectReportWithCI() - Method in class net.maizegenetics.analysis.modelfitter.StepwiseAdditiveModelFitter
 
getMarkerEffectReportWithCI() - Method in class net.maizegenetics.analysis.modelfitter.StepwiseOLSModelFitter
 
getMarkerFp() - Method in class net.maizegenetics.stats.EMMA.EMMAforDoubleMatrix
 
getMarkerName(marker) - Static method in class net.maizegenetics.analysis.imputation.AGPMap
 
getMarkerNameFromLine(mline, isVCF, tabPos, mapsetname) - Static method in class net.maizegenetics.analysis.gobii.GOBII_IFLUtils
 
getMarkerNumber(marker) - Static method in class net.maizegenetics.analysis.imputation.AGPMap
 
getMarkerPosition(marker) - Static method in class net.maizegenetics.analysis.imputation.AGPMap
 
getMarkers() - Method in class net.maizegenetics.analysis.chart.TableReportQQDataset
 
getMarkerSSdf() - Method in class net.maizegenetics.stats.linearmodels.SweepFastNestedModel
 
getMask(taxon, site) - Method in interface net.maizegenetics.gui.GenotypeTableMask
 
getMask(taxon, site) - Method in class net.maizegenetics.gui.GenotypeTableMaskBoolean
 
getMask(taxon, site) - Method in class net.maizegenetics.gui.GenotypeTableMaskGeneticDistance
 
getMask(taxon, site) - Method in class net.maizegenetics.gui.GenotypeTableMaskReference
 
getMaskBitSet() - Method in interface net.maizegenetics.dna.map.GVCFGenomeSequence
 
getMaskInstance(base, mask) - Static method in class net.maizegenetics.dna.snp.score.AlleleDepthBuilder
 
getMaskInstance(base, mask) - Static method in class net.maizegenetics.dna.snp.score.AlleleProbabilityBuilder
 
getMaskInstance(base, mask) - Static method in class net.maizegenetics.dna.snp.score.DosageBuilder
 
getMaskInstance(base, mask) - Static method in class net.maizegenetics.dna.snp.score.ReferenceProbabilityBuilder
 
getMaskType() - Method in class net.maizegenetics.gui.AbstractGenotypeTableMask
 
getMaskType() - Method in interface net.maizegenetics.gui.GenotypeTableMask
 
getMatrix() - Method in class net.maizegenetics.matrixalgebra.decomposition.EJMLSingularValueDecomposition
 
getMatrix() - Method in class net.maizegenetics.matrixalgebra.Matrix.BlasDoubleMatrix
 
getMatrixCopy() - Method in class net.maizegenetics.matrixalgebra.Matrix.BlasDoubleMatrix
 
getMaxFreq() - Method in class net.maizegenetics.analysis.filter.FilterAlignmentPlugin
 
getMaxHeapSizeMB() - Static method in class net.maizegenetics.util.Utils
Returns max heap size in MB.
getMaximumDistance(hap) - Method in class net.maizegenetics.analysis.clustering.HaplotypeCluster
 
getMaximumPathLengthLengthToLeaf(root) - Static method in class net.maizegenetics.taxa.tree.NodeUtils
 
getMaximumSize(c) - Method in class net.maizegenetics.gui.VerticalLabelUI
 
getMaxNodeDepth(root) - Static method in class net.maizegenetics.taxa.tree.NodeUtils
 
getMaxNumVariants() - Method in class net.maizegenetics.dna.map.AbstractTagsOnPhysicalMap
 
getMaxNumVariants() - Method in class net.maizegenetics.dna.map.TagsOnPhysicalMap
 
getMaxNumVariants() - Method in interface net.maizegenetics.dna.map.TOPMInterface
Returns maximum number of variants stored per tag.
getMaxp() - Method in class net.maizegenetics.analysis.association.MLMPlugin
 
getMaxp() - Method in class net.maizegenetics.analysis.association.WeightedMLMPlugin
 
getMaxP() - Method in class net.maizegenetics.gui.ReportDestinationDialog
 
getMaxStartPosition() - Method in class net.maizegenetics.dna.map.TagLocus
 
getMaxTagLength() - Method in class net.maizegenetics.dna.map.TagLocus
 
getMaxThreads() - Static method in class net.maizegenetics.prefs.TasselPrefs
 
getMD5Checksum(filename) - Static method in class net.maizegenetics.util.CheckSum
 
getMeanCladeHeight(clade, trees) - Static method in class net.maizegenetics.taxa.tree.RootedTreeUtils
 
getMeanLocation(loc, size, t, add, nsnps) - Static method in class net.maizegenetics.analysis.imputation.ImputationUtils
 
getMeanLocation(locs) - Static method in class net.maizegenetics.analysis.imputation.ImputationUtils
 
getMeanSubtreeHeight(subtree, trees) - Static method in class net.maizegenetics.taxa.tree.RootedTreeUtils
 
getMedianQuality(phredScale) - Method in class net.maizegenetics.dna.read.Read
Return median quality of read
getMemoryUse() - Static method in class net.maizegenetics.util.Sizeof
 
getMenu() - Method in class net.maizegenetics.plugindef.AbstractPlugin
Returns menu that can be added to main menu bar.
getMenu() - Method in interface net.maizegenetics.plugindef.Plugin
Returns menu that can be added to main menu bar.
getMergedClusters(candidateClusters, maxdiff) - Static method in class net.maizegenetics.analysis.clustering.HaplotypeClusterer
Merges clusters whose maximum pairwise difference is less than maxdiff. Clusters are tested sequentially. That is, if two clusters are merged, they become the new head cluster against which remaining clusters are tested for merging.
getMergedInstance(dh1, dh2) - Static method in class net.maizegenetics.dna.map.DonorHaplotypes
 
getMergedPETagCounts(another, ifCollapsed) - Method in class net.maizegenetics.dna.tag.PETagCounts
Merge two PETagCounts objects
getMetaData() - Method in class net.maizegenetics.plugindef.PluginEvent
 
getMGID() - Method in class net.maizegenetics.analysis.gobii.MarkerDNARun_IFLFilePlugin.HmpTaxaData
 
getMinCount() - Method in class net.maizegenetics.analysis.filter.FilterAlignmentPlugin
 
getMinFreq() - Method in class net.maizegenetics.analysis.filter.FilterAlignmentPlugin
 
getMinimumPathLengthLengthToLeaf(root) - Static method in class net.maizegenetics.taxa.tree.NodeUtils
 
getMinimumSize(c) - Method in class net.maizegenetics.gui.VerticalLabelUI
 
getMinStartPosition() - Method in class net.maizegenetics.dna.map.TagLocus
 
getMinTagLength() - Method in class net.maizegenetics.dna.map.TagLocus
 
getMismatchInLong(longSeq1, longSeq2) - Method in class net.maizegenetics.analysis.gbs.PolymorphismFinder
 
getMismatchInLong(longSeq1, longSeq2) - Method in class net.maizegenetics.analysis.gbs.UTagPairFinder
 
getModelcfmSSdf() - Method in class net.maizegenetics.stats.linearmodels.SweepFastLinearModel
 
getModelcfmSSdf() - Method in class net.maizegenetics.stats.linearmodels.SweepFastNestedModel
 
getModeldf() - Method in class net.maizegenetics.stats.linearmodels.PartitionedLinearModel
 
getModelEffects() - Method in class net.maizegenetics.stats.linearmodels.LinearModelForStepwiseRegression
 
getModelSS() - Method in class net.maizegenetics.stats.linearmodels.PartitionedLinearModel
 
getMostProbableIntegerStateSequence() - Method in class net.maizegenetics.analysis.imputation.ViterbiAlgorithmVariableStateNumber
 
getMostProbableStateSequence() - Method in class net.maizegenetics.analysis.imputation.ViterbiAlgorithm
 
getMostProbableStateSequence() - Method in class net.maizegenetics.analysis.imputation.ViterbiAlgorithmVariableStateNumber
 
getMrkBlups() - Method in class net.maizegenetics.analysis.association.RegRidgeEmmaDoubleMatrix
 
getMrkEstsAsDoubleMatrix() - Method in class net.maizegenetics.analysis.association.RegRidgeEmmaDoubleMatrix
 
getMultiMaps(index) - Method in class net.maizegenetics.dna.map.AbstractTagsOnPhysicalMap
 
getMultiMaps(index) - Method in class net.maizegenetics.dna.map.TagsOnPhysicalMap
 
getMultiMaps(tagIndex) - Method in class net.maizegenetics.dna.map.TagsOnPhysicalMapV3
 
getMultiMaps(index) - Method in interface net.maizegenetics.dna.map.TOPMInterface
 
getMyDecomposition() - Method in class net.maizegenetics.matrixalgebra.decomposition.EJMLEigenvalueDecomposition
 
getMyMatrix() - Method in class net.maizegenetics.matrixalgebra.decomposition.EJMLSingularValueDecomposition
 
getMyMatrix() - Method in class net.maizegenetics.matrixalgebra.Matrix.EJMLDoubleMatrix
 
getMySvd() - Method in class net.maizegenetics.matrixalgebra.decomposition.EJMLSingularValueDecomposition
 
getName() - Method in class net.maizegenetics.dna.map.Chromosome
 
getName() - Method in enum net.maizegenetics.dna.map.TagMappingInfoV3.Aligner
 
getName() - Method in class net.maizegenetics.plugindef.Datum
 
getName() - Method in class net.maizegenetics.taxa.Taxon
 
getNameList(pedigree) - Method in class net.maizegenetics.analysis.distance.AMatrixPlugin
getNamSubPopulation(taxonname) - Static method in class net.maizegenetics.analysis.imputation.SubpopulationFinder
 
getNamSubPopulation(taxon) - Static method in class net.maizegenetics.analysis.imputation.SubpopulationFinder
 
getNewChar() - Method in class net.maizegenetics.analysis.gbs.neobio.Factor
Returns this factor's new character.
getNext() - Method in class net.maizegenetics.analysis.gbs.neobio.Factor
Returns this factor's next factor.
getNext() - Method in class net.maizegenetics.dna.tag.FastqReader
Returns single entry in fastq file consisting of 4 Strings.
getNext() - Method in interface net.maizegenetics.stats.math.OrderEnumerator
The next value in the enumeration
getNextBoolean() - Static method in class net.maizegenetics.stats.math.MersenneTwisterFast
Access a default instance of this class, access is synchronized
getNextByte() - Static method in class net.maizegenetics.stats.math.MersenneTwisterFast
Access a default instance of this class, access is synchronized
getNextBytes(bs) - Static method in class net.maizegenetics.stats.math.MersenneTwisterFast
Access a default instance of this class, access is synchronized
getNextChar() - Static method in class net.maizegenetics.stats.math.MersenneTwisterFast
Access a default instance of this class, access is synchronized
getNextColor() - Static method in class net.maizegenetics.gui.AbstractGenotypeTableMask
 
getNextDouble() - Static method in class net.maizegenetics.stats.math.MersenneTwisterFast
Access a default instance of this class, access is synchronized
getNextFloat() - Static method in class net.maizegenetics.stats.math.MersenneTwisterFast
Access a default instance of this class, access is synchronized
getNextInt() - Static method in class net.maizegenetics.stats.math.MersenneTwisterFast
Access a default instance of this class, access is synchronized
getNextLong() - Static method in class net.maizegenetics.stats.math.MersenneTwisterFast
Access a default instance of this class, access is synchronized
getNextShort() - Static method in class net.maizegenetics.stats.math.MersenneTwisterFast
Access a default instance of this class, access is synchronized
getNodeByName(tree, name) - Static method in class net.maizegenetics.taxa.tree.TreeUtils
 
getNodeByName(root, name) - Static method in class net.maizegenetics.taxa.tree.TreeUtils
 
getNodeHeight() - Method in interface net.maizegenetics.taxa.tree.Node
Get the height of this node relative to the most recent node.
getNodeHeight() - Method in class net.maizegenetics.taxa.tree.SimpleNode
Get the height of this node relative to the most recent node.
getNonMissingBytes(allData, missing) - Static method in class net.maizegenetics.analysis.association.AssociationUtils
 
getNonMissingDoubles(allData, missing) - Static method in class net.maizegenetics.analysis.association.AssociationUtils
 
getNonMissingDoubles(allData, missing) - Static method in class net.maizegenetics.analysis.association.AssociationUtils
 
getNonMissingElements(array, missing) - Static method in class net.maizegenetics.stats.linearmodels.LinearModelUtils
 
getNonMissingElements(array, missing) - Static method in class net.maizegenetics.stats.linearmodels.LinearModelUtils
 
getNonMissingValues(allData, missing) - Static method in class net.maizegenetics.analysis.association.AssociationUtils
 
getNonMissingValues(allData, missing) - Static method in class net.maizegenetics.analysis.association.AssociationUtils
 
getNucleotideAlleleByte(value) - Static method in class net.maizegenetics.dna.snp.NucleotideAlignmentConstants
Returns haploid byte value for given nucleotide value. Only right-most four bits used.
getNucleotideAlleleByte(value) - Static method in class net.maizegenetics.dna.snp.NucleotideAlignmentConstants
Returns haploid byte value for given nucleotide value. Only right-most four bits used.
getNucleotideAlleleValue(value) - Static method in class net.maizegenetics.dna.snp.NucleotideAlignmentConstants
Returns char allele for allele byte encoding. THis is called from junit tests in ReferenceGenomeSequenceTest.java
getNucleotideComplement(nucleotide) - Static method in class net.maizegenetics.dna.snp.NucleotideAlignmentConstants
Returns the Nucleotide Complement of given byte encoded nucleotide. A returns T. T returns A. C returns G. G returns C. Otherwise given nucleotide is returned.
getNucleotideDiploidByte(value) - Static method in class net.maizegenetics.dna.snp.NucleotideAlignmentConstants
Returns diploid byte value for given nucleotide value. First four bits contain first allele value. And second four bits contain second allele value.
getNucleotideDiploidByte(value) - Static method in class net.maizegenetics.dna.snp.NucleotideAlignmentConstants
Returns diploid byte value for given nucleotide value. First four bits contain first allele value. And second four bits contain second allele value.
getNucleotideDiploidComplement(diploidAllele) - Static method in class net.maizegenetics.dna.snp.NucleotideAlignmentConstants
Returns the Nucleotide Complement of the given diploid byte encoded alleles.
getNucleotideDiploidIUPACComplement(diploidAllele) - Static method in class net.maizegenetics.dna.snp.NucleotideAlignmentConstants
Returns the Nucleotide Complement of the given diploid IUPAC encoded alleles.
getNucleotideIUPAC(value) - Static method in class net.maizegenetics.dna.snp.NucleotideAlignmentConstants
Returns the IUPAC String for the given diploid allele value.
getNucleotideIUPACChar(value) - Static method in class net.maizegenetics.dna.snp.NucleotideAlignmentConstants
Returns the IUPAC char for the given diploid allele value.
getNucleotideRendering(table, value, isSelected, hasFocus, row, col) - Method in class net.maizegenetics.gui.AlignmentTableCellRenderer
 
getNull() - Static method in class net.maizegenetics.stats.math.OrthogonalHints.Utils
 
getNullTag() - Method in class net.maizegenetics.dna.map.PETagsOnPhysicalMapV3
 
getNullTag() - Method in class net.maizegenetics.dna.tag.AbstractTags
 
getNullTag() - Method in interface net.maizegenetics.dna.tag.Tags
Returns a polyA string of length 32*getTagSizeInLong()
getNum() - Method in class net.maizegenetics.analysis.gobii.MarkerDNARun_IFLFilePlugin.HmpTaxaData
 
getNumAccumulateIntervals() - Method in class net.maizegenetics.analysis.popgen.LinkageDisequilibriumPlugin
 
getNumber() - Method in interface net.maizegenetics.taxa.tree.Node
return the index of this node
getNumber() - Method in class net.maizegenetics.taxa.tree.SimpleNode
 
getNumberLines(filename) - Static method in class net.maizegenetics.util.Utils
Return number of lines in given file.
getNumberLinesNotHashOrBlank(filename) - Static method in class net.maizegenetics.util.Utils
Return number of lines in given file that doesn't begin with Hash (#) and isn't blank.
getNumberOfChunks() - Method in class net.maizegenetics.dna.tag.TagsByTaxaByteHDF5TaxaGroups
 
getNumberOfClusters() - Method in class net.maizegenetics.analysis.clustering.HaplotypeClusterer
 
getNumberOfGroups() - Method in class net.maizegenetics.analysis.association.CompressedDoubleMatrix
 
getNumberOfLevels() - Method in class net.maizegenetics.analysis.modelfitter.AddPlusDomModelEffect
 
getNumberOfLevels() - Method in class net.maizegenetics.stats.linearmodels.CovariateModelEffect
 
getNumberOfLevels() - Method in class net.maizegenetics.stats.linearmodels.FactorModelEffect
 
getNumberOfLevels() - Method in interface net.maizegenetics.stats.linearmodels.ModelEffect
 
getNumberOfLevels() - Method in class net.maizegenetics.stats.linearmodels.NestedCovariateModelEffect
 
getNumberOfSites() - Method in class net.maizegenetics.analysis.clustering.HaplotypeCluster
 
getNumberOfStates() - Method in class net.maizegenetics.analysis.imputation.TransitionProbability
 
getNumberOfSublevels() - Method in class net.maizegenetics.stats.linearmodels.BasicLevel
 
getNumberOfSublevels() - Method in interface net.maizegenetics.stats.linearmodels.Level
 
getNumberOfTagsPerChunk() - Method in class net.maizegenetics.dna.tag.TagsByTaxaByteHDF5TaxaGroups
 
getNumberOfTaxaWithTag(readIndex) - Method in class net.maizegenetics.dna.tag.AbstractTagsByTaxa
 
getNumberOfTaxaWithTag(readIndex) - Method in interface net.maizegenetics.dna.tag.TagsByTaxa
Get the number of taxa with a given tag It is count of the taxa with readCount>0
getNumberTaxaCovered() - Method in class net.maizegenetics.dna.map.TagLocus
 
getNumColumns() - Method in class net.maizegenetics.util.ColumnMatrix
 
getNumColumns() - Method in interface net.maizegenetics.util.SuperByteMatrix
Return number of columns.
getNumColumns() - Method in class net.maizegenetics.util.SuperByteMatrixMultiple
 
getNumColumns() - Method in class net.maizegenetics.util.SuperByteMatrixSingle
 
getNumColumns() - Method in class net.maizegenetics.util.SuperByteMatrixSingleValue
 
getNumColumns() - Method in class net.maizegenetics.util.SuperByteMatrixTranspose
 
getNumericCodingForAdditiveModel(marker, allele) - Static method in class net.maizegenetics.stats.linearmodels.ModelEffectUtils
 
getNumericCodingForAdditiveModel(marker, allele) - Static method in class net.maizegenetics.stats.linearmodels.ModelEffectUtils
 
getNumOfAlign(tagIndex, mapIndex) - Method in class net.maizegenetics.analysis.gbs.AnnotateTOPM
Return number of alignment in an aligner
getNumOfAlignAll(tagIndex) - Method in class net.maizegenetics.analysis.gbs.AnnotateTOPM
Return number of alignment hypotheses across all aligners, excluding PEEnd1 and PEEnd2
getNumOfRank0(tagIndex, mapIndex) - Method in class net.maizegenetics.analysis.gbs.AnnotateTOPM
Return the number of Rank0 in an aligner
getNumParameters() - Method in class net.maizegenetics.taxa.tree.MultiParameterized
 
getNumParameters() - Method in interface net.maizegenetics.taxa.tree.Parameterized
get number of parameters
getNumParameters() - Method in class net.maizegenetics.taxa.tree.Parameterized.Null
 
getNumParameters() - Method in class net.maizegenetics.taxa.tree.Parameterized.ParameterizedBase
 
getNumParameters() - Method in class net.maizegenetics.taxa.tree.Parameterized.ParameterizedUser
 
getNumRows() - Method in class net.maizegenetics.util.ColumnMatrix
 
getNumRows() - Method in interface net.maizegenetics.util.SuperByteMatrix
Return number of rows.
getNumRows() - Method in class net.maizegenetics.util.SuperByteMatrixMultiple
 
getNumRows() - Method in class net.maizegenetics.util.SuperByteMatrixSingle
 
getNumRows() - Method in class net.maizegenetics.util.SuperByteMatrixSingleValue
 
getNumRows() - Method in class net.maizegenetics.util.SuperByteMatrixTranspose
 
getNumWords() - Method in interface net.maizegenetics.util.BitSet
Expert: gets the number of longs in the array that are in use
getNumWords() - Method in class net.maizegenetics.util.OpenBitSet
Expert: gets the number of longs in the array that are in use
getNumWords() - Method in class net.maizegenetics.util.UnmodifiableBitSet
 
getOkButton() - Method in class net.maizegenetics.gui.SelectFromAvailableSitesDialog
 
getOpenDir(parent) - Static method in class net.maizegenetics.gui.FileBrowserUtils
 
getOpenDir() - Static method in class net.maizegenetics.prefs.TasselPrefs
 
getOpenFile(parent) - Static method in class net.maizegenetics.gui.FileBrowserUtils
 
getOpenFiles() - Method in class net.maizegenetics.analysis.data.FileLoadPlugin
 
getOrdered(size) - Static method in class net.maizegenetics.stats.math.OrderEnumerator.Utils
 
getOrderedFactory() - Static method in class net.maizegenetics.stats.math.OrderEnumerator.Utils
 
getOrthogonalizedData() - Method in class net.maizegenetics.stats.linearmodels.SolveByOrthogonalizing
 
getOutformat() - Method in class net.maizegenetics.analysis.chart.AbstractDisplayPlugin
 
getOutput() - Method in class net.maizegenetics.analysis.gbs.TextToBinaryPlugin
 
getOutputFileName() - Method in class net.maizegenetics.gui.ReportDestinationDialog
 
getOutputName() - Method in class net.maizegenetics.analysis.association.MLMPlugin
 
getOutputName() - Method in class net.maizegenetics.analysis.association.WeightedMLMPlugin
 
getOverlapIdentity() - Method in class net.maizegenetics.dna.read.PERead
Return identity of overlap of PE
getOverlapLength() - Method in class net.maizegenetics.dna.read.PERead
Return length of overlap of PE
getp() - Method in class net.maizegenetics.stats.linearmodels.PartitionedLinearModel
 
getP(a, b, c, d) - Method in class net.maizegenetics.stats.statistics.FisherExact
calculates the P-value for this specific state
getPackagesFromClassPath(classpath) - Static method in class net.maizegenetics.util.Utils
 
getPairIndex(index) - Method in class net.maizegenetics.dna.map.PETagsOnPhysicalMapV3
Return the index of the tag which is the other end of PE
getPairwiseAlignment() - Method in class net.maizegenetics.analysis.gbs.neobio.PairwiseAlignmentAlgorithm
Return the last pairwise alignment computed (if any) or request subclasses to compute one and return the result by calling the computePairwiseAlignment method. The sequences must already be loaded and a scoring scheme must already be set.
getPanel() - Method in class net.maizegenetics.plugindef.AbstractPlugin
GUI Panel for this plugin.
getPanel() - Method in class net.maizegenetics.plugindef.AbstractPluginAction
GUI Panel for associated plugin.
getPanel() - Method in interface net.maizegenetics.plugindef.Plugin
GUI Panel for this plugin.
getPanel() - Method in interface net.maizegenetics.plugindef.PluginAction
GUI Panel for associated plugin.
getParameter(key) - Method in class net.maizegenetics.plugindef.AbstractPlugin
 
getParameter(key) - Method in class net.maizegenetics.plugindef.AbstractPlugin
 
getParameter(key) - Method in interface net.maizegenetics.plugindef.Plugin
Returns parameter value for given parameter key.
getParameter(key) - Method in interface net.maizegenetics.plugindef.Plugin
Returns parameter value for given parameter key.
getParameter(n) - Method in class net.maizegenetics.taxa.tree.MultiParameterized
 
getParameter(n) - Method in interface net.maizegenetics.taxa.tree.Parameterized
get model parameter
getParameter(n) - Method in class net.maizegenetics.taxa.tree.Parameterized.Null
 
getParameter(n) - Method in class net.maizegenetics.taxa.tree.Parameterized.ParameterizedBase
 
getParameter(n) - Method in class net.maizegenetics.taxa.tree.Parameterized.ParameterizedUser
 
getParameterFields() - Method in class net.maizegenetics.plugindef.AbstractPlugin
 
getParameters(source) - Static method in class net.maizegenetics.taxa.tree.Parameterized.Utils
 
getParametersSE() - Method in class net.maizegenetics.taxa.tree.Parameterized.ParameterizedBase
 
getParent() - Method in interface net.maizegenetics.taxa.tree.Node
Returns the parent node of this node.
getParent() - Method in class net.maizegenetics.taxa.tree.SimpleNode
Returns the parent node of this node.
getParent1index() - Method in class net.maizegenetics.dna.map.DonorHaplotypes
 
getParent2index() - Method in class net.maizegenetics.dna.map.DonorHaplotypes
 
getParentalGenotype(genos, parentIndices, site) - Method in class net.maizegenetics.analysis.data.GenosToABHPlugin
 
getParentFrame() - Method in class net.maizegenetics.plugindef.AbstractPlugin
Parent Frame for this plugin. Can be null.
getParentFrame() - Method in interface net.maizegenetics.plugindef.Plugin
Parent Frame for this plugin. Can be null.
getParentFromGffAttributes(attributes) - Static method in class net.maizegenetics.dna.map.GenomeFeatureBuilder
Parse a GFF attribute field to identify the parent of the current GenomeFeature. Tricky b/c of the different ways it can be represented. There's a hierarchy of accepted answers, with 'parent_id', 'Parent=', 'transcript_id', and 'gene_id' taken in that order. If nothing is found, returns an empty string ("")
getParentHaplotypes(previousParents, candidates, overlap, forward) - Static method in class net.maizegenetics.analysis.imputation.BiparentalHaplotypeFinder
 
getParentHaplotypesV1(previousParents, candidates, overlap, forward) - Static method in class net.maizegenetics.analysis.imputation.BiparentalHaplotypeFinder
 
getPathLengthInfo(root) - Static method in class net.maizegenetics.taxa.tree.NodeUtils
Calculates max/min lengths of paths from root to leaf, taking into account branch lengths
getPBest(tagIndex) - Method in class net.maizegenetics.analysis.gbs.AnnotateTOPM
Return the most significant p-value across all hypotheses
getPContig() - Method in class net.maizegenetics.dna.read.PERead
Return Pcontig read Return null when there is no Pcontig
getPERead(index) - Method in class net.maizegenetics.dna.read.PEFastqChunk
Return PE read
getPEReadNum() - Method in class net.maizegenetics.dna.read.PEFastqChunk
Return number of PE read
getPermutationReport() - Method in class net.maizegenetics.analysis.modelfitter.StepwiseAdditiveModelFitter
 
getPermutationReport() - Method in class net.maizegenetics.analysis.modelfitter.StepwiseOLSModelFitter
 
getPermutedData() - Method in class net.maizegenetics.stats.linearmodels.WithinPopulationPermuter
 
getPersistPreferences() - Static method in class net.maizegenetics.prefs.TasselPrefs
 
getPev() - Method in class net.maizegenetics.stats.EMMA.EMMAforDoubleMatrix
 
getPhaseForSite(site) - Method in class net.maizegenetics.analysis.popgen.DonorHypoth
 
getPhenotypeFromB4RMergeDuplicates(dbURL, db, userName, password, studyName, taxaName, variableName) - Static method in class net.maizegenetics.analysis.b4r.B4RPhenotypeUtils
 
GetPhenotypeFromB4RPlugin - Class in net.maizegenetics.analysis.b4r
 
GetPhenotypeFromB4RPlugin(parentFrame, isInteractive) - Constructor for class net.maizegenetics.analysis.b4r.GetPhenotypeFromB4RPlugin
 
getPhenotypeFromB4RWithDuplicates(dbURL, db, userName, password, studyName, taxaName, variableName) - Static method in class net.maizegenetics.analysis.b4r.B4RPhenotypeUtils
 
getPhenotypeFromB4RWithRepNumber(dbURL, db, userName, password, studyName, taxaName, variableName, repNumber) - Static method in class net.maizegenetics.analysis.b4r.B4RPhenotypeUtils
 
getPhredScale() - Method in class net.maizegenetics.dna.read.FastqChunk
Return phred score scale of the fastq, 33 or 64
getPhredScale() - Method in class net.maizegenetics.dna.read.PEFastqChunk
Return phred score scale of the fastq, 33 or 64
getPhysicalMapPositions() - Method in interface net.maizegenetics.dna.tag.RepGenData
Get all of the physical map positions associated with the ref tags.
getPhysicalMapPositions(chromosome, firstPosition, lastPosition) - Method in interface net.maizegenetics.dna.tag.RepGenData
Get the unique list of positions for ref tags for a specific chromosome within a range.
getPhysicalMapPositions() - Method in class net.maizegenetics.dna.tag.RepGenSQLite
 
getPhysicalMapPositions(chromosome, firstPosition, lastPosition) - Method in class net.maizegenetics.dna.tag.RepGenSQLite
 
getPhysicalPositions() - Method in class net.maizegenetics.analysis.distance.DistanceMatrixRangesPlugin
 
getPhysPos(markerIndex) - Method in class net.maizegenetics.analysis.imputation.AGPMap
 
getPlateName() - Method in class net.maizegenetics.analysis.gobii.MarkerDNARun_IFLFilePlugin.HmpTaxaData
 
getPLINKAlleleByte(value) - Static method in class net.maizegenetics.dna.snp.io.BuilderFromPLINK
Returns haploid byte value for given PLINK value. Only right-most four bits used.
getPlugin() - Method in class net.maizegenetics.plugindef.AbstractPluginAction
Return associated plugin.
getPlugin() - Method in interface net.maizegenetics.plugindef.PluginAction
Return associated plugin.
getPluginInstance(className, frame) - Static method in interface net.maizegenetics.plugindef.Plugin
 
getPluginInstance(className, frame, isInteractive) - Static method in interface net.maizegenetics.plugindef.Plugin
Gets instance of Plugin
getPluginListener() - Method in class net.maizegenetics.plugindef.ThreadedPluginListener
 
getPosEndB(index) - Method in class net.maizegenetics.dna.map.AbstractPETagsOnPhysicalMap
 
getPosEndContig(index) - Method in class net.maizegenetics.dna.map.AbstractPETagsOnPhysicalMap
 
getPosEndF(index) - Method in class net.maizegenetics.dna.map.AbstractPETagsOnPhysicalMap
 
getPosFromLine(mline, isVCF, tabPos) - Static method in class net.maizegenetics.analysis.gobii.GOBII_IFLUtils
 
getPosition(siteIndex) - Method in class net.maizegenetics.analysis.gbs.SimpleGenotypeSBit
 
getPosition() - Method in class net.maizegenetics.dna.map.GeneralPosition
 
getPosition() - Method in interface net.maizegenetics.dna.map.Position
Return the physical position of a site
getPositionArray(index) - Method in class net.maizegenetics.dna.map.TagsOnPhysicalMap
 
getPositionArray(tagIndex) - Method in class net.maizegenetics.dna.map.TagsOnPhysicalMapV3
 
getPositionArray(index) - Method in class net.maizegenetics.dna.map.TagsOnPhysMapHDF5
 
getPositionArray(index) - Method in interface net.maizegenetics.dna.map.TOPMInterface
Returns chromosome, strand, and start position for given tag.
getPositionFromCm(chromosome, cM) - Method in class net.maizegenetics.analysis.imputation.AGPMap
 
getPositionList() - Method in class net.maizegenetics.dna.map.PositionListTableReport
 
getPositionList(bedfile) - Static method in class net.maizegenetics.dna.snp.io.ReadBedfile
Gets position list from specified bed file.
GetPositionListPlugin - Class in net.maizegenetics.analysis.data
 
GetPositionListPlugin(parentFrame, isInteractive) - Constructor for class net.maizegenetics.analysis.data.GetPositionListPlugin
 
getPositions() - Method in class net.maizegenetics.analysis.chart.TableReportQQDataset
 
getPositionsOfVariableSites() - Method in class net.maizegenetics.dna.map.TagLocus
 
getPossibleCharts() - Static method in class net.maizegenetics.analysis.chart.ChartDisplayPlugin
 
getPossibleGraphicOutFormats() - Static method in class net.maizegenetics.analysis.chart.AbstractDisplayPlugin
 
getPosStartB(index) - Method in class net.maizegenetics.dna.map.AbstractPETagsOnPhysicalMap
 
getPosStartContig(index) - Method in class net.maizegenetics.dna.map.AbstractPETagsOnPhysicalMap
 
getPosStartF(index) - Method in class net.maizegenetics.dna.map.AbstractPETagsOnPhysicalMap
 
getPred() - Method in class net.maizegenetics.stats.EMMA.EMMAforDoubleMatrix
 
getPredictedValues() - Method in class net.maizegenetics.stats.linearmodels.SweepFastLinearModel
 
getPrediction(index) - Method in class net.maizegenetics.dna.map.TagsOnGeneticMap
Return prediction value from model
getPref(path, key, def) - Static method in class net.maizegenetics.prefs.TasselPrefs
 
getPreferredSize(c) - Method in class net.maizegenetics.gui.VerticalLabelUI
 
getPreviousRegionStats() - Method in interface net.maizegenetics.dna.map.GVCFGenomeSequence
 
getPrincipalComponents() - Method in class net.maizegenetics.stats.PCA.PrinComp
calculated as data * eigenvectors
getPrincipalCoordinate(index) - Method in class net.maizegenetics.stats.PCA.ClassicMds
 
getProbObsGivenState(state, obs) - Method in class net.maizegenetics.analysis.imputation.CrossProgenyEmissionMatrix
 
getProbObsGivenState(state, obs, site) - Method in class net.maizegenetics.analysis.imputation.CrossProgenyEmissionMatrix
 
getProbObsGivenState(state, obs) - Method in class net.maizegenetics.analysis.imputation.EmissionProbability
 
getProbObsGivenState(state, obs, node) - Method in class net.maizegenetics.analysis.imputation.EmissionProbability
 
getProgressPanel() - Method in class net.maizegenetics.tassel.TASSELMainFrame
 
getProtocolChecksum(filename, protocol) - Static method in class net.maizegenetics.util.CheckSum
Allows user to specify the protocol, e.g. MD5, SHA-1, SHA-256
getPVal(r, c) - Method in class net.maizegenetics.analysis.popgen.LinkageDisequilibrium
Returns P-value estimate for a given pair of numSites. If there were only 2 alleles at each locus, then the Fisher Exact P-value (one-tail) is returned. If more states then the permuted Monte Carlo test is used.
getQRDecomposition() - Method in class net.maizegenetics.matrixalgebra.Matrix.BlasDoubleMatrix
 
getQRDecomposition() - Method in class net.maizegenetics.matrixalgebra.Matrix.ColtDoubleMatrix
 
getQRDecomposition() - Method in interface net.maizegenetics.matrixalgebra.Matrix.DoubleMatrix
 
getQRDecomposition() - Method in class net.maizegenetics.matrixalgebra.Matrix.EJMLDoubleMatrix
 
getQual() - Method in class net.maizegenetics.dna.read.Read
Return quality string
getQual(startIndex, endIndex) - Method in class net.maizegenetics.dna.read.Read
Return quality string from startIndex to endIndex
getQuantAnnotation(annoName) - Method in interface net.maizegenetics.util.GeneralAnnotation
Returns all annotation value for a given annotation key
getQuantAnnotation(annoName) - Method in class net.maizegenetics.util.GeneralAnnotationStorage
 
getR2Count() - Method in class net.maizegenetics.analysis.data.MeanR2FromLDPlugin.AccumulateR2
 
getR2Total() - Method in class net.maizegenetics.analysis.data.MeanR2FromLDPlugin.AccumulateR2
 
getRandom() - Method in class net.maizegenetics.stats.linearmodels.BasicLevel
 
getRandomNode(tree) - Static method in class net.maizegenetics.taxa.tree.TreeUtils
Returns a uniformly distributed random node from the tree, including both internal and external nodes.
getRandomParameterValue(parameter) - Method in class net.maizegenetics.taxa.tree.Parameterized.ParameterizedUser
 
getRangeBounds() - Method in class net.maizegenetics.analysis.chart.TableReportManhattanDataset
 
getRanges(bedFile) - Static method in class net.maizegenetics.dna.snp.io.ReadBedfile
Function to parse the bedFile and create a List of BedFileRanges. The positions stored in BedFileRange are 1-based inclusive exclusive. This is done by adding 1 to both the start and end position from the BED file.
getRangesAsPositionMap(bedfile) - Static method in class net.maizegenetics.dna.snp.io.ReadBedfile
Function that returns the 1-based Position ranges from a BED file as a RangeMap of Positions to the annotated name of the region. NOTE: getRanges(bedFile) will be called which will shift the start and end positions in the BED file up by 1. Because of this the ranges returned will be 1-based Closed-Open(Inclusive-Exclusive). This is NOT returning ranges in BED specification(0-based Inclusive-Exclusive).
getRangesAsPositions(bedfile) - Static method in class net.maizegenetics.dna.snp.io.ReadBedfile
Function that returns the 1-based Position ranges from a BED file as a RangeSet of Positions. NOTE: getRanges(bedFile) will be called which will shift the start and end positions in the BED file up by 1. Because of this the ranges returned will be 1-based Closed-Open(Inclusive-Exclusive). This is NOT returning ranges in BED specification(0-based Inclusive-Exclusive).
getRank() - Method in class net.maizegenetics.matrixalgebra.decomposition.BlasSingularValueDecomposition
 
getRank() - Method in class net.maizegenetics.matrixalgebra.decomposition.ColtSingularValueDecomposition
 
getRank() - Method in class net.maizegenetics.matrixalgebra.decomposition.EJMLSingularValueDecomposition
 
getRank() - Method in interface net.maizegenetics.matrixalgebra.decomposition.SingularValueDecomposition
 
getRead() - Method in class net.maizegenetics.analysis.gbs.ReadBarcodeResult
 
getRead() - Method in class net.maizegenetics.analysis.gbs.ShortReadBarcodeResult
 
getRead(index) - Method in class net.maizegenetics.dna.read.FastqChunk
Return Fastq read
getRead(index) - Method in interface net.maizegenetics.dna.tag.Reads
Get the compressed read sequence in a long array for a given index
getRead(i) - Method in class net.maizegenetics.dna.tag.ReadsByTaxa
 
getReadB() - Method in class net.maizegenetics.analysis.gbs.PEReadBarcodeResult
Return backward sequence in Long array
getReadCount(tagIndex) - Method in class net.maizegenetics.dna.tag.AbstractTagsByTaxa
 
getReadCount(index) - Method in class net.maizegenetics.dna.tag.PETagCounts
Return read count of a PE tag
getReadCount(index) - Method in interface net.maizegenetics.dna.tag.Reads
Gets the count of a particular read. If index does not exist it return -1
getReadCount(index) - Method in class net.maizegenetics.dna.tag.ReadsByTaxa
 
getReadCount(index) - Method in class net.maizegenetics.dna.tag.TagCounts
 
getReadCountDistributionForTaxon(taxaIndex) - Method in class net.maizegenetics.dna.tag.TagsByTaxaByteHDF5TaxaGroups
 
getReadCountForTagTaxon(tagIndex, taxaIndex) - Method in interface net.maizegenetics.dna.tag.TagsByTaxa
Returns the read count for a specified tag and taxon
getReadCountForTagTaxon(tagIndex, taxaIndex) - Method in class net.maizegenetics.dna.tag.TagsByTaxaByte
 
getReadCountForTagTaxon(tagIndex, taxaIndex) - Method in class net.maizegenetics.dna.tag.TagsByTaxaByteFileMap
 
getReadCountForTagTaxon(tagIndex, taxaIndex) - Method in class net.maizegenetics.dna.tag.TagsByTaxaByteFileMapSeq
 
getReadCountForTagTaxon(tagIndex, taxaIndex) - Method in class net.maizegenetics.dna.tag.TagsByTaxaByteHDF5TagGroups
 
getReadCountForTagTaxon(tagIndex, taxaIndex) - Method in class net.maizegenetics.dna.tag.TagsByTaxaByteHDF5TaxaGroups
 
getReadCountForTagTaxon(tagIndex, taxaIndex) - Method in class net.maizegenetics.dna.tag.TagsByTaxaShort
 
getReadCountForTaxa(readIndex, taxaIndex) - Method in class net.maizegenetics.dna.tag.ReadsByTaxa
 
getReadCountsForTaxa(readIndex) - Method in class net.maizegenetics.dna.tag.ReadsByTaxa
 
getReadF() - Method in class net.maizegenetics.analysis.gbs.PEReadBarcodeResult
Return forward sequence in Long array
getReadIndex(read) - Method in interface net.maizegenetics.dna.tag.Reads
Gets the first index of a read (the only one if a unique list). If the read is not found then it return a negative value indicating its insertion point.
getReadIndex(read) - Method in class net.maizegenetics.dna.tag.ReadsByTaxa
Gets the first index of a read (the only one if a unique list). If the read is not found then it return a negative value indicating its insertion point.
getReadIndexForPositionIndex(posIndex) - Method in class net.maizegenetics.dna.map.TagsOnPhysicalMap
 
getReadIndexForPositionIndex(posIndex) - Method in class net.maizegenetics.dna.map.TagsOnPhysicalMapV3
 
getReadIndexForPositionIndex(posIndex) - Method in class net.maizegenetics.dna.map.TagsOnPhysMapHDF5
 
getReadIndexForPositionIndex(posIndex) - Method in interface net.maizegenetics.dna.map.TOPMInterface
Consider removing this. -Terry
getReadIndexSet(read) - Method in interface net.maizegenetics.dna.tag.Reads
Gets the set indices of matching reads (the only one if a unique list). If the read is not found then it returns a null array indicating its insertion point.
getReadIndexSet(read) - Method in class net.maizegenetics.dna.tag.ReadsByTaxa
 
getReadLength() - Method in class net.maizegenetics.dna.read.Read
Return read length
getReadNum() - Method in class net.maizegenetics.dna.read.FastqChunk
Return number of Fastq read
getReadTotal() - Method in interface net.maizegenetics.dna.tag.Reads
This is the number of different reads in the list (NOT THE SUM OF THE COUNTS) The index will vary from 0 to (ReadTotal-1) This is the number of distinct reads if readUnique is true
getReadTotal() - Method in class net.maizegenetics.dna.tag.ReadsByTaxa
 
getRealColumnCount() - Method in class net.maizegenetics.gui.AlignmentTableModel
 
getRealColumnIndex(col) - Method in class net.maizegenetics.gui.AlignmentTableModel
 
getRealEigenvalues() - Method in class net.maizegenetics.matrixalgebra.decomposition.SymmetricEigenvalueDecomposition
 
getRealElementAt(index) - Method in class net.maizegenetics.gui.AbstractAvailableListModel
 
getRealElementAt(index) - Method in class net.maizegenetics.gui.SiteNamesAvailableListModel
 
getRealElementAt(index) - Method in class net.maizegenetics.gui.TaxaAvailableListModel
 
getRealNames() - Method in class net.maizegenetics.taxa.IdentifierSynonymizer
 
getRealSize() - Method in class net.maizegenetics.gui.AbstractAvailableListModel
 
getRefAlignmentsForRefTags(refTags, minscore) - Method in interface net.maizegenetics.dna.tag.RepGenData
Map of all alignments for specified ref tags having minimum specified score. minscore = 0 means get all tags. This returns refTag to refTag alignments from the reftag_reftag_Alignments table. It does not include refTag to non-refTag alignments.
getRefAlignmentsForRefTags(refTags, minscore) - Method in class net.maizegenetics.dna.tag.RepGenSQLite
 
getRefAlignmentsForTags(tags, minscore) - Method in interface net.maizegenetics.dna.tag.RepGenData
Map of all reftag alignments for specified non-ref tags. All tags on the list must be non-ref tags as the tagID is pulled from the tagTagIDMap.
getRefAlignmentsForTags(tags, minscore) - Method in class net.maizegenetics.dna.tag.RepGenSQLite
 
getRefChromPosList(chrom) - Method in class net.maizegenetics.analysis.monetdb.ColumnsToBinarySNPOnlyTablePlugin
 
getReferenceMasksRendering(table, value, isSelected, hasFocus, row, col) - Method in class net.maizegenetics.gui.AlignmentTableCellRenderer
 
getReferenceProbabilityRendering(table, value, isSelected, hasFocus, row, col) - Method in class net.maizegenetics.gui.AlignmentTableCellRenderer
 
getRefGeno(site) - Method in class net.maizegenetics.dna.map.TagLocus
 
getRefTags() - Method in interface net.maizegenetics.dna.tag.RepGenData
Set of all reference tags
getRefTags() - Method in class net.maizegenetics.dna.tag.RepGenSQLite
 
getRemoveButton() - Method in class net.maizegenetics.gui.SelectFromAvailableDialog
 
getRenderingType() - Method in class net.maizegenetics.gui.AlignmentTableCellRenderer
 
getRenderingTypes() - Method in class net.maizegenetics.gui.AlignmentTableCellRenderer
 
getRenderingTypes() - Method in class net.maizegenetics.gui.TOPMGenotypeTableCellRenderer
 
getRes() - Method in class net.maizegenetics.stats.EMMA.EMMAforDoubleMatrix
 
getResidualPhenotypesByChromosome() - Method in class net.maizegenetics.analysis.modelfitter.StepwiseAdditiveModelFitter
 
getResiduals() - Method in class net.maizegenetics.stats.linearmodels.SweepFastLinearModel
 
getResidualSS() - Method in class net.maizegenetics.stats.linearmodels.SweepFast
 
getResidualSSdf() - Method in class net.maizegenetics.stats.linearmodels.SweepFastLinearModel
 
getRestricted() - Method in class net.maizegenetics.stats.linearmodels.FactorModelEffect
 
getRestricted(toRestrict, minimum, range) - Static method in class net.maizegenetics.stats.math.OrderEnumerator.Utils
 
getRestrictedFactory(toRestrict, minimum, range) - Static method in class net.maizegenetics.stats.math.OrderEnumerator.Utils
 
getReverseComplement(seq, len) - Static method in class net.maizegenetics.dna.BaseEncoder
Returns the reverse complement of a sequence already encoded in a 2-bit long.
getReverseComplement(seq) - Static method in class net.maizegenetics.dna.BaseEncoder
Returns the reverse complement of a sequence already encoded in a 2-bit long. The entire long (32-bp) is reverse complemented.
getReverseComplement(seq) - Static method in class net.maizegenetics.dna.BaseEncoder
Returns the reverse complement of a arrays of sequences already encoded in a 2-bit long.
getReverseComplement(seq) - Static method in class net.maizegenetics.dna.BaseEncoder
Returns a string based reverse complement. Get around issues with the poly-A tailing in the 2-bit encoding approach.
getReverseComplementarySeq() - Method in class net.maizegenetics.dna.read.Read
Return reverse complementary sequence
getReverseComplementarySeq(startIndex, endIndex) - Method in class net.maizegenetics.dna.read.Read
Return reverse complementary sequence
getReverseQual() - Method in class net.maizegenetics.dna.read.Read
Return reverse quality string
getRightTailedP(a, b, c, d) - Method in class net.maizegenetics.stats.statistics.FisherExact
Calculates the right-tail P-value for the Fisher Exact test.
getRightTailedPQuick(a, b, c, d, maxP) - Method in class net.maizegenetics.stats.statistics.FisherExact
Calculates the right-tail P-value for the Fisher Exact test.
getRobinsonFouldsDistance(t1, t2) - Static method in class net.maizegenetics.taxa.tree.TreeUtils
computes Robinson-Foulds (1981) distance between two trees
getRobinsonFouldsDistance(s1, t2) - Static method in class net.maizegenetics.taxa.tree.TreeUtils
computes Robinson-Foulds (1981) distance between two trees
getRobinsonFouldsRescaledDistance(t1, t2) - Static method in class net.maizegenetics.taxa.tree.TreeUtils
computes Robinson-Foulds (1981) distance between two trees rescaled to a number between 0 and 1
getRobinsonFouldsRescaledDistance(s1, t2) - Static method in class net.maizegenetics.taxa.tree.TreeUtils
computes Robinson-Foulds (1981) distance between two trees rescaled to a number between 0 and 1
getRoot() - Method in class net.maizegenetics.taxa.tree.SimpleTree
Returns the root node of this tree.
getRoot() - Method in interface net.maizegenetics.taxa.tree.Tree
 
getRootFactor() - Method in class net.maizegenetics.analysis.gbs.neobio.FactorSequence
Returns the root factor, the one that starts the list of factors.
getRow(row) - Method in class net.maizegenetics.analysis.popgen.DiversityAnalyses
Returns specified row.
getRow(row) - Method in class net.maizegenetics.analysis.popgen.LinkageDisequilibrium
 
getRow(row) - Method in class net.maizegenetics.dna.map.PositionListTableReport
 
getRow(row) - Method in class net.maizegenetics.dna.map.TOPMTableReport
 
getRow(row) - Method in class net.maizegenetics.dna.snp.FilterTableReport
 
getRow(row) - Method in class net.maizegenetics.phenotype.CorePhenotype
 
getRow(row) - Method in class net.maizegenetics.phenotype.FilterPhenotype
 
getRow(row) - Method in class net.maizegenetics.phenotype.GenotypePhenotype
 
getRow(rowLong) - Method in class net.maizegenetics.taxa.distance.DistanceMatrix
Returns specified row.
getRow(rowLong) - Method in class net.maizegenetics.taxa.IdentifierSynonymizer
Returns specified row.
getRow(row) - Method in class net.maizegenetics.taxa.TaxaListTableReport
 
getRow(row) - Method in class net.maizegenetics.util.HDF5TableReport
 
getRow(row) - Method in class net.maizegenetics.util.SimpleTableReport
Returns specified row.
getRow(row) - Method in interface net.maizegenetics.util.TableReport
Returns specified row.
getRowCount() - Method in class net.maizegenetics.analysis.popgen.DiversityAnalyses
 
getRowCount() - Method in class net.maizegenetics.analysis.popgen.LinkageDisequilibrium
 
getRowCount() - Method in class net.maizegenetics.dna.map.PositionListTableReport
 
getRowCount() - Method in class net.maizegenetics.dna.map.TOPMTableReport
 
getRowCount() - Method in class net.maizegenetics.dna.snp.FilterTableReport
 
getRowCount() - Method in class net.maizegenetics.gui.AlignmentTableModel
 
getRowCount() - Method in class net.maizegenetics.gui.TableReportNoPagingTableModel
 
getRowCount() - Method in class net.maizegenetics.phenotype.CorePhenotype
 
getRowCount() - Method in class net.maizegenetics.phenotype.FilterPhenotype
 
getRowCount() - Method in class net.maizegenetics.phenotype.GenotypePhenotype
 
getRowCount() - Method in class net.maizegenetics.taxa.distance.DistanceMatrix
 
getRowCount() - Method in class net.maizegenetics.taxa.IdentifierSynonymizer
 
getRowCount() - Method in class net.maizegenetics.taxa.TaxaListTableReport
 
getRowCount() - Method in class net.maizegenetics.util.HDF5TableReport
 
getRowCount() - Method in class net.maizegenetics.util.SimpleTableReport
 
getRowCount() - Method in interface net.maizegenetics.util.TableReport
Get the number of rows
getRowHeaders() - Method in class net.maizegenetics.gui.AlignmentTableModel
 
getRowStart() - Method in class net.maizegenetics.analysis.gbs.neobio.PairwiseAlignment
Returns the matrix row position where the paried alignement starts
getRSqr(r, c) - Method in class net.maizegenetics.analysis.popgen.LinkageDisequilibrium
Returns r^2 estimate for a given pair of numSites
getS() - Method in class net.maizegenetics.matrixalgebra.decomposition.BlasSingularValueDecomposition
 
getS() - Method in class net.maizegenetics.matrixalgebra.decomposition.ColtSingularValueDecomposition
 
getS() - Method in class net.maizegenetics.matrixalgebra.decomposition.EJMLSingularValueDecomposition
 
getS() - Method in interface net.maizegenetics.matrixalgebra.decomposition.SingularValueDecomposition
for the decomposition of A, A = USV'
getSampleSize(r, c) - Method in class net.maizegenetics.analysis.popgen.LinkageDisequilibrium
Get number of gametes included in LD calculations (after missing data was excluded)
getSaveDir(parent) - Static method in class net.maizegenetics.gui.FileBrowserUtils
 
getSaveDir() - Static method in class net.maizegenetics.prefs.TasselPrefs
 
getSaveFile() - Method in class net.maizegenetics.analysis.chart.AbstractDisplayPlugin
 
getSaveFile(parent) - Static method in class net.maizegenetics.gui.FileBrowserUtils
 
getSaveFileByChooser(fileExtensions) - Method in class net.maizegenetics.analysis.chart.AbstractDisplayPlugin
 
getSaveFileByChooser(fileExtensions, parent) - Method in class net.maizegenetics.analysis.chart.AbstractDisplayPlugin
 
getSaveFiles() - Method in class net.maizegenetics.analysis.data.ExportMultiplePlugin
 
getSchema() - Method in class net.maizegenetics.analysis.avro.GenericArrayPositions
 
getSchema() - Method in class net.maizegenetics.analysis.avro.GenericArrayTaxa
 
getSchema() - Method in class net.maizegenetics.analysis.avro.GenericRecordChromosome
 
getSchema() - Method in class net.maizegenetics.analysis.avro.GenericRecordGenotype
 
getSchema() - Method in class net.maizegenetics.analysis.avro.GenericRecordGenotypeTable
 
getSchema() - Method in class net.maizegenetics.analysis.avro.GenericRecordPosition
 
getSchema() - Method in class net.maizegenetics.analysis.avro.GenericRecordTaxon
 
getScore() - Method in class net.maizegenetics.analysis.clustering.HaplotypeCluster
 
getScore() - Method in class net.maizegenetics.analysis.gbs.neobio.PairwiseAlignment
Returns the score for this alignment.
getScore() - Method in class net.maizegenetics.analysis.gbs.neobio.PairwiseAlignmentAlgorithm
Returns the score of the last alignment computed (if any) or request subclasses to compute one and return the result by calling the computeScore method. The sequences must already be loaded and a scoring scheme must already be set.
getScore(tagIndex, mappingIndex) - Method in class net.maizegenetics.dna.map.PETagsOnPhysicalMapV3
Return score of a mapping
getScore(i, j) - Static method in class net.maizegenetics.dna.snp.io.VCFUtil
 
getScore(s1, s2, ignoreCase, ignoreWhite, ignorePunc, technique) - Static method in class net.maizegenetics.taxa.IdentifierSynonymizer
 
getScore(s1, s2, ignoreCase, ignoreWhite, ignorePunc, technique, delimiter) - Static method in class net.maizegenetics.taxa.IdentifierSynonymizer
 
getScoreTagLine() - Method in class net.maizegenetics.analysis.gbs.neobio.PairwiseAlignment
Returns the score tag line.
getSelectedButton() - Method in class net.maizegenetics.gui.SelectFromAvailableDialog
 
getSelectedButton() - Method in class net.maizegenetics.gui.SelectFromAvailableSitesDialog
 
getSelectedTasselDataSet() - Method in class net.maizegenetics.tassel.DataTreePanel
 
getSelection(rows, columns) - Method in class net.maizegenetics.matrixalgebra.Matrix.BlasDoubleMatrix
 
getSelection(rows, columns) - Method in class net.maizegenetics.matrixalgebra.Matrix.ColtDoubleMatrix
 
getSelection(rows, columns) - Method in interface net.maizegenetics.matrixalgebra.Matrix.DoubleMatrix
Creates a new matrix consisting or the rows and columns of this matrix in the order specified. If rows or columns is null then all rows or columns, respectively, will be included
getSelection(rows, columns) - Method in class net.maizegenetics.matrixalgebra.Matrix.EJMLDoubleMatrix
 
getSelectionFromDoubleArray(original, nrows, ncols, rows, columns) - Static method in class net.maizegenetics.matrixalgebra.Matrix.BlasDoubleMatrix
 
getSeq() - Method in class net.maizegenetics.dna.read.Read
Return read
getSeq(startIndex, endIndex) - Method in class net.maizegenetics.dna.read.Read
Return read from startIndex to endIndex
getSequence() - Method in interface net.maizegenetics.taxa.tree.Node
Returns the sequence at this node, in the form an array of bytes.
getSequence() - Method in class net.maizegenetics.taxa.tree.SimpleNode
Returns the sequence at this node, in the form of an array of bytes.
getSequenceFromInt(val) - Static method in class net.maizegenetics.dna.BaseEncoder
Return a string representation of the 2-bit encoded Integer (16bp).
getSequenceFromLong(val, len) - Static method in class net.maizegenetics.dna.BaseEncoder
Return a string representation of the 2-bit encoded long.
getSequenceFromLong(val) - Static method in class net.maizegenetics.dna.BaseEncoder
Return a string representation of an array of 2-bit encoded longs.
getSequenceFromLong(val) - Static method in class net.maizegenetics.dna.BaseEncoder
Return a string representation of the 2-bit encoded long.
getSequenceFromLong(val, length) - Static method in class net.maizegenetics.dna.tag.AbstractTag
Return a string representation of an array of 2-bit encoded longs.
getSequenceString() - Method in class net.maizegenetics.taxa.tree.SimpleNode
Returns the sequence at this node, in the form of a String.
getSerialNumber() - Method in class net.maizegenetics.analysis.gbs.neobio.Factor
Returns this factor's serial number.
getSeries1() - Method in class net.maizegenetics.analysis.chart.ChartDisplayPlugin
 
getSeries2() - Method in class net.maizegenetics.analysis.chart.ChartDisplayPlugin
 
getSeries3() - Method in class net.maizegenetics.analysis.chart.ChartDisplayPlugin
 
getSeriesCount() - Method in class net.maizegenetics.analysis.chart.TableReportManhattanDataset
 
getSeriesCount() - Method in class net.maizegenetics.analysis.chart.TableReportQQDataset
 
getSeriesCount() - Method in class net.maizegenetics.analysis.chart.TableReportXYDataset
 
getSeriesKey(series) - Method in class net.maizegenetics.analysis.chart.TableReportManhattanDataset
 
getSeriesKey(series) - Method in class net.maizegenetics.analysis.chart.TableReportQQDataset
 
getSeriesKey(series) - Method in class net.maizegenetics.analysis.chart.TableReportXYDataset
 
getSeriesName(series) - Method in class net.maizegenetics.analysis.chart.TableReportManhattanDataset
 
getSeriesName(series) - Method in class net.maizegenetics.analysis.chart.TableReportQQDataset
 
getSeriesName(series) - Method in class net.maizegenetics.analysis.chart.TableReportXYDataset
 
getSFString(numbers, sf, delimiter) - Method in class net.maizegenetics.util.FormattedOutput
 
getSFString(number, sf) - Method in class net.maizegenetics.util.FormattedOutput
 
getShuffled(size) - Static method in class net.maizegenetics.stats.math.OrderEnumerator.Utils
 
getShuffledFactory() - Static method in class net.maizegenetics.stats.math.OrderEnumerator.Utils
 
getSignificance(deltaL, df) - Static method in class net.maizegenetics.stats.statistics.LikelihoodRatioTest
compute significance level for the differences in log-likelihood (based on chi-square distribution)
getSingularValueDecomposition() - Method in class net.maizegenetics.matrixalgebra.Matrix.BlasDoubleMatrix
 
getSingularValueDecomposition() - Method in class net.maizegenetics.matrixalgebra.Matrix.ColtDoubleMatrix
 
getSingularValueDecomposition() - Method in interface net.maizegenetics.matrixalgebra.Matrix.DoubleMatrix
 
getSingularValueDecomposition() - Method in class net.maizegenetics.matrixalgebra.Matrix.EJMLDoubleMatrix
 
getSingularValues() - Method in class net.maizegenetics.matrixalgebra.decomposition.BlasSingularValueDecomposition
 
getSingularValues() - Method in class net.maizegenetics.matrixalgebra.decomposition.ColtSingularValueDecomposition
 
getSingularValues() - Method in class net.maizegenetics.matrixalgebra.decomposition.EJMLSingularValueDecomposition
 
getSingularValues() - Method in interface net.maizegenetics.matrixalgebra.decomposition.SingularValueDecomposition
for the decomposition of A, A = USV'
getSiteCompareType(alleles1, alleles2) - Static method in class net.maizegenetics.analysis.gbs.CompareGenosBetweenHapMapFilesPlugin
 
getSiteCount() - Method in class net.maizegenetics.analysis.popgen.LinkageDisequilibrium
Returns the counts of the numSites in the alignment
getSiteCount() - Method in class net.maizegenetics.dna.snp.genotypecall.GenotypeCallTableBuilder
 
getSiteIncremental(taxaList) - Static method in class net.maizegenetics.dna.snp.GenotypeTableBuilder
Build an alignment site by site in memory
getSiteIncremental(taxaList, numberOfPositions, newHDF5File) - Static method in class net.maizegenetics.dna.snp.GenotypeTableBuilder
Build an GenotypeTable by site block (1<<16 sites). Number of positions (sites) must be known from the beginning. Positions and genotypes must be added by block
getSiteIndex(chr, pos) - Method in class net.maizegenetics.analysis.gbs.SimpleGenotypeSBit
Return index of nearest site of given position
getSiteInstance(genotype) - Static method in class net.maizegenetics.dna.snp.genotypecall.ListStats
 
getSiteNamesToCovariates() - Method in class net.maizegenetics.analysis.filter.FilterSiteNamePlugin
Deprecated.
 
getSiteNamesToFactors() - Method in class net.maizegenetics.analysis.filter.FilterSiteNamePlugin
Deprecated.
 
getSiteNamesToKeep() - Method in class net.maizegenetics.analysis.filter.FilterSiteNamePlugin
Deprecated.
 
getSiteNamesToRemove() - Method in class net.maizegenetics.analysis.filter.FilterSiteNamePlugin
Deprecated.
 
getSiteNum() - Method in class net.maizegenetics.analysis.gbs.SimpleGenotypeSBit
 
getSitesToCovariateButton() - Method in class net.maizegenetics.gui.SelectFromAvailableSitesDialog
 
getSitesToCovariatesIndex() - Method in class net.maizegenetics.analysis.filter.FilterSiteNamePlugin
Deprecated.
 
getSitesToFactorsButton() - Method in class net.maizegenetics.gui.SelectFromAvailableSitesDialog
 
getSitesToFactorsIndex() - Method in class net.maizegenetics.analysis.filter.FilterSiteNamePlugin
Deprecated.
 
getSitesToKeep() - Method in class net.maizegenetics.analysis.filter.FilterSiteNamePlugin
Deprecated.
 
getSize() - Method in class net.maizegenetics.analysis.clustering.HaplotypeCluster
 
getSize() - Static method in enum net.maizegenetics.analysis.gbs.AnnotateTOPM.EvidenceType
 
getSize() - Method in class net.maizegenetics.analysis.modelfitter.AddPlusDomModelEffect
 
getSize() - Method in class net.maizegenetics.dna.map.AbstractTagsOnPhysicalMap
 
getSize() - Method in class net.maizegenetics.dna.map.TagLocus
 
getSize() - Method in interface net.maizegenetics.dna.map.TOPMInterface
Returns number of tags.
getSize() - Method in class net.maizegenetics.dna.tag.TagCounts
 
getSize() - Method in class net.maizegenetics.gui.AbstractAvailableListModel
 
getSize() - Method in class net.maizegenetics.gui.SelectFromAvailableDialog.SelectedListModel
 
getSize() - Method in class net.maizegenetics.gui.TableRowHeaderListModel
Returns the length of the list.
getSize() - Method in class net.maizegenetics.matrixalgebra.Matrix.BlasDoubleMatrix
 
getSize() - Method in class net.maizegenetics.plugindef.DataSet
 
getSize() - Method in class net.maizegenetics.stats.linearmodels.CovariateModelEffect
 
getSize() - Method in class net.maizegenetics.stats.linearmodels.FactorModelEffect
 
getSize() - Method in interface net.maizegenetics.stats.linearmodels.ModelEffect
 
getSize() - Method in class net.maizegenetics.stats.linearmodels.NestedCovariateModelEffect
 
getSize() - Method in class net.maizegenetics.taxa.distance.DistanceMatrix
Returns the number of taxa which is also the number of rows and columns that the distance matrix has.
getSliderPosition() - Method in class net.maizegenetics.tassel.SeqViewerPanel
 
getSliderPositionAsSite() - Method in class net.maizegenetics.tassel.SeqViewerPanel
 
getSNPCallsQuant(callBiallelicSNPsWithGap, includeReferenceTag) - Method in class net.maizegenetics.dna.map.TagLocus
 
getSNPCallsQuant(refSeq, callBiallelicSNPsWithGap) - Method in class net.maizegenetics.dna.map.TagLocus
 
getSNPCallsVCF(callBiallelicSNPsWithGap, includeReferenceTag) - Method in class net.maizegenetics.dna.map.TagLocus
 
getSnpCount() - Method in class net.maizegenetics.analysis.gbs.Clusters
 
getSNPID() - Method in class net.maizegenetics.dna.map.GeneralPosition
 
getSNPID() - Method in interface net.maizegenetics.dna.map.Position
Return the ID (name) for a site
getSNPPositionQS(myMap) - Method in interface net.maizegenetics.dna.tag.RepGenData
For a given map of chromosome/posiiton, Returns a map of chromsome (string) and Tuple (position,qualityScore)
getSNPPositionQS(myMap) - Method in class net.maizegenetics.dna.tag.RepGenSQLite
 
getSNPPositionQS(myMap) - Method in interface net.maizegenetics.dna.tag.TagData
For a given map of chromosome/posiiton, Returns a map of chromsome (string) and Tuple (position,qualityScore)
getSNPPositionQS(myMap) - Method in class net.maizegenetics.dna.tag.TagDataSQLite
 
getSNPPositions() - Method in interface net.maizegenetics.dna.tag.RepGenData
Create the unique list of SNPs (variants) based on all alleles.
getSNPPositions(minSupportValue) - Method in interface net.maizegenetics.dna.tag.RepGenData
Create the unique list of SNPs (variants) based on all alleles. Only alleles with support values greater than the minSupportValue are considered.
getSNPPositions(minQualityScore) - Method in interface net.maizegenetics.dna.tag.RepGenData
Create the unique list of SNPs (variants) based on all alleles. Only positions with minimum quality score equal to or greater than the u are considered.
getSNPPositions() - Method in class net.maizegenetics.dna.tag.RepGenSQLite
 
getSNPPositions(minSupportValue) - Method in class net.maizegenetics.dna.tag.RepGenSQLite
 
getSNPPositions(minQualityScore) - Method in class net.maizegenetics.dna.tag.RepGenSQLite
 
getSNPPositions() - Method in interface net.maizegenetics.dna.tag.TagData
Create the unique list of SNPs (variants) based on all alleles.
getSNPPositions(minSupportValue) - Method in interface net.maizegenetics.dna.tag.TagData
Create the unique list of SNPs (variants) based on all alleles. Only alleles with support values greater than the minSupportValue are considered.
getSNPPositions(minQualityScore) - Method in interface net.maizegenetics.dna.tag.TagData
Create the unique list of SNPs (variants) based on all alleles. Only positions with minimum quality score equal to or greater than the u are considered.
getSNPPositions() - Method in class net.maizegenetics.dna.tag.TagDataSQLite
 
getSNPPositions(minSupportValue) - Method in class net.maizegenetics.dna.tag.TagDataSQLite
 
getSNPPositions(minQualityScore) - Method in class net.maizegenetics.dna.tag.TagDataSQLite
 
getSNPPositionsForChromosomes(startChr, endChr) - Method in interface net.maizegenetics.dna.tag.RepGenData
Get SNPs for specified chromosomes
getSNPPositionsForChromosomes(startChr, endChr) - Method in class net.maizegenetics.dna.tag.RepGenSQLite
 
getSNPPositionsForChromosomes(startChr, endChr) - Method in interface net.maizegenetics.dna.tag.TagData
Get SNPs for specified chromosomes
getSNPPositionsForChromosomes(startChr, endChr) - Method in class net.maizegenetics.dna.tag.TagDataSQLite
 
getSplit(i) - Method in class net.maizegenetics.taxa.tree.SplitSystem
get split
getSplit(idGroup, internalNode, split) - Static method in class net.maizegenetics.taxa.tree.SplitUtils
get split for branch associated with internal node
getSplitCount() - Method in class net.maizegenetics.taxa.tree.SplitSystem
get number of splits
getSplits(idGroup, tree) - Static method in class net.maizegenetics.taxa.tree.SplitUtils
creates a split system from a tree (using a pre-specified order of sequences)
getSplits(tree) - Static method in class net.maizegenetics.taxa.tree.SplitUtils
creates a split system from a tree (using tree-induced order of sequences)
getSplitVector() - Method in class net.maizegenetics.taxa.tree.SplitSystem
get split vector
getStackTrace(exception, max) - Static method in class net.maizegenetics.util.ExceptionUtils
This sends an exception's stack trace to the specified logger. The max parameter defines the maximun number of entries to send to the logger. Setting max to a negative number sends all the entries in the stack track to the logger.
getStart() - Method in class net.maizegenetics.analysis.data.MeanR2FromLDPlugin.AccumulateR2
 
getStart() - Method in class net.maizegenetics.analysis.filter.FilterAlignmentPlugin
 
getStartPos() - Method in class net.maizegenetics.analysis.filter.FilterAlignmentPlugin
 
getStartPos(tagIndex, mappingIndex) - Method in class net.maizegenetics.dna.map.PETagsOnPhysicalMapV3
Return start position of a mapping
getStartPosition(index) - Method in class net.maizegenetics.dna.map.AbstractTagsOnPhysicalMap
 
getStartPosition() - Method in class net.maizegenetics.dna.map.DonorHaplotypes
 
getStartPosition(tagIndex) - Method in class net.maizegenetics.dna.map.TagsOnPhysicalMapV3
 
getStartPosition(index) - Method in interface net.maizegenetics.dna.map.TOPMInterface
Returns start position of given tag.
getState() - Method in exception net.maizegenetics.util.db.DataAccessException
 
getSteps() - Method in class net.maizegenetics.analysis.modelfitter.StepwiseAdditiveModelFitter
 
getStepSize() - Method in class net.maizegenetics.analysis.filter.FilterAlignmentPlugin
 
getStrand(tagIndex) - Method in class net.maizegenetics.dna.map.AbstractTagsOnPhysicalMap
 
getStrand() - Method in class net.maizegenetics.dna.map.GeneralPosition
 
getStrand(tagIndex, mappingIndex) - Method in class net.maizegenetics.dna.map.PETagsOnPhysicalMapV3
Return strand of a mapping
getStrand(value) - Static method in interface net.maizegenetics.dna.map.Position
 
getStrand(value) - Static method in interface net.maizegenetics.dna.map.Position
 
getStrand() - Method in interface net.maizegenetics.dna.map.Position
Return the strand for a site definition
getStrand() - Method in class net.maizegenetics.dna.map.TagLocus
 
getStrand(tagIndex) - Method in class net.maizegenetics.dna.map.TagsOnPhysicalMapV3
 
getStrand(tagIndex) - Method in interface net.maizegenetics.dna.map.TOPMInterface
Returns Strand for given tag.
getStrandB(index) - Method in class net.maizegenetics.dna.map.AbstractPETagsOnPhysicalMap
 
getStrandContig(index) - Method in class net.maizegenetics.dna.map.AbstractPETagsOnPhysicalMap
 
getStrandF(index) - Method in class net.maizegenetics.dna.map.AbstractPETagsOnPhysicalMap
 
getStrandFromLine(mline, isVCF, tabPos) - Static method in class net.maizegenetics.analysis.gobii.GOBII_IFLUtils
 
getStrandStr() - Method in class net.maizegenetics.dna.map.GeneralPosition
 
getStrandStr() - Method in interface net.maizegenetics.dna.map.Position
 
getString(key) - Method in class net.maizegenetics.util.ArgsEngine
Gets the value for a valued option.
getStringGenotype(site) - Method in class net.maizegenetics.phenotype.GenotypePhenotype
 
getSublevel(sublevel) - Method in class net.maizegenetics.stats.linearmodels.BasicLevel
 
getSublevel(sublevel) - Method in interface net.maizegenetics.stats.linearmodels.Level
 
getSublevels() - Method in class net.maizegenetics.stats.linearmodels.BasicLevel
 
getSublevels() - Method in interface net.maizegenetics.stats.linearmodels.Level
 
getSubSample(sample) - Method in class net.maizegenetics.analysis.modelfitter.AddPlusDomModelEffect
 
getSubSample(sample) - Method in class net.maizegenetics.stats.linearmodels.CovariateModelEffect
 
getSubSample(sample) - Method in class net.maizegenetics.stats.linearmodels.FactorModelEffect
 
getSubSample(sample) - Method in interface net.maizegenetics.stats.linearmodels.ModelEffect
 
getSubSample(sample) - Method in class net.maizegenetics.stats.linearmodels.NestedCovariateModelEffect
 
getSubsetOfA(exclude) - Method in class net.maizegenetics.stats.linearmodels.SweepFast
 
getSubtree(root, node) - Static method in class net.maizegenetics.taxa.tree.RootedTreeUtils
 
getSuggestedOrdering(defaultOrdering) - Method in interface net.maizegenetics.stats.math.OrthogonalHints
If there is a "best" ordering to use it can be specified here, if not should return null
getSum() - Method in class net.maizegenetics.stats.linearmodels.CovariateModelEffect
 
getSumSquares() - Method in class net.maizegenetics.stats.linearmodels.CovariateModelEffect
 
getTableCellRendererComponent(table, value, isSelected, hasFocus, row, col) - Method in class net.maizegenetics.gui.AlignmentTableCellRenderer
 
getTableCellRendererComponent(table, value, isSelected, hasFocus, row, col) - Method in class net.maizegenetics.gui.TOPMGenotypeTableCellRenderer
 
getTableColumnNames() - Method in class net.maizegenetics.analysis.popgen.DiversityAnalyses
 
getTableColumnNames() - Method in class net.maizegenetics.analysis.popgen.LinkageDisequilibrium
 
getTableColumnNames() - Method in class net.maizegenetics.analysis.popgen.PolymorphismDistribution
 
getTableColumnNames() - Method in class net.maizegenetics.dna.map.PositionListTableReport
 
getTableColumnNames() - Method in class net.maizegenetics.dna.map.TOPMTableReport
 
getTableColumnNames() - Method in class net.maizegenetics.dna.snp.FilterTableReport
 
getTableColumnNames() - Method in class net.maizegenetics.phenotype.CorePhenotype
 
getTableColumnNames() - Method in class net.maizegenetics.phenotype.FilterPhenotype
 
getTableColumnNames() - Method in class net.maizegenetics.phenotype.GenotypePhenotype
 
getTableColumnNames() - Method in class net.maizegenetics.taxa.distance.DistanceMatrix
 
getTableColumnNames() - Method in class net.maizegenetics.taxa.IdentifierSynonymizer
 
getTableColumnNames() - Method in class net.maizegenetics.taxa.TaxaListTableReport
 
getTableColumnNames() - Method in class net.maizegenetics.util.HDF5TableReport
 
getTableColumnNames() - Method in class net.maizegenetics.util.SimpleTableReport
Return column names for the table
getTableColumnNames() - Method in interface net.maizegenetics.util.TableReport
Get the names of the columns
getTableData() - Method in class net.maizegenetics.analysis.popgen.PolymorphismDistribution
 
getTableDisplayPlugin(filename, flag) - Method in class net.maizegenetics.pipeline.TasselPipeline
 
getTableTitle() - Method in class net.maizegenetics.analysis.popgen.DiversityAnalyses
 
getTableTitle() - Method in class net.maizegenetics.analysis.popgen.LinkageDisequilibrium
 
getTableTitle() - Method in class net.maizegenetics.analysis.popgen.PolymorphismDistribution
 
getTableTitle() - Method in class net.maizegenetics.dna.map.PositionListTableReport
 
getTableTitle() - Method in class net.maizegenetics.dna.map.TOPMTableReport
 
getTableTitle() - Method in class net.maizegenetics.dna.snp.FilterTableReport
 
getTableTitle() - Method in class net.maizegenetics.phenotype.CorePhenotype
 
getTableTitle() - Method in class net.maizegenetics.phenotype.FilterPhenotype
 
getTableTitle() - Method in class net.maizegenetics.phenotype.GenotypePhenotype
 
getTableTitle() - Method in class net.maizegenetics.taxa.distance.DistanceMatrix
 
getTableTitle() - Method in class net.maizegenetics.taxa.IdentifierSynonymizer
 
getTableTitle() - Method in class net.maizegenetics.taxa.TaxaListTableReport
 
getTableTitle() - Method in class net.maizegenetics.util.HDF5TableReport
 
getTableTitle() - Method in class net.maizegenetics.util.SimpleTableReport
Return the name for the title of the ANOVA
getTableTitle() - Method in interface net.maizegenetics.util.TableReport
Get the title of the table
getTag(index) - Method in class net.maizegenetics.dna.map.PETagsOnPhysicalMapV3
 
getTag(index) - Method in class net.maizegenetics.dna.tag.AbstractTags
 
getTag(index) - Method in interface net.maizegenetics.dna.tag.Tags
Get the compressed read sequence in a long array for a given index
getTag(index) - Method in class net.maizegenetics.dna.tag.UTagPairs
 
getTagAlignmentApproaches() - Method in interface net.maizegenetics.dna.tag.RepGenData
 
getTagAlignmentApproaches() - Method in class net.maizegenetics.dna.tag.RepGenSQLite
 
getTagAlignmentApproaches() - Method in interface net.maizegenetics.dna.tag.TagData
 
getTagAlignmentApproaches() - Method in class net.maizegenetics.dna.tag.TagDataSQLite
 
getTagAlignmentsForRefTag(refTag, minscore) - Method in interface net.maizegenetics.dna.tag.RepGenData
Map of all non-reftag alignments for specified ref tag.
getTagAlignmentsForRefTag(refTag, minscore) - Method in class net.maizegenetics.dna.tag.RepGenSQLite
 
getTagAlignmentsForTags(tags, minscore) - Method in interface net.maizegenetics.dna.tag.RepGenData
Method returns a map of all tag (non-ref) alignments for specified non-ref tags. All tags on the list must be non-ref tags as the tagID is pulled from the tagTagIDMap.
getTagAlignmentsForTags(tags, minscore) - Method in class net.maizegenetics.dna.tag.RepGenSQLite
 
getTagB(index) - Method in class net.maizegenetics.dna.tag.AbstractPETags
 
getTagB(index) - Method in interface net.maizegenetics.dna.tag.PETags
Get the compressed backward tag sequence in a long array for a given index
getTagBLength(index) - Method in class net.maizegenetics.dna.tag.AbstractPETags
 
getTagBLength(index) - Method in interface net.maizegenetics.dna.tag.PETags
Returns the length in bp of a backward tag
getTagCount() - Method in class net.maizegenetics.dna.map.PETagsOnPhysicalMapV3
 
getTagCount() - Method in class net.maizegenetics.dna.tag.AbstractPETags
 
getTagCount() - Method in class net.maizegenetics.dna.tag.AbstractTags
 
getTagCount() - Method in interface net.maizegenetics.dna.tag.PETags
This is the number of different PE tags in the list (NOT THE SUM OF THE COUNTS) The index will vary from 0 to (ReadTotal-1) This is the number of distinct tags if readUnique is true
getTagCount() - Method in class net.maizegenetics.dna.tag.TagCounts
I don't know why we have 4 or 5 methods with different names that do exactly the same thing. I'm just putting this here because it's defined in the abstract class and its absence is causing problems.
getTagCount() - Method in interface net.maizegenetics.dna.tag.Tags
This is the number of different tags in the list (NOT THE SUM OF THE COUNTS) The index will vary from 0 to (ReadTotal-1) This is the number of distinct tags if readUnique is true
getTagCutPosition(tag) - Method in interface net.maizegenetics.dna.tag.RepGenData
Get the cut position associated with a list of tags. Return a map of Tag/CutPosition The Position object is returned to facilitate grabbing both physical position and strand information.
getTagCutPosition(tagSet) - Method in class net.maizegenetics.dna.tag.RepGenSQLite
Get the cut position associated with each tag in a set. Return a map of Tag/Position from which the cut position/strand will be pulled. This is used in debugging with the SNPCutPosTagVerificationPlugin
getTagCutPosition(tag) - Method in interface net.maizegenetics.dna.tag.TagData
Get the cut position associated with a list of tags. Return a map of Tag/CutPosition The Position object is returned to facilitate grabbing both physical position and strand information.
getTagCutPosition(tagSet) - Method in class net.maizegenetics.dna.tag.TagDataSQLite
Get the cut position associated with each tag in a set. Return a map of Tag/Position from which the cut position/strand will be pulled. This is used in debugging with the SNPCutPosTagVerificationPlugin
getTagCutPositions(onlyBest) - Method in interface net.maizegenetics.dna.tag.RepGenData
Get all of the genomic cut positions associated with all tags. Positions in the position list are annotated with cigarAlignment, isBest, alignmentApproach, and supportValue.
getTagCutPositions(chromosome, firstPosition, lastPosition, onlyBest) - Method in interface net.maizegenetics.dna.tag.RepGenData
Get the unique list of position that tags to for a specific chromosome within a range.
getTagCutPositions(chromosome, firstPosition, lastPosition, onlyBest) - Method in class net.maizegenetics.dna.tag.RepGenSQLite
 
getTagCutPositions(onlyBest) - Method in class net.maizegenetics.dna.tag.RepGenSQLite
 
getTagCutPositions(onlyBest) - Method in interface net.maizegenetics.dna.tag.TagData
Get all of the genomic cut positions associated with all tags. Positions in the position list are annotated with cigarAlignment, isBest, alignmentApproach, and supportValue.
getTagCutPositions(chromosome, firstPosition, lastPosition, onlyBest) - Method in interface net.maizegenetics.dna.tag.TagData
Get the unique list of position that tags to for a specific chromosome within a range.
getTagCutPositions(onlyBest) - Method in class net.maizegenetics.dna.tag.TagDataSQLite
 
getTagCutPositions(chromosome, firstPosition, lastPosition, onlyBest) - Method in class net.maizegenetics.dna.tag.TagDataSQLite
 
getTagDepth(taxon, position) - Method in interface net.maizegenetics.dna.tag.RepGenData
 
getTagDepth(taxon, position) - Method in class net.maizegenetics.dna.tag.RepGenSQLite
 
getTagDepth(taxon, position) - Method in interface net.maizegenetics.dna.tag.TagData
 
getTagDepth(taxon, position) - Method in class net.maizegenetics.dna.tag.TagDataSQLite
 
getTagF(index) - Method in class net.maizegenetics.dna.tag.AbstractPETags
 
getTagF(index) - Method in interface net.maizegenetics.dna.tag.PETags
Get the compressed forward tag sequence in a long array for a given index
getTagFLength(index) - Method in class net.maizegenetics.dna.tag.AbstractPETags
 
getTagFLength(index) - Method in interface net.maizegenetics.dna.tag.PETags
Returns the length in bp of a forward tag
getTagGWASMapInfo(tagIndex) - Method in class net.maizegenetics.dna.map.TagGWASMap
 
getTagIndex(read) - Method in class net.maizegenetics.dna.map.PETagsOnPhysicalMapV3
This may return one of multiple identical 64 bp tags, which are essentially differnt in full-length PE tags
getTagIndex(tagF, tagB) - Method in class net.maizegenetics.dna.tag.AbstractPETags
 
getTagIndex(read) - Method in class net.maizegenetics.dna.tag.AbstractTags
 
getTagIndex(tagF, tagB) - Method in interface net.maizegenetics.dna.tag.PETags
Gets the index of a PE tag (including forward and backward) (the only one if a unique list). If the read is not found then it return a negative value indicating its insertion point.
getTagIndex(read) - Method in interface net.maizegenetics.dna.tag.Tags
Gets the first index of a read (the only one if a unique list). If the read is not found then it return a negative value indicating its insertion point.
getTagIndexFirst(readFirst) - Method in class net.maizegenetics.dna.tag.AbstractTags
 
getTagIndexSet(read) - Method in class net.maizegenetics.dna.map.PETagsOnPhysicalMapV3
Return the range of identical 64 bp tags, [0,3] means {0,1,2} are identical. When the read doesn't exist, return null
getTagIndexSet(read) - Method in class net.maizegenetics.dna.tag.AbstractTags
 
getTagIndexSet(read) - Method in class net.maizegenetics.dna.tag.TagCounts
 
getTagIndexSet(read) - Method in interface net.maizegenetics.dna.tag.Tags
Gets the set indices of matching reads (the only one if a unique list). If the read is not found then it returns a null array indicating its insertion point.
getTagIndexWithLongestSeq(read) - Method in class net.maizegenetics.dna.map.PETagsOnPhysicalMapV3
Return the index of 64 bp tag with alignment of longest PE tag, when there are multiple identical 64 bp tags. When the tag is not found, return -1
getTagLength(index) - Method in class net.maizegenetics.dna.map.PETagsOnPhysicalMapV3
 
getTagLength(index) - Method in class net.maizegenetics.dna.tag.AbstractTags
 
getTagLength() - Method in class net.maizegenetics.dna.tag.AbstractTags
 
getTagLength(index) - Method in class net.maizegenetics.dna.tag.TagCounts
 
getTagLength(index) - Method in interface net.maizegenetics.dna.tag.Tags
Returns the length in bp of a particular tag
getTagLength(index) - Method in class net.maizegenetics.dna.tag.UTagPairs
 
getTagLengthArray() - Method in class net.maizegenetics.dna.map.AbstractTagsOnPhysicalMap
 
getTagLengthInLong() - Method in class net.maizegenetics.analysis.gbs.PEReadBarcodeResult
Return tag length in Long primitive data type
getTagLookTable() - Method in class net.maizegenetics.analysis.gbs.TagMatchFinder
 
getTagNum() - Method in class net.maizegenetics.dna.tag.UTagPairs
 
getTagPair(tc, etr) - Method in class net.maizegenetics.analysis.gbs.UNetworkFilter
 
getTagPath(tag) - Static method in class net.maizegenetics.util.HDF5Utils
 
getTags() - Method in class net.maizegenetics.analysis.rna.FindMatchByWordHash
Returns a unmodifiable list of the tags (reference sequences)
getTags() - Method in interface net.maizegenetics.dna.tag.RepGenData
Set of all tags
getTags() - Method in class net.maizegenetics.dna.tag.RepGenSQLite
 
getTags() - Method in class net.maizegenetics.dna.tag.TagCounts
 
getTags() - Method in interface net.maizegenetics.dna.tag.TagData
Set of all tags
getTags() - Method in class net.maizegenetics.dna.tag.TagDataSQLite
 
getTags(reader) - Static method in class net.maizegenetics.util.HDF5Utils
 
getTagsArray() - Method in class net.maizegenetics.dna.map.AbstractTagsOnPhysicalMap
 
GetTagSequenceFromDBPlugin - Class in net.maizegenetics.analysis.gbs.v2
This plugin queries a GBSv2 sql database for existing tags. If the user specifies a tag, and the tag is found, a tab-delimited file is written containing that tag sequence. If the tag is NOT found, a tab-delimited file is written that shows the tag and "not found". If no tag sequence is specified, the method will print out all tag sequences stored in the specified db. If input db not found, plugin throws an exception. If output directory doesn't exist, plugin throws an exception
GetTagSequenceFromDBPlugin() - Constructor for class net.maizegenetics.analysis.gbs.v2.GetTagSequenceFromDBPlugin
 
GetTagSequenceFromDBPlugin(parentFrame) - Constructor for class net.maizegenetics.analysis.gbs.v2.GetTagSequenceFromDBPlugin
 
GetTagSequenceFromDBPlugin(parentFrame, isInteractive) - Constructor for class net.maizegenetics.analysis.gbs.v2.GetTagSequenceFromDBPlugin
 
getTagsForAllele(position, allele) - Method in interface net.maizegenetics.dna.tag.RepGenData
Return all tags that call a particular SNP position allele. Empty list is returned if there are no tags.
getTagsForAllele(allele) - Method in interface net.maizegenetics.dna.tag.RepGenData
Return all tags that call a particular SNP position allele. Empty list is returned if there are no tags.
getTagsForAllele(position, allele) - Method in class net.maizegenetics.dna.tag.RepGenSQLite
 
getTagsForAllele(allele) - Method in class net.maizegenetics.dna.tag.RepGenSQLite
 
getTagsForAllele(position, allele) - Method in interface net.maizegenetics.dna.tag.TagData
Return all tags that call a particular SNP position allele. Empty list is returned if there are no tags.
getTagsForAllele(allele) - Method in interface net.maizegenetics.dna.tag.TagData
Return all tags that call a particular SNP position allele. Empty list is returned if there are no tags.
getTagsForAllele(position, allele) - Method in class net.maizegenetics.dna.tag.TagDataSQLite
 
getTagsForAllele(allele) - Method in class net.maizegenetics.dna.tag.TagDataSQLite
 
getTagsForSNPPosition(position) - Method in interface net.maizegenetics.dna.tag.TagData
Return all tags that cover a particular SNP position. Empty list is returned if there are no tags.
getTagsForSNPPosition(position) - Method in class net.maizegenetics.dna.tag.TagDataSQLite
 
getTagsForTaxon(taxon) - Method in interface net.maizegenetics.dna.tag.RepGenData
Returns the list of tags present of a taxon. Note this could be a very compute intensive request.
getTagsForTaxon(taxon) - Method in class net.maizegenetics.dna.tag.RepGenSQLite
 
getTagsForTaxon(taxon) - Method in interface net.maizegenetics.dna.tag.TagData
Returns the list of tags present of a taxon. Note this could be a very compute intensive request.
getTagsForTaxon(taxon) - Method in class net.maizegenetics.dna.tag.TagDataSQLite
 
getTagSizeInLong() - Method in class net.maizegenetics.dna.map.PETagsOnPhysicalMapV3
 
getTagSizeInLong() - Method in class net.maizegenetics.dna.tag.AbstractPETags
 
getTagSizeInLong() - Method in class net.maizegenetics.dna.tag.AbstractTags
 
getTagSizeInLong() - Method in interface net.maizegenetics.dna.tag.PETags
Returns the number of long use to represent the sequence
getTagSizeInLong() - Method in class net.maizegenetics.dna.tag.TagCounts
 
getTagSizeInLong() - Method in interface net.maizegenetics.dna.tag.Tags
Returns the number of longs use to represent the sequence
getTagsNameMap() - Method in interface net.maizegenetics.dna.tag.RepGenData
Map of all tags with associated names
getTagsNameMap() - Method in class net.maizegenetics.dna.tag.RepGenSQLite
 
getTagsNameMap() - Method in interface net.maizegenetics.dna.tag.TagData
Map of all tags with associated names
getTagsNameMap() - Method in class net.maizegenetics.dna.tag.TagDataSQLite
 
getTagsTaxaMap(cutPosition) - Method in interface net.maizegenetics.dna.tag.TagData
For a given genomic position returns of the map tags and their distribution.
getTagsTaxaMap(cutPosition) - Method in class net.maizegenetics.dna.tag.TagDataSQLite
 
getTagsWithDepth(minimumDepth) - Method in interface net.maizegenetics.dna.tag.RepGenData
 
getTagsWithDepth(minimumDepth) - Method in class net.maizegenetics.dna.tag.RepGenSQLite
 
getTagsWithDepth(minimumDepth) - Method in interface net.maizegenetics.dna.tag.TagData
 
getTagsWithDepth(minimumDepth) - Method in class net.maizegenetics.dna.tag.TagDataSQLite
 
GetTagTaxaDistFromDBPlugin - Class in net.maizegenetics.analysis.gbs.v2
This plugin takes a GBSv2 database as input, queries for the tags and their taxa distribution, and creates a tab-delimited file of tag and taxa-distribution. IT can be used for verifying data in the db. The user may supply a file with tab-delimited columns specifying on which tags to present data. The input "tag" file must have at least 1 column named "TAGS" (any case - Tags/TAGS/tags). Other data in the file will be ignored. Output: A tab-delimited file where the first column is the tag, and subsequent columns indicate taxa found in the db. The values in the "taxa" columns are the number of occurranes of that tag for that taxa.
GetTagTaxaDistFromDBPlugin() - Constructor for class net.maizegenetics.analysis.gbs.v2.GetTagTaxaDistFromDBPlugin
 
GetTagTaxaDistFromDBPlugin(parentFrame) - Constructor for class net.maizegenetics.analysis.gbs.v2.GetTagTaxaDistFromDBPlugin
 
GetTagTaxaDistFromDBPlugin(parentFrame, isInteractive) - Constructor for class net.maizegenetics.analysis.gbs.v2.GetTagTaxaDistFromDBPlugin
 
getTasselClasses() - Static method in class net.maizegenetics.util.Utils
 
getTaxaCount() - Method in class net.maizegenetics.dna.snp.genotypecall.GenotypeCallTableBuilder
 
getTaxaCount() - Method in class net.maizegenetics.dna.tag.AbstractTagsByTaxa
 
getTaxaCount() - Method in class net.maizegenetics.dna.tag.ReadsByTaxa
 
getTaxaCount() - Method in interface net.maizegenetics.dna.tag.TagsByTaxa
Returns the number of taxa (samples)
getTaxaCount() - Method in class net.maizegenetics.dna.tag.TagsByTaxaByteHDF5TaxaGroups
 
getTaxaCountForRead(readIndex) - Method in class net.maizegenetics.dna.tag.ReadsByTaxa
 
getTaxaDistribution(tag) - Method in interface net.maizegenetics.dna.tag.RepGenData
Returns the TaxaDistribution for a given taxa. If distribution data is not available, null is returned.
getTaxaDistribution(tag) - Method in class net.maizegenetics.dna.tag.RepGenSQLite
 
getTaxaDistribution(tag) - Method in interface net.maizegenetics.dna.tag.TagData
Returns the TaxaDistribution for a given taxa. If distribution data is not available, null is returned.
getTaxaDistribution(tag) - Method in class net.maizegenetics.dna.tag.TagDataSQLite
 
getTaxaGroupAlignments(a, parentIndex, snpIndices) - Static method in class net.maizegenetics.analysis.imputation.NucleotideImputationUtils
 
getTaxaIncremental(positionList) - Static method in class net.maizegenetics.dna.snp.GenotypeTableBuilder
Creates an in memory builder for addition by taxon. Each taxon can only be added once, i.e. merging is not possible
getTaxaIncremental(positionList, mergeRule) - Static method in class net.maizegenetics.dna.snp.GenotypeTableBuilder
Creates an in memory builder for addition by taxon, which permits the merging of taxa.
getTaxaIncremental(genotypeTable, mergeRule) - Static method in class net.maizegenetics.dna.snp.GenotypeTableBuilder
Creates a builder initialized with the Genotypes in a existing GenotypeTable. The position list and initial taxa list is derived from the positions, taxa, and genotypes already in the GenotypeTable. The initial GenotypeTable is not changed as it is immutable.
getTaxaIncremental(positionList, newHDF5File) - Static method in class net.maizegenetics.dna.snp.GenotypeTableBuilder
Create a new taxa incremental HDF5 GenotypeTableBuilder
getTaxaIncrementalWithMerging(newHDF5File, positionList, mergeRule) - Static method in class net.maizegenetics.dna.snp.GenotypeTableBuilder
Creates a new taxa incremental HDF5 GenotypeTableBuilder to which replicate taxa can be added
getTaxaIndex() - Method in class net.maizegenetics.analysis.gbs.Barcode
 
getTaxaInMarkerSSdf() - Method in class net.maizegenetics.stats.linearmodels.SweepFastNestedModel
 
getTaxaInstance(genotype) - Static method in class net.maizegenetics.dna.snp.genotypecall.ListStats
 
getTaxaList() - Method in class net.maizegenetics.dna.tag.AbstractTagsByTaxa
 
getTaxaList() - Method in interface net.maizegenetics.dna.tag.RepGenData
Returns the taxa list associated with taxa distribution
getTaxaList() - Method in class net.maizegenetics.dna.tag.RepGenSQLite
 
getTaxaList() - Method in interface net.maizegenetics.dna.tag.TagData
Returns the taxa list associated with taxa distribution
getTaxaList() - Method in class net.maizegenetics.dna.tag.TagDataSQLite
 
getTaxaList() - Method in interface net.maizegenetics.dna.tag.TagsByTaxa
Return taxa list of this alignment.
getTaxaList() - Method in class net.maizegenetics.taxa.distance.DistanceMatrix
Return TaxaList of this alignment.
getTaxaList() - Method in class net.maizegenetics.taxa.IdentifierSynonymizer
 
getTaxaList() - Method in class net.maizegenetics.taxa.TaxaListTableReport
 
GetTaxaListPlugin - Class in net.maizegenetics.analysis.data
 
GetTaxaListPlugin(parentFrame, isInteractive) - Constructor for class net.maizegenetics.analysis.data.GetTaxaListPlugin
 
getTaxaName() - Method in class net.maizegenetics.analysis.gbs.Barcode
 
getTaxaName(taxaIndex) - Method in class net.maizegenetics.dna.tag.AbstractTagsByTaxa
 
getTaxaName(taxaIndex) - Method in class net.maizegenetics.dna.tag.ReadsByTaxa
 
getTaxaName(taxaIndex) - Method in interface net.maizegenetics.dna.tag.TagsByTaxa
Returns the name of a taxon
getTaxaName(taxaIndex) - Method in class net.maizegenetics.dna.tag.TagsByTaxaByteHDF5TaxaGroups
 
getTaxaNames() - Method in class net.maizegenetics.analysis.gbs.ParseBarcodeRead
Returns the taxaNames for the flowcell and lane
getTaxaNames() - Method in class net.maizegenetics.dna.tag.AbstractTagsByTaxa
 
getTaxaNames() - Method in class net.maizegenetics.dna.tag.ReadsByTaxa
 
getTaxaNames() - Method in interface net.maizegenetics.dna.tag.TagsByTaxa
Returns an array of taxa names
getTaxaNames() - Method in class net.maizegenetics.dna.tag.TagsByTaxaByteHDF5TaxaGroups
 
getTaxaNum() - Method in class net.maizegenetics.analysis.gbs.SimpleGenotypeSBit
 
getTaxaReadBitsForTag(tagIndex) - Method in class net.maizegenetics.dna.tag.AbstractTagsByTaxa
 
getTaxaReadBitsForTag(tagIndex) - Method in interface net.maizegenetics.dna.tag.TagsByTaxa
The presence/absence of the taxa in a bitSet format (1=present, 0=absent)
getTaxaReadCountsForTag(tagIndex) - Method in class net.maizegenetics.dna.tag.AbstractTagsByTaxa
 
getTaxaReadCountsForTag(tagIndex) - Method in interface net.maizegenetics.dna.tag.TagsByTaxa
Returns all read counts for a specified tag index.
getTaxon() - Method in class net.maizegenetics.analysis.distance.DistanceMatrixRangesPlugin
 
getTaxon() - Method in class net.maizegenetics.analysis.gbs.Barcode
 
getTaxon(i) - Method in class net.maizegenetics.taxa.distance.DistanceMatrix
 
getTaxon(reader, taxonName) - Static method in class net.maizegenetics.util.HDF5Utils
 
getTaxonIndex() - Method in class net.maizegenetics.analysis.gbs.ReadBarcodeResult
 
getTaxonIndex(taxonName) - Method in class net.maizegenetics.analysis.gbs.SimpleGenotypeSBit
 
getTaxonName() - Method in class net.maizegenetics.analysis.gbs.PEReadBarcodeResult
Return taxon name of the sequence
getTaxonName() - Method in class net.maizegenetics.analysis.gbs.ReadBarcodeResult
Return taxon name implied by the barcode sequence
getTaxonName() - Method in class net.maizegenetics.analysis.gbs.ShortReadBarcodeResult
 
getTaxonPath(taxon) - Static method in class net.maizegenetics.util.Tassel5HDF5Constants
 
getTaxonSiteFromKey(keyStr) - Static method in class net.maizegenetics.analysis.avro.AvroConstants
 
getTBTIndexOfTag(tagIndex) - Method in class net.maizegenetics.dna.map.TagLocus
 
getTechnique() - Method in class net.maizegenetics.taxa.IdentifierSynonymizer
 
getTestSite() - Method in class net.maizegenetics.analysis.popgen.LinkageDisequilibriumPlugin
 
getTestSiteName() - Method in class net.maizegenetics.analysis.popgen.LinkageDisequilibriumPlugin
 
getTextAnnotation(annoName) - Method in interface net.maizegenetics.util.GeneralAnnotation
Returns all annotation value for a given annotation key
getTextAnnotation(annoName) - Method in class net.maizegenetics.util.GeneralAnnotationStorage
 
getTheBarcodes(index) - Method in class net.maizegenetics.analysis.gbs.ParseBarcodeRead
Returns the class Barcode for the flowcell and lane
getTheFileType() - Method in class net.maizegenetics.analysis.data.FileLoadPlugin
 
getThis() - Method in class net.maizegenetics.tassel.DataTreePanel
 
getTissueDepths(tissueNum, taxaNum) - Method in class net.maizegenetics.taxa.TaxaTissueDist
 
getTissueIndex() - Method in class net.maizegenetics.analysis.gbs.Barcode
 
getTol() - Method in class net.maizegenetics.matrixalgebra.decomposition.EJMLSingularValueDecomposition
 
getTol() - Method in class net.maizegenetics.matrixalgebra.Matrix.EJMLDoubleMatrix
 
getTolerance() - Method in class net.maizegenetics.matrixalgebra.decomposition.BlasSingularValueDecomposition
 
getToolTipText() - Method in class net.maizegenetics.analysis.association.EqtlAssociationPlugin
 
getToolTipText() - Method in class net.maizegenetics.analysis.association.FastMultithreadedAssociationPlugin
 
getToolTipText() - Method in class net.maizegenetics.analysis.association.FixedEffectLMPlugin
 
getToolTipText() - Method in class net.maizegenetics.analysis.association.GenomicSelectionPlugin
 
getToolTipText() - Method in class net.maizegenetics.analysis.association.MLMPlugin
 
getToolTipText() - Method in class net.maizegenetics.analysis.association.RidgeRegressionEmmaPlugin
 
getToolTipText() - Method in class net.maizegenetics.analysis.association.WeightedMLMPlugin
 
getToolTipText() - Method in class net.maizegenetics.analysis.b4r.GetPhenotypeFromB4RPlugin
 
getToolTipText() - Method in class net.maizegenetics.analysis.chart.ChartDisplayPlugin
Tool Tip Text for this plugin
getToolTipText() - Method in class net.maizegenetics.analysis.chart.ManhattanDisplayPlugin
Tool Tip Text for this plugin
getToolTipText() - Method in class net.maizegenetics.analysis.chart.QQDisplayPlugin
Tool Tip Text for this plugin
getToolTipText() - Method in class net.maizegenetics.analysis.chart.TableDisplayPlugin
Tool Tip Text for this plugin
getToolTipText() - Method in class net.maizegenetics.analysis.data.AddReferenceAlleleToHDF5Plugin
 
getToolTipText() - Method in class net.maizegenetics.analysis.data.AddReferenceToGenotypePlugin
 
getToolTipText() - Method in class net.maizegenetics.analysis.data.AdjustPhasingPlugin
 
getToolTipText() - Method in class net.maizegenetics.analysis.data.BuildUnfinishedHDF5GenotypesPlugin
 
getToolTipText() - Method in class net.maizegenetics.analysis.data.CombineDataSetsPlugin
 
getToolTipText() - Method in class net.maizegenetics.analysis.data.ConvertAlignmentCoordinatesPlugin
 
getToolTipText() - Method in class net.maizegenetics.analysis.data.CountAssociationsPlugin
 
getToolTipText() - Method in class net.maizegenetics.analysis.data.CreateHybridGenotypesPlugin
 
getToolTipText() - Method in class net.maizegenetics.analysis.data.ExportMultiplePlugin
Tool Tip Text for this plugin
getToolTipText() - Method in class net.maizegenetics.analysis.data.ExportPlugin
Tool Tip Text for this plugin
getToolTipText() - Method in class net.maizegenetics.analysis.data.ExtractHapmapSubsetPlugin
 
getToolTipText() - Method in class net.maizegenetics.analysis.data.FeatureListToPositionsPlugin
 
getToolTipText() - Method in class net.maizegenetics.analysis.data.FileLoadPlugin
Tool Tip Text for this plugin
getToolTipText() - Method in class net.maizegenetics.analysis.data.FindInversionsPlugin
 
getToolTipText() - Method in class net.maizegenetics.analysis.data.GenomeAnnosDBQueryToPositionListPlugin
 
getToolTipText() - Method in class net.maizegenetics.analysis.data.GenosToABHPlugin
 
getToolTipText() - Method in class net.maizegenetics.analysis.data.GenotypeSummaryPlugin
 
getToolTipText() - Method in class net.maizegenetics.analysis.data.GenotypeToAdditiveValuesPlugin
 
getToolTipText() - Method in class net.maizegenetics.analysis.data.GetPositionListPlugin
 
getToolTipText() - Method in class net.maizegenetics.analysis.data.GetTaxaListPlugin
 
getToolTipText() - Method in class net.maizegenetics.analysis.data.HDF5SummaryPlugin
 
getToolTipText() - Method in class net.maizegenetics.analysis.data.HetsToUnknownPlugin
 
getToolTipText() - Method in class net.maizegenetics.analysis.data.IdentityRecognitionPlugin
 
getToolTipText() - Method in class net.maizegenetics.analysis.data.IndelsToUnknownPlugin
 
getToolTipText() - Method in class net.maizegenetics.analysis.data.IntersectionAlignmentPlugin
Tool Tip Text for this plugin
getToolTipText() - Method in class net.maizegenetics.analysis.data.KmerCountingPlugin
 
getToolTipText() - Method in class net.maizegenetics.analysis.data.LIXPlugin
 
getToolTipText() - Method in class net.maizegenetics.analysis.data.MaskGenotypePlugin
 
getToolTipText() - Method in class net.maizegenetics.analysis.data.MeanR2FromLDPlugin
 
getToolTipText() - Method in class net.maizegenetics.analysis.data.MemoryUsagePlugin
 
getToolTipText() - Method in class net.maizegenetics.analysis.data.MergeAlignmentsSameSitesPlugin
 
getToolTipText() - Method in class net.maizegenetics.analysis.data.MergeGenotypeTablesPlugin
 
getToolTipText() - Method in class net.maizegenetics.analysis.data.MergeGenotypeTablesPluginV2
 
getToolTipText() - Method in class net.maizegenetics.analysis.data.MergeHDF5GenotypesSameSitesPlugin
 
getToolTipText() - Method in class net.maizegenetics.analysis.data.MergeRenameDeleteTaxaPlugin
 
getToolTipText() - Method in class net.maizegenetics.analysis.data.PassThroughPlugin
 
getToolTipText() - Method in class net.maizegenetics.analysis.data.PlinkLoadPlugin
Tool Tip Text for this plugin
getToolTipText() - Method in class net.maizegenetics.analysis.data.PrincipalComponentsPlugin
 
getToolTipText() - Method in class net.maizegenetics.analysis.data.ProjectionLoadPlugin
Tool Tip Text for this plugin
getToolTipText() - Method in class net.maizegenetics.analysis.data.ProjectPcsAndRunModelSelectionPlugin
Tool Tip Text for this plugin
getToolTipText() - Method in class net.maizegenetics.analysis.data.SeparatePlugin
Tool Tip Text for this plugin
getToolTipText() - Method in class net.maizegenetics.analysis.data.SetLowDepthGenosToMissingPlugin
 
getToolTipText() - Method in class net.maizegenetics.analysis.data.SortGenotypeFilePlugin
 
getToolTipText() - Method in class net.maizegenetics.analysis.data.SortTaxaAlphabeticallyPlugin
 
getToolTipText() - Method in class net.maizegenetics.analysis.data.SplitHDF5ByChromosomePlugin
 
getToolTipText() - Method in class net.maizegenetics.analysis.data.SubtractGenotypesPlugin
 
getToolTipText() - Method in class net.maizegenetics.analysis.data.SynonymizerPlugin
Tool Tip Text for this plugin
getToolTipText() - Method in class net.maizegenetics.analysis.data.ThinSitesByPositionPlugin
 
getToolTipText() - Method in class net.maizegenetics.analysis.data.UnionAlignmentPlugin
Tool Tip Text for this plugin
getToolTipText() - Method in class net.maizegenetics.analysis.distance.AddDistanceMatrixPlugin
 
getToolTipText() - Method in class net.maizegenetics.analysis.distance.AMatrixPlugin
 
getToolTipText() - Method in class net.maizegenetics.analysis.distance.DistanceMatrixPlugin
Tool Tip Text for this plugin
getToolTipText() - Method in class net.maizegenetics.analysis.distance.DistanceMatrixRangesPlugin
Tool Tip Text for this plugin
getToolTipText() - Method in class net.maizegenetics.analysis.distance.HMatrixPlugin
 
getToolTipText() - Method in class net.maizegenetics.analysis.distance.KinshipPlugin
 
getToolTipText() - Method in class net.maizegenetics.analysis.distance.MultiDimensionalScalingPlugin
 
getToolTipText() - Method in class net.maizegenetics.analysis.distance.RemoveNaNFromDistanceMatrixPlugin
 
getToolTipText() - Method in class net.maizegenetics.analysis.distance.SubtractDistanceMatrixPlugin
 
getToolTipText() - Method in class net.maizegenetics.analysis.distance.VCAPScanPlugin
 
getToolTipText() - Method in class net.maizegenetics.analysis.filter.FilterAlignmentPlugin
Tool Tip Text for this plugin
getToolTipText() - Method in class net.maizegenetics.analysis.filter.FilterDataSetPlugin
 
getToolTipText() - Method in class net.maizegenetics.analysis.filter.FilterSiteBuilderPlugin
 
getToolTipText() - Method in class net.maizegenetics.analysis.filter.FilterSiteNamePlugin
Deprecated.
Tool Tip Text for this plugin
getToolTipText() - Method in class net.maizegenetics.analysis.filter.FilterSubsetPlugin
Tool Tip Text for this plugin
getToolTipText() - Method in class net.maizegenetics.analysis.filter.FilterTaxaBuilderPlugin
 
getToolTipText() - Method in class net.maizegenetics.analysis.filter.FilterTaxaPropertiesPlugin
Tool Tip Text for this plugin
getToolTipText() - Method in class net.maizegenetics.analysis.filter.FilterTraitsPlugin
 
getToolTipText() - Method in class net.maizegenetics.analysis.gbs.AnnotateTOPMwSAMPlugin
 
getToolTipText() - Method in class net.maizegenetics.analysis.gbs.BinaryToTextPlugin
 
getToolTipText() - Method in class net.maizegenetics.analysis.gbs.CompareGenosBetweenHapMapFilesPlugin
 
getToolTipText() - Method in class net.maizegenetics.analysis.gbs.ContigPETagCountPlugin
 
getToolTipText() - Method in class net.maizegenetics.analysis.gbs.DiscoverySNPCallerPlugin
 
getToolTipText() - Method in class net.maizegenetics.analysis.gbs.FastqToPETagCountPlugin
 
getToolTipText() - Method in class net.maizegenetics.analysis.gbs.FastqToTagCountPlugin
 
getToolTipText() - Method in class net.maizegenetics.analysis.gbs.FastqToTBTPlugin
 
getToolTipText() - Method in class net.maizegenetics.analysis.gbs.KeepSpecifiedReadsinFastqPlugin
 
getToolTipText() - Method in class net.maizegenetics.analysis.gbs.KeepSpecifiedSitesInTOPMPlugin
 
getToolTipText() - Method in class net.maizegenetics.analysis.gbs.KmerToTagCountPlugin
 
getToolTipText() - Method in class net.maizegenetics.analysis.gbs.KmerToTBTPlugin
 
getToolTipText() - Method in class net.maizegenetics.analysis.gbs.MergeDuplicateSNPsPlugin
 
getToolTipText() - Method in class net.maizegenetics.analysis.gbs.MergeMultipleTagCountPlugin
 
getToolTipText() - Method in class net.maizegenetics.analysis.gbs.MergeMultipleTOPMPlugin
 
getToolTipText() - Method in class net.maizegenetics.analysis.gbs.MergePETagCountPlugin
 
getToolTipText() - Method in class net.maizegenetics.analysis.gbs.MergeTagsByTaxaFilesByRowPlugin
 
getToolTipText() - Method in class net.maizegenetics.analysis.gbs.MergeTagsByTaxaFilesPlugin
 
getToolTipText() - Method in class net.maizegenetics.analysis.gbs.ModifyTBTHDF5Plugin
 
getToolTipText() - Method in class net.maizegenetics.analysis.gbs.pana.PanAAddPosToTagMapPlugin
 
getToolTipText() - Method in class net.maizegenetics.analysis.gbs.pana.PanABuildPivotTBTPlugin
 
getToolTipText() - Method in class net.maizegenetics.analysis.gbs.pana.PanABuildTagBlockPosPlugin
 
getToolTipText() - Method in class net.maizegenetics.analysis.gbs.pana.PanABuildTagGWASMapPlugin
 
getToolTipText() - Method in class net.maizegenetics.analysis.gbs.pana.PanABuildTrainingSetPlugin
 
getToolTipText() - Method in class net.maizegenetics.analysis.gbs.pana.PanAFilteringTagMapPlugin
 
getToolTipText() - Method in class net.maizegenetics.analysis.gbs.pana.PanAH5ToAnchorPlugin
 
getToolTipText() - Method in class net.maizegenetics.analysis.gbs.pana.PanAMergeMappingResultPlugin
 
getToolTipText() - Method in class net.maizegenetics.analysis.gbs.pana.PanAModelTrainingPlugin
 
getToolTipText() - Method in class net.maizegenetics.analysis.gbs.pana.PanAPredictionPlugin
 
getToolTipText() - Method in class net.maizegenetics.analysis.gbs.pana.PanAReadDigestPlugin
 
getToolTipText() - Method in class net.maizegenetics.analysis.gbs.pana.PanAReadToKmerPlugin
 
getToolTipText() - Method in class net.maizegenetics.analysis.gbs.pana.PanASamToMultiPositionTOPMPlugin
 
getToolTipText() - Method in class net.maizegenetics.analysis.gbs.pana.PanASplitTagBlockPosPlugin
 
getToolTipText() - Method in class net.maizegenetics.analysis.gbs.pana.PanASplitTBTPlugin
 
getToolTipText() - Method in class net.maizegenetics.analysis.gbs.pana.PanATagGWASMappingPlugin
 
getToolTipText() - Method in class net.maizegenetics.analysis.gbs.pana.PanATagMapToFastaPlugin
 
getToolTipText() - Method in class net.maizegenetics.analysis.gbs.ProductionPipeline
 
getToolTipText() - Method in class net.maizegenetics.analysis.gbs.ProductionSNPCallerPlugin
 
getToolTipText() - Method in class net.maizegenetics.analysis.gbs.QseqToPETagCountPlugin
 
getToolTipText() - Method in class net.maizegenetics.analysis.gbs.QseqToTagCountPlugin
 
getToolTipText() - Method in class net.maizegenetics.analysis.gbs.QseqToTBTPlugin
 
getToolTipText() - Method in class net.maizegenetics.analysis.gbs.repgen.RampSeqAlignFromBlastTags
 
getToolTipText() - Method in class net.maizegenetics.analysis.gbs.repgen.RepGenAlignerPlugin
 
getToolTipText() - Method in class net.maizegenetics.analysis.gbs.repgen.RepGenLDAnalysisPlugin
 
getToolTipText() - Method in class net.maizegenetics.analysis.gbs.repgen.RepGenLoadSeqToDBPlugin
 
getToolTipText() - Method in class net.maizegenetics.analysis.gbs.repgen.RepGenPhase2AlignerPlugin
 
getToolTipText() - Method in class net.maizegenetics.analysis.gbs.repgen.RGBSProductionSNPCallerPlugin
 
getToolTipText() - Method in class net.maizegenetics.analysis.gbs.SAMConverterPlugin
 
getToolTipText() - Method in class net.maizegenetics.analysis.gbs.SAMWGMapConverterPlugin
 
getToolTipText() - Method in class net.maizegenetics.analysis.gbs.SeqToTBTHDF5Plugin
 
getToolTipText() - Method in class net.maizegenetics.analysis.gbs.TagAgainstAnchorPlugin
 
getToolTipText() - Method in class net.maizegenetics.analysis.gbs.TagCountToFastqPlugin
 
getToolTipText() - Method in class net.maizegenetics.analysis.gbs.TextToBinaryPlugin
 
getToolTipText() - Method in class net.maizegenetics.analysis.gbs.TOPMSummaryPlugin
 
getToolTipText() - Method in class net.maizegenetics.analysis.gbs.UTagCountToTagPairPlugin
 
getToolTipText() - Method in class net.maizegenetics.analysis.gbs.UTagPairToTOPMPlugin
 
getToolTipText() - Method in class net.maizegenetics.analysis.gbs.v2.DiscoverySNPCallerPluginV2
 
getToolTipText() - Method in class net.maizegenetics.analysis.gbs.v2.GBSSeqToTagDBPlugin
 
getToolTipText() - Method in class net.maizegenetics.analysis.gbs.v2.GetTagSequenceFromDBPlugin
 
getToolTipText() - Method in class net.maizegenetics.analysis.gbs.v2.GetTagTaxaDistFromDBPlugin
 
getToolTipText() - Method in class net.maizegenetics.analysis.gbs.v2.ProductionSNPCallerPluginV2
 
getToolTipText() - Method in class net.maizegenetics.analysis.gbs.v2.SAMToGBSdbPlugin
 
getToolTipText() - Method in class net.maizegenetics.analysis.gbs.v2.SNPCutPosTagVerificationPlugin
 
getToolTipText() - Method in class net.maizegenetics.analysis.gbs.v2.SNPQualityProfilerPlugin
 
getToolTipText() - Method in class net.maizegenetics.analysis.gbs.v2.TagExportToFastqPlugin
 
getToolTipText() - Method in class net.maizegenetics.analysis.gbs.v2.UpdateSNPPositionQualityPlugin
 
getToolTipText() - Method in class net.maizegenetics.analysis.gobii.GOBIIPlugin
 
getToolTipText() - Method in class net.maizegenetics.analysis.gobii.GWAS_IFLPlugin
 
getToolTipText() - Method in class net.maizegenetics.analysis.gobii.HapBreakpoints_IFLFilePlugin
 
getToolTipText() - Method in class net.maizegenetics.analysis.gobii.MarkerDNARun_IFLFilePlugin
 
getToolTipText() - Method in class net.maizegenetics.analysis.gobii.MonetDB_IFLFilePlugin
 
getToolTipText() - Method in class net.maizegenetics.analysis.gobii.PreProcessGOBIIMappingFilePlugin
 
getToolTipText() - Method in class net.maizegenetics.analysis.gobii.SplitFile_IFLFilePlugin
 
getToolTipText() - Method in class net.maizegenetics.analysis.imputation.CallParentAllelesPlugin
 
getToolTipText() - Method in class net.maizegenetics.analysis.imputation.ClusterGenotypesPlugin
 
getToolTipText() - Method in class net.maizegenetics.analysis.imputation.FILLINFindHaplotypesPlugin
 
getToolTipText() - Method in class net.maizegenetics.analysis.imputation.FILLINImputationPlugin
 
getToolTipText() - Method in class net.maizegenetics.analysis.imputation.FindMergeHaplotypesPlugin
 
getToolTipText() - Method in class net.maizegenetics.analysis.imputation.FSFHapImputationPlugin
 
getToolTipText() - Method in class net.maizegenetics.analysis.imputation.ImputationAccuracyPlugin
 
getToolTipText() - Method in class net.maizegenetics.analysis.imputation.ImputeProgenyStatesPlugin
 
getToolTipText() - Method in class net.maizegenetics.analysis.imputation.LDKNNiImputationHetV2Plugin
 
getToolTipText() - Method in class net.maizegenetics.analysis.imputation.LDKNNiImputationHetV3Plugin
 
getToolTipText() - Method in class net.maizegenetics.analysis.imputation.LDKNNiImputationPlugin
 
getToolTipText() - Method in class net.maizegenetics.analysis.imputation.MergeBreakpointFilesPlugin
 
getToolTipText() - Method in class net.maizegenetics.analysis.imputation.ParentPhasingPlugin
 
getToolTipText() - Method in class net.maizegenetics.analysis.imputation.RandomGenotypeImputationPlugin
 
getToolTipText() - Method in class net.maizegenetics.analysis.imputation.ReImputeUpdatedTaxaByFILLINPlugin
 
getToolTipText() - Method in class net.maizegenetics.analysis.imputation.RemoveIndelsForBeaglePlugin
 
getToolTipText() - Method in class net.maizegenetics.analysis.imputation.ViterbiAlgorithmPlugin
 
getToolTipText() - Method in class net.maizegenetics.analysis.imputation.WritePopulationAlignmentPlugin
 
getToolTipText() - Method in class net.maizegenetics.analysis.ListPluginParameters
 
getToolTipText() - Method in class net.maizegenetics.analysis.ListPlugins
 
getToolTipText() - Method in class net.maizegenetics.analysis.modelfitter.AdditiveSiteStorePlugin
 
getToolTipText() - Method in class net.maizegenetics.analysis.modelfitter.ResamplingGWASPlugin
 
getToolTipText() - Method in class net.maizegenetics.analysis.modelfitter.StepwiseAdditiveModelFitterPlugin
 
getToolTipText() - Method in class net.maizegenetics.analysis.modelfitter.StepwiseOLSModelFitterPlugin
 
getToolTipText() - Method in class net.maizegenetics.analysis.monetdb.ColumnsToBinaryFullGenomeTablePlugin
 
getToolTipText() - Method in class net.maizegenetics.analysis.monetdb.ColumnsToBinarySNPOnlyTablePlugin
 
getToolTipText() - Method in class net.maizegenetics.analysis.numericaltransform.AvgPhenotypeByTaxaPlugin
 
getToolTipText() - Method in class net.maizegenetics.analysis.numericaltransform.BoxCoxTransformationPlugin
 
getToolTipText() - Method in class net.maizegenetics.analysis.numericaltransform.ImputationPlugin
 
getToolTipText() - Method in class net.maizegenetics.analysis.numericaltransform.NumericalGenotypePlugin
 
getToolTipText() - Method in class net.maizegenetics.analysis.numericaltransform.SubtractPhenotypeByTaxaPlugin
 
getToolTipText() - Method in class net.maizegenetics.analysis.numericaltransform.TransformDataPlugin
 
getToolTipText() - Method in class net.maizegenetics.analysis.popgen.LinkageDiseqDisplayPlugin
Tool Tip Text for this plugin
getToolTipText(e) - Method in class net.maizegenetics.analysis.popgen.LinkageDisequilibriumComponent
 
getToolTipText() - Method in class net.maizegenetics.analysis.popgen.LinkageDisequilibriumPlugin
Tool Tip Text for this plugin
getToolTipText() - Method in class net.maizegenetics.analysis.popgen.SequenceDiversityPlugin
 
getToolTipText() - Method in class net.maizegenetics.analysis.rna.LoadRNAContigsToGBSDBPlugin
 
getToolTipText() - Method in class net.maizegenetics.analysis.rna.RNADeMultiplexProductionPlugin
 
getToolTipText() - Method in class net.maizegenetics.analysis.rna.RNADeMultiPlexSeqToDBPlugin
 
getToolTipText() - Method in class net.maizegenetics.analysis.tree.ArchaeopteryxPlugin
 
getToolTipText() - Method in class net.maizegenetics.analysis.tree.ConvertTreeNamesPlugin
 
getToolTipText() - Method in class net.maizegenetics.analysis.tree.CreateTreePlugin
Tool Tip Text for this plugin
getToolTipText() - Method in class net.maizegenetics.analysis.tree.MergeTreesPlugin
 
getToolTipText() - Method in class net.maizegenetics.analysis.tree.RemoveBranchLengthsPlugin
 
getToolTipText() - Method in class net.maizegenetics.analysis.tree.SubsetTreePlugin
 
getToolTipText() - Method in class net.maizegenetics.analysis.workflow.WorkflowPlugin
 
getToolTipText() - Method in interface net.maizegenetics.plugindef.Plugin
Tool Tip Text for this plugin
getToolTipText() - Method in class net.maizegenetics.tassel.PreferencesDialog
 
getToolTipText() - Method in class net.maizegenetics.tassel.ShowParameterCachePlugin
 
getToolTipText() - Method in class net.maizegenetics.tassel.TasselLogging
 
getToolTipText() - Method in class net.maizegenetics.util.ConvertOldFastqToModernFormatPlugin
 
getTOPMIndexOfTag(tagIndex) - Method in class net.maizegenetics.dna.map.TagLocus
 
getTopPrefix(block) - Method in class net.maizegenetics.analysis.gbs.neobio.CrochemoreLandauZivUkelson
This method is a shorthand to retrieve the top prefix of a block from the block table.
getTotalCount() - Method in class net.maizegenetics.dna.tag.TagCounts
 
getTotalNReads() - Method in class net.maizegenetics.dna.map.TagLocus
 
getTotalReadCount() - Method in class net.maizegenetics.dna.tag.PETagCounts
Return total read count of PE tags
getTrait() - Method in class net.maizegenetics.analysis.chart.TableReportManhattanDataset
 
getTransitionProbability(state1, state2) - Method in class net.maizegenetics.analysis.imputation.TransitionProbability
 
getTranslations() - Method in class net.maizegenetics.dna.snp.TranslateIndex
Returns all the translated indices.
getTree() - Method in class net.maizegenetics.tassel.DataTreePanel
 
getTwoClusters(gt, parentIndex) - Static method in class net.maizegenetics.analysis.imputation.ImputationUtils
 
getTwoClusters(inputAlignment, minGametesPerTaxon) - Static method in class net.maizegenetics.analysis.imputation.ImputationUtils
 
getTwoTailedP(a, b, c, d) - Method in class net.maizegenetics.stats.statistics.FisherExact
Calculates the two-tailed P-value for the Fisher Exact test. In order for a table under consideration to have its p-value included in the final result, it must have a p-value less than the original table's P-value, i.e. Fisher's exact test computes the probability, given the observed marginal frequencies, of obtaining exactly the frequencies observed and any configuration more extreme. By "more extreme," we mean any configuration (given observed marginals) with a smaller probability of occurrence in the same direction (one-tailed) or in both directions (two-tailed).
getType() - Method in class net.maizegenetics.analysis.gbs.TextToBinaryPlugin
 
getType() - Method in class net.maizegenetics.matrixalgebra.Matrix.DoubleMatrixFactory
 
getTypeChangeMap() - Method in class net.maizegenetics.analysis.filter.FilterTraitsDialog
 
getU(transpose) - Method in class net.maizegenetics.matrixalgebra.decomposition.BlasSingularValueDecomposition
 
getU(transpose) - Method in class net.maizegenetics.matrixalgebra.decomposition.ColtSingularValueDecomposition
 
getU(transpose) - Method in class net.maizegenetics.matrixalgebra.decomposition.EJMLSingularValueDecomposition
 
getU(transpose) - Method in interface net.maizegenetics.matrixalgebra.decomposition.SingularValueDecomposition
for the decomposition of A, A = USV'
getUColumns() - Method in class net.maizegenetics.stats.linearmodels.SolveByOrthogonalizing
 
getUnanimousHaplotype() - Method in class net.maizegenetics.analysis.clustering.HaplotypeCluster
The unanimous haplotype of this cluster. Only monomorphic sites are reported. Others will be unknown.
getUniqueMapOfTaxonByAnnotation(taxaList, annotation) - Static method in class net.maizegenetics.taxa.TaxaListIOUtils
Create a Map of all the taxa associated with a particular annotation value. If there would be a duplicate mapping, then an Optional.empty() is returned.
getUniqueMappingOfAligner(tagIndex, alignerName) - Method in class net.maizegenetics.dna.map.TagsOnPhysicalMapV3
Return unique mapping (chr and startPosition) from an aligner, return null if it has multiple equally good position or doesn't align. This is used to block positions for genetic mapping
getUniquePositions(chromosome) - Method in class net.maizegenetics.dna.map.AbstractTagsOnPhysicalMap
 
getUniquePositions(chromosome) - Method in class net.maizegenetics.dna.map.TagsOnPhysicalMapV3
 
getUniquePositions(chromosome) - Method in class net.maizegenetics.dna.map.TagsOnPhysMapHDF5
 
getUniquePositions(chromosome) - Method in interface net.maizegenetics.dna.map.TOPMInterface
Returns the set of unique positions for the given chromosome
getUnits() - Method in class net.maizegenetics.taxa.tree.SimpleTree
Return the units that this tree is expressed in.
getUnits() - Method in interface net.maizegenetics.taxa.tree.Tree
Gets the units that this tree's branch lengths and node heights are expressed in.
getUnits() - Method in interface net.maizegenetics.taxa.tree.UnitsProvider
 
getUnknownInstance(genotype) - Static method in class net.maizegenetics.dna.snp.bit.DynamicBitStorage
 
getUnphasedDiploidValue(a, b) - Static method in class net.maizegenetics.dna.snp.GenotypeTableUtils
Combines two allele values into one diploid value. In alphabetical order
getUnphasedDiploidValueNoHets(g1, g2) - Static method in class net.maizegenetics.dna.snp.GenotypeTableUtils
Combines two genotype values into one diploid value. Returns unknown if either parent is heterozygous or unknown, or alleles are swapped.
getUnphasedNucleotideGenotypeBuilder(numTaxa, numSites) - Static method in class net.maizegenetics.dna.snp.genotypecall.GenotypeCallTableBuilder
Get Genotype Builder given number of taxa and sites. Performance optimized for site loop inside taxon loop. Default is unphased and NucleotideAlignmentConstants.NUCLEOTIDE_ALLELES encoding.
getUnphasedSortedDiploidValue(genotype) - Static method in class net.maizegenetics.dna.snp.GenotypeTableUtils
Ensures diploid value in alphabetical order
getUnrootedBranchCount(center) - Static method in class net.maizegenetics.taxa.tree.NodeUtils
returns number of branches centered around an internal node in an unrooted tree
getUnselectedButton() - Method in class net.maizegenetics.gui.SelectFromAvailableDialog
 
getUnselectedButton() - Method in class net.maizegenetics.gui.SelectFromAvailableSitesDialog
 
getUpperCorner() - Method in class net.maizegenetics.analysis.popgen.LinkageDiseqDisplayPlugin
 
getUpperLimit(n) - Method in class net.maizegenetics.taxa.tree.MultiParameterized
 
getUpperLimit(n) - Method in interface net.maizegenetics.taxa.tree.Parameterized
get upper parameter limit
getUpperLimit(n) - Method in class net.maizegenetics.taxa.tree.Parameterized.Null
 
getUpperLimit(n) - Method in class net.maizegenetics.taxa.tree.Parameterized.ParameterizedBase
 
getUpperLimit(n) - Method in class net.maizegenetics.taxa.tree.Parameterized.ParameterizedUser
 
getUsage() - Method in class net.maizegenetics.analysis.data.ExtractHapmapSubsetPlugin
 
getUsage() - Method in class net.maizegenetics.analysis.imputation.CallParentAllelesPlugin
 
getUsage() - Method in class net.maizegenetics.analysis.imputation.ViterbiAlgorithmPlugin
 
getUsage() - Method in class net.maizegenetics.analysis.imputation.WritePopulationAlignmentPlugin
 
getUsage() - Method in class net.maizegenetics.analysis.numericaltransform.TransformDataPlugin
 
getUsage() - Method in class net.maizegenetics.plugindef.AbstractPlugin
 
getUsage() - Method in interface net.maizegenetics.plugindef.Plugin
Gets the Usage Statement for this Plugin.
getUsageHTML() - Method in class net.maizegenetics.plugindef.AbstractPlugin
 
getUTA() - Method in class net.maizegenetics.stats.linearmodels.SweepFast
 
getV(transpose) - Method in class net.maizegenetics.matrixalgebra.decomposition.BlasSingularValueDecomposition
 
getV(transpose) - Method in class net.maizegenetics.matrixalgebra.decomposition.ColtSingularValueDecomposition
 
getV(transpose) - Method in class net.maizegenetics.matrixalgebra.decomposition.EJMLSingularValueDecomposition
 
getV(transpose) - Method in interface net.maizegenetics.matrixalgebra.decomposition.SingularValueDecomposition
for the decomposition of A, A = USV'
getValue() - Method in enum net.maizegenetics.dna.map.TagMappingInfoV3.Aligner
 
getValueAt(row, col) - Method in class net.maizegenetics.analysis.popgen.LinkageDisequilibrium
 
getValueAt(rowLong, col) - Method in class net.maizegenetics.dna.map.PositionListTableReport
 
getValueAt(rowLong, col) - Method in class net.maizegenetics.dna.map.TOPMTableReport
 
getValueAt(row, col) - Method in class net.maizegenetics.dna.snp.FilterTableReport
 
getValueAt(row, col) - Method in class net.maizegenetics.gui.AlignmentTableModel
 
getValueAt(row, col) - Method in class net.maizegenetics.gui.TableReportNoPagingTableModel
 
getValueAt(row, col) - Method in class net.maizegenetics.phenotype.CorePhenotype
 
getValueAt(row, col) - Method in class net.maizegenetics.phenotype.FilterPhenotype
 
getValueAt(row, col) - Method in class net.maizegenetics.phenotype.GenotypePhenotype
 
getValueAt(rowIndex, columnIndex) - Method in class net.maizegenetics.taxa.distance.DistanceMatrix
 
getValueAt(row, col) - Method in class net.maizegenetics.taxa.TaxaListTableReport
 
getValueAt(row, col) - Method in class net.maizegenetics.util.AbstractTableReport
 
getValueAt(row, col) - Method in class net.maizegenetics.util.HDF5TableReport
 
getValueAt(row, col) - Method in class net.maizegenetics.util.SimpleTableReport
 
getValueAt(row, col) - Method in interface net.maizegenetics.util.TableReport
Returns value at given row and column.
getValueFromName(name) - Static method in enum net.maizegenetics.dna.map.TagMappingInfoV3.Aligner
 
getVariableTagSizeInLong(index) - Method in class net.maizegenetics.dna.map.PETagsOnPhysicalMapV3
 
getVariantDef() - Method in class net.maizegenetics.dna.map.AbstractTagsOnPhysicalMap
 
getVariantDef(tagIndex, variantIndex) - Method in class net.maizegenetics.dna.map.AbstractTagsOnPhysicalMap
 
getVariantDef(tagIndex, variantIndex) - Method in interface net.maizegenetics.dna.map.TOPMInterface
Returns variant definition at given tag and variant index.
getVariantDef() - Method in interface net.maizegenetics.dna.map.TOPMInterface
Returns variant definitions for all tags. First index of result is tag and second is variant.
getVariantDefArray(tagIndex) - Method in class net.maizegenetics.dna.map.AbstractTagsOnPhysicalMap
Returns an array containing all variant definitions for the tag at the supplied index.
getVariantDefArray(tagIndex) - Method in interface net.maizegenetics.dna.map.TOPMInterface
Returns an array containing all variant definitions for given tag.
getVariantDefByReference() - Method in class net.maizegenetics.dna.map.AbstractTagsOnPhysicalMap
Provides the reference
getVariantOff() - Method in class net.maizegenetics.dna.map.AbstractTagsOnPhysicalMap
 
getVariantOff() - Method in interface net.maizegenetics.dna.map.TOPMInterface
Returns variant position offsets for all tags. First index of result is tag and second is variant.
getVariantOffByReference() - Method in class net.maizegenetics.dna.map.AbstractTagsOnPhysicalMap
 
getVariantPosOff(tagIndex, variantIndex) - Method in class net.maizegenetics.dna.map.AbstractTagsOnPhysicalMap
 
getVariantPosOff(tagIndex, variantIndex) - Method in interface net.maizegenetics.dna.map.TOPMInterface
Returns variant position offset from start position at given tag and variant index.
getVariantPosOffArray(tagIndex) - Method in class net.maizegenetics.dna.map.AbstractTagsOnPhysicalMap
Returns an array containing all variant position offsets for the tag at the supplied index.
getVariantPosOffArray(tagIndex) - Method in interface net.maizegenetics.dna.map.TOPMInterface
Returns an array containing all variant position offsets for given tag.
getVariants(inputLine) - Static method in class net.maizegenetics.dna.tag.SAMUtils
Parses an input line from a SAM file to determine all variants.
getVarRan() - Method in class net.maizegenetics.stats.EMMA.EMMAforDoubleMatrix
 
getVarRes() - Method in class net.maizegenetics.stats.EMMA.EMMAforDoubleMatrix
 
getWindows(ispoly, windowSize) - Static method in class net.maizegenetics.analysis.imputation.NucleotideImputationUtils
 
getWinSize() - Method in class net.maizegenetics.analysis.filter.FilterAlignmentPlugin
 
getWinSize() - Method in class net.maizegenetics.analysis.popgen.LinkageDisequilibriumPlugin
 
getWords(prefix) - Method in class net.maizegenetics.analysis.gbs.v2.BarcodeTrie
get the words in the trie with the given prefix
getX(series, item) - Method in class net.maizegenetics.analysis.chart.TableReportManhattanDataset
 
getX(series, item) - Method in class net.maizegenetics.analysis.chart.TableReportQQDataset
 
getX(series, item) - Method in class net.maizegenetics.analysis.chart.TableReportXYDataset
 
getX() - Method in class net.maizegenetics.analysis.modelfitter.AddPlusDomModelEffect
 
getX(row) - Method in class net.maizegenetics.analysis.popgen.LinkageDisequilibrium
 
getX() - Method in class net.maizegenetics.stats.linearmodels.CovariateModelEffect
 
getX() - Method in class net.maizegenetics.stats.linearmodels.FactorModelEffect
 
getX() - Method in interface net.maizegenetics.stats.linearmodels.ModelEffect
 
getX() - Method in class net.maizegenetics.stats.linearmodels.NestedCovariateModelEffect
 
getX() - Method in class net.maizegenetics.util.Tuple
 
getXDim() - Static method in class net.maizegenetics.prefs.TasselPrefs
 
getXName() - Method in class net.maizegenetics.analysis.chart.TableReportManhattanDataset
 
getXName() - Method in class net.maizegenetics.analysis.chart.TableReportQQDataset
 
getXName() - Method in class net.maizegenetics.analysis.chart.TableReportXYDataset
 
getXtX() - Method in class net.maizegenetics.analysis.modelfitter.AddPlusDomModelEffect
 
getXtX() - Method in class net.maizegenetics.stats.linearmodels.CovariateModelEffect
 
getXtX() - Method in class net.maizegenetics.stats.linearmodels.FactorModelEffect
 
getXtX() - Method in interface net.maizegenetics.stats.linearmodels.ModelEffect
 
getXtX() - Method in class net.maizegenetics.stats.linearmodels.NestedCovariateModelEffect
 
getXtX2(cme) - Method in class net.maizegenetics.stats.linearmodels.CovariateModelEffect
 
getXtX2(fme) - Method in class net.maizegenetics.stats.linearmodels.FactorModelEffect
 
getXtX2(ncme) - Method in class net.maizegenetics.stats.linearmodels.NestedCovariateModelEffect
 
getXtXGM() - Method in class net.maizegenetics.matrixalgebra.Matrix.BlasDoubleMatrix
 
getXtXGM() - Method in class net.maizegenetics.matrixalgebra.Matrix.ColtDoubleMatrix
 
getXtXGM() - Method in interface net.maizegenetics.matrixalgebra.Matrix.DoubleMatrix
 
getXtXGM() - Method in class net.maizegenetics.matrixalgebra.Matrix.EJMLDoubleMatrix
 
getXTXpart() - Method in class net.maizegenetics.stats.linearmodels.SweepFast
 
getXty(y) - Method in class net.maizegenetics.analysis.modelfitter.AddPlusDomModelEffect
 
getXty(y) - Method in class net.maizegenetics.stats.linearmodels.CovariateModelEffect
 
getXty(y) - Method in class net.maizegenetics.stats.linearmodels.FactorModelEffect
 
getXty(y) - Method in interface net.maizegenetics.stats.linearmodels.ModelEffect
 
getXtY(X, Y) - Static method in class net.maizegenetics.stats.linearmodels.ModelEffectUtils
 
getXty(y) - Method in class net.maizegenetics.stats.linearmodels.NestedCovariateModelEffect
 
getY(series, item) - Method in class net.maizegenetics.analysis.chart.TableReportManhattanDataset
 
getY(series, item) - Method in class net.maizegenetics.analysis.chart.TableReportQQDataset
 
getY(series, item) - Method in class net.maizegenetics.analysis.chart.TableReportXYDataset
 
getY(row) - Method in class net.maizegenetics.analysis.popgen.LinkageDisequilibrium
 
getY() - Method in class net.maizegenetics.util.Tuple
 
getYDim() - Static method in class net.maizegenetics.prefs.TasselPrefs
 
getyhat(beta) - Method in class net.maizegenetics.analysis.modelfitter.AddPlusDomModelEffect
 
getyhat(beta) - Method in class net.maizegenetics.analysis.modelfitter.AddPlusDomModelEffect
 
getyhat(beta) - Method in class net.maizegenetics.stats.linearmodels.CovariateModelEffect
 
getyhat(beta) - Method in class net.maizegenetics.stats.linearmodels.CovariateModelEffect
 
getyhat(beta) - Method in class net.maizegenetics.stats.linearmodels.FactorModelEffect
 
getyhat(beta) - Method in class net.maizegenetics.stats.linearmodels.FactorModelEffect
 
getyhat() - Method in class net.maizegenetics.stats.linearmodels.LinearModelForStepwiseRegression
 
getyhat(beta) - Method in interface net.maizegenetics.stats.linearmodels.ModelEffect
 
getyhat(beta) - Method in interface net.maizegenetics.stats.linearmodels.ModelEffect
 
getyhat(beta) - Method in class net.maizegenetics.stats.linearmodels.NestedCovariateModelEffect
 
getyhat(beta) - Method in class net.maizegenetics.stats.linearmodels.NestedCovariateModelEffect
 
getZero() - Static method in class net.maizegenetics.stats.math.OrderEnumerator.Utils
 
getZeroFactory() - Static method in class net.maizegenetics.stats.math.OrderEnumerator.Utils
 
gMatrix() - Method in class net.maizegenetics.analysis.distance.HMatrixPlugin
Kinship Matrix
gMatrix(value) - Method in class net.maizegenetics.analysis.distance.HMatrixPlugin
Set Kinship Matrix. Kinship Matrix
GOBII_DB - Static variable in class net.maizegenetics.prefs.TasselPrefs
 
GOBII_DB_DEFAULT - Static variable in class net.maizegenetics.prefs.TasselPrefs
 
GOBII_IFLUtils - Class in net.maizegenetics.analysis.gobii
This class contains utility methods for pulling values out of hmp or vcf files needed when creating the intermediate files for loading into GOBII postgres and monetdb instances
GOBII_TOP - Static variable in class net.maizegenetics.prefs.TasselPrefs
 
GOBII_USER - Static variable in class net.maizegenetics.prefs.TasselPrefs
 
GOBII_USER_DEFAULT - Static variable in class net.maizegenetics.prefs.TasselPrefs
 
GOBIIAvroGenotypeCallTable - Class in net.maizegenetics.dna.snp.genotypecall
 
GOBIIDbUtils - Class in net.maizegenetics.analysis.gobii
These methods were largely borrowed from Jeff's privatemaizegenetics GenomeAnnosDB.java, then modified as needed for GOBII postgres access. Currently, this file is ONLY connecting to postgres, not monetd. if plugins are created that need to connect to monetdb, a new connectToDB() method for monetdb must be created, or the existing one will need to be changed to indicate the database type for connection. For connecting to a monetdb instance, see example in privatemaizegenetics.lynn.MonetdbFileProcessing.MonetDBQtoPosList.connectToDBOrDie
GOBIIGenotypeCallTable - Class in net.maizegenetics.dna.snp.genotypecall
 
GOBIIPlugin - Class in net.maizegenetics.analysis.gobii
 
GOBIIPlugin(parentFrame, isInteractive) - Constructor for class net.maizegenetics.analysis.gobii.GOBIIPlugin
 
GOBIIPostgresConnection - Class in net.maizegenetics.analysis.gobii
 
gPos - Variable in class net.maizegenetics.dna.map.TagGWASMapInfo
Genetic mapping position of a tag, unknown = Integer.MIN_VALUE
gPos - Variable in class net.maizegenetics.dna.map.TagsOnGeneticMap
 
Graph<T> - Interface in net.maizegenetics.util
Created by Eli Rodgers-Melnick on 7/2/2014 This interface is implemented by graphs, both directed and undirected. The design is inspired by the Python networkx library (https://networkx.github.io/)
Graph.GraphType - Enum in net.maizegenetics.util
 
GraphBuilder<T> - Class in net.maizegenetics.util
Builder for graphs, directed and undirected
GraphBuilder(type) - Constructor for class net.maizegenetics.util.GraphBuilder
Generic constructor
GraphUtils<T> - Class in net.maizegenetics.util
Functions used for Graph traversal and analysis
groupMembers - Variable in class net.maizegenetics.analysis.association.CompressedDoubleMatrix
 
guiName(guiName) - Method in class net.maizegenetics.plugindef.PluginParameter.Builder
 
guiName() - Method in class net.maizegenetics.plugindef.PluginParameter
 
GVCFGenomeSequence - Interface in net.maizegenetics.dna.map
Created by zrm22 on 3/27/17. Interface is used to store GenomeSequences defined by a GATK generated GVCF file
GVCFGenomeSequenceBuilder - Class in net.maizegenetics.dna.map
Created by zrm22 on 3/27/17.
GVCFLine(lineNum, line) - Constructor for class net.maizegenetics.analysis.phg.ParseGVCF.GVCFLine
 
GWAS - Static variable in class net.maizegenetics.dna.snp.HapMapHDF5Constants
 
GWAS_IFLPlugin - Class in net.maizegenetics.analysis.gobii
The tables populated from this plugin are described in TAS-1162 The plugin takes files of gwas data and adds them to the gwas_data in a GOBII instance. It is assume the gwas_method and gwas_experiment tables associated with this data have already been populated. These are all proprietary tables currently only in use by Buckler Lab. TO speed up procesing, the experimentId and methodIds are hard-coded in the juint that calls this plugin. Those tables are generally small, and if you have to go to it to get the name, you might as well just input the ID anda save GOBII IFL processing time. The values stored in the "values" column will be stored as "real" in the gwas_data table This is because there is 1 "value" field, which holds values for all data, of any type. The method table will provide specifics on how to interpret each statistic. In addition to the .gz files of gwas data, a mapping file of phenotype names to IDs is created - data pulled from b4R table.
GWAS_IFLPlugin(parentFrame, isInteractive) - Constructor for class net.maizegenetics.analysis.gobii.GWAS_IFLPlugin
 
GWAS_IFLPlugin() - Constructor for class net.maizegenetics.analysis.gobii.GWAS_IFLPlugin
 
GWASMappingPlugin() - Method in class net.maizegenetics.analysis.gbs.pana.PanAUsageExample
 
gwasPValue - Variable in class net.maizegenetics.dna.map.TagGWASMapInfo
P-value of genetic mapping of a tag
gwasResults() - Method in class net.maizegenetics.analysis.data.CountAssociationsPlugin
GWAS Result File.
gwasResults(value) - Method in class net.maizegenetics.analysis.data.CountAssociationsPlugin
Set Gwas Results. GWAS Result File.

H

h5 - Variable in class net.maizegenetics.dna.tag.AbstractTagsHDF5
 
h5ToAnchorPlugin() - Method in class net.maizegenetics.analysis.gbs.pana.PanAUsageExample
 
hadamardProduct(m0, m1) - Static method in class net.maizegenetics.taxa.distance.DistanceMatrix
 
hammingDistSoundex(s1, s2, ignoreCase, ignoreWhite, ignorePunc) - Static method in class net.maizegenetics.taxa.IdentifierSynonymizer
 
HapBreakpoints_IFLFilePlugin - Class in net.maizegenetics.analysis.gobii
THis is defined in tas-1098 This plugin takes a haplotype breakpoint file and creates intermediate files for the hap_breakpoint and breakpoint_set tables. These three tables are currently proprietary tables created by Buckler lab to be added to the GOBII postgres DB. THe tables are created from the create_hapBrkptTables.sql on cbsudc01 in directory /workdir/lcj34/postgresFiles/gobii_ifl_filesToLoad/gobii_hapbreakpoints THe tables to be created have these entries: hapbreakpoint Table: hap_breakpoint_id int taxa(GID) int position_range int4range (start/stop stored as an integer range) donor1 (GID) int donor2 (GID) int breakpoint_set_id int (maps to breapoint_set table) breakpoint_set Table: breakpoint_set_id int name text method text (method used to created breakpoint file ,e.g FILLIN) mapset_id int projection_align Table: projection_align_id int name text het_resolution text breakpoint_set_id int dataset_id int (gives us the donor file) The thought is that GOBII IFL scripts will operate successfully on them. It will require the tables to be previously created in the DB, and mapping files to be created and stored on the db server that can be used to process these files for bulk loading. THis method will take the set name and use it to populate the breakpoint table. Need to create the index into each table like GOBII does, with auto increment and they live in the pg_catalog. Restrictions: The breakfile format must be as defined by Ed. The first line must contain 2 tab-delimited values, the first indicating the number of donors and the second indicating the number of "blocks" to process. All lines beginning with a "#" are considered comment lines. There are 2 mapping files required: one for donors, and one for taxa. in the Ames example, the donor mapping file is the same file used to curate the WGS dataset 5, which is named ZeaWGS_hmp321_raw_AGPv3. The taxa mapping file is the file Cinta provides with each subset, e.g. for Ames in Cornell box. If the TaxaColumn in the mapping file contains a libraryID (e.g. name:libraryID) the code removes it, leaving taxa set to just the "name" portion. THis is because Kelly's pa.txt.gz files do NOT have the library portion, though some of Cinta's files do. The breakpoint file has donors at top: Donors are Feb-48,PHG84, PHG83, etc. Their GIDs come from the WGS mapping file Cinta gave for curating that large vcf set. 1210 2711 #Donor Haplotypes 0 Feb-48 1 PHG84 2 PHG83 And taxa breakpoint blocks at the bottom: "taxa" is the first column. It gets it GID from the germplasminformation_Ames_20160810.txt file Cinta provided in Cornell Box with the Ames data: Below, 12E and 37 are taxa. #Block are defined chr:startPos:endPos:donor1:donor2 (-1 means no hypothesis) 12E 1:299497909:299752426:958:1070 1:299777120:300064510:79:958 1:300064521:300335541:1050:1202 1:300351838:300818858:162:7 37 2:233507851:234268676:1015:1015 2:234268677:234350614:820:820 2:234350639:234411604:950:950 2:234411637:234464003:191:1 The third table, the projection_alignment table, will be populated with another plugin. Users will create their own projection alignment analyses for the breakpoint sets of their choice. ------------- Sept 14, 2016: Trying with Cinta's "name2" field, as the taxa are not matching from the taxa column for the taxa mapping file. Donors are working.
HapBreakpoints_IFLFilePlugin(parentFrame, isInteractive) - Constructor for class net.maizegenetics.analysis.gobii.HapBreakpoints_IFLFilePlugin
 
HapBreakpoints_IFLFilePlugin() - Constructor for class net.maizegenetics.analysis.gobii.HapBreakpoints_IFLFilePlugin
 
hapcutDir() - Method in class net.maizegenetics.analysis.data.AdjustPhasingPlugin
Directory containing Hapcut output files.
hapcutDir(value) - Method in class net.maizegenetics.analysis.data.AdjustPhasingPlugin
Set Hapcut Dir. Directory containing Hapcut output files.
hapDetail(rbt, outfileS, coverRate) - Method in class net.maizegenetics.analysis.gbs.Clusters
 
hapDist - Variable in class net.maizegenetics.dna.tag.ReadsByTaxa
 
Haplotype - Class in net.maizegenetics.analysis.clustering
A Haplotype is a sequence which can be either a true haplotype or a genotype. The natural ordering is by number of non-missing values, descending.
Haplotype(hap, taxon) - Constructor for class net.maizegenetics.analysis.clustering.Haplotype
 
Haplotype(hap) - Constructor for class net.maizegenetics.analysis.clustering.Haplotype
 
haplotype - Variable in class net.maizegenetics.dna.tag.ReadsByTaxa
 
haplotypeAllelePresenceForAllSites(taxon, firstParent) - Method in interface net.maizegenetics.dna.snp.bit.BitStorage
Returns sequence of true/false values indicating whether taxon at each site for given parent matches a specific allele (based on frequency). Allele number of value 0 would be the major allele. Allele number of value 1 would be the minor allele. Allele number of value 2 would be the third most frequent allele value and so on.
haplotypeAllelePresenceForAllSites(taxon, firstParent) - Method in class net.maizegenetics.dna.snp.bit.DynamicBitStorage
 
haplotypeAllelePresenceForAllSites(taxon, firstParent, allele) - Method in class net.maizegenetics.dna.snp.CombineGenotypeTable
 
haplotypeAllelePresenceForAllSites(taxon, firstParent, allele) - Method in class net.maizegenetics.dna.snp.CoreGenotypeTable
 
haplotypeAllelePresenceForAllSites(taxon, firstParent, allele) - Method in interface net.maizegenetics.dna.snp.GenotypeTable
Returns sequence of true/false values indicating whether taxon at each site for given parent matches a specific allele.
haplotypeAllelePresenceForAllSites(taxon, firstParent, allele) - Method in class net.maizegenetics.dna.snp.MergedGenotypeTable
 
haplotypeAllelePresenceForAllSites(taxon, firstParent, allele) - Method in class net.maizegenetics.dna.snp.TOPMGenotypeTable
 
haplotypeAllelePresenceForAllTaxa(site, firstParent) - Method in interface net.maizegenetics.dna.snp.bit.BitStorage
Returns sequence of true/false values indicating whether site at each taxon for given parent matches a specific allele (based on frequency). Allele number of value 0 would be the major allele. Allele number of value 1 would be the minor allele. Allele number of value 2 would be the third most frequent allele value and so on.
haplotypeAllelePresenceForAllTaxa(site, firstParent) - Method in class net.maizegenetics.dna.snp.bit.DynamicBitStorage
 
haplotypeAllelePresenceForAllTaxa(site, firstParent, allele) - Method in class net.maizegenetics.dna.snp.CombineGenotypeTable
 
haplotypeAllelePresenceForAllTaxa(site, firstParent, allele) - Method in class net.maizegenetics.dna.snp.CoreGenotypeTable
 
haplotypeAllelePresenceForAllTaxa(site, firstParent, allele) - Method in interface net.maizegenetics.dna.snp.GenotypeTable
Returns sequence of true/false values indicating whether site at each taxon for given parent matches a specific allele (based on frequency). Allele number of value 0 would be the major allele. Allele number of value 1 would be the minor allele. Allele number of value 2 would be the third most frequent allele value and so on.
haplotypeAllelePresenceForAllTaxa(site, firstParent, allele) - Method in class net.maizegenetics.dna.snp.MergedGenotypeTable
 
haplotypeAllelePresenceForAllTaxa(site, firstParent, allele) - Method in class net.maizegenetics.dna.snp.TOPMGenotypeTable
 
haplotypeAllelePresenceForSitesBlock(taxon, firstParent, startBlock, endBlock) - Method in interface net.maizegenetics.dna.snp.bit.BitStorage
Returns sequence of true/false values indicating whether taxon at sites (in given blocks, 64 sites per block including start block but excluding end block) for given parent matches a specific allele (based on frequency). Allele number of value 0 would be the major allele. Allele number of value 1 would be the minor allele. Allele number of value 2 would be the third most frequent allele value and so on.
haplotypeAllelePresenceForSitesBlock(taxon, firstParent, startBlock, endBlock) - Method in class net.maizegenetics.dna.snp.bit.DynamicBitStorage
 
haplotypeAllelePresenceForSitesBlock(taxon, firstParent, allele, startBlock, endBlock) - Method in class net.maizegenetics.dna.snp.CombineGenotypeTable
 
haplotypeAllelePresenceForSitesBlock(taxon, firstParent, allele, startBlock, endBlock) - Method in class net.maizegenetics.dna.snp.CoreGenotypeTable
 
haplotypeAllelePresenceForSitesBlock(taxon, firstParent, allele, startBlock, endBlock) - Method in interface net.maizegenetics.dna.snp.GenotypeTable
Returns sequence of true/false values indicating whether taxon at sites (in given blocks, 64 sites per block including start block but excluding end block) for given parent matches a specific allele (based on frequency). Allele number of value 0 would be the major allele. Allele number of value 1 would be the minor allele. Allele number of value 2 would be the third most frequent allele value and so on.
haplotypeAllelePresenceForSitesBlock(taxon, firstParent, allele, startBlock, endBlock) - Method in class net.maizegenetics.dna.snp.MergedGenotypeTable
 
haplotypeAllelePresenceForSitesBlock(taxon, firstParent, allele, startBlock, endBlock) - Method in class net.maizegenetics.dna.snp.TOPMGenotypeTable
 
HaplotypeCluster - Class in net.maizegenetics.analysis.clustering
A HaplotypeCluster is a List of Haplotypes that are all similar. Size and score are alternate methods of measuring cluster importance. For score, Haplotypes are weighted by the number of clusters to which they belong since a Haplotype can belong to more than one cluster. The natural order for clusters is determined by score then by size, both in descending order.
HaplotypeCluster(hapList) - Constructor for class net.maizegenetics.analysis.clustering.HaplotypeCluster
 
HaplotypeCluster(hap) - Constructor for class net.maizegenetics.analysis.clustering.HaplotypeCluster
 
HaplotypeCluster(hap, initialScore) - Constructor for class net.maizegenetics.analysis.clustering.HaplotypeCluster
 
HaplotypeCluster(hapList, initialScore) - Constructor for class net.maizegenetics.analysis.clustering.HaplotypeCluster
 
HaplotypeCluster.TYPE - Enum in net.maizegenetics.analysis.clustering
TYPE determines how the haplotype will be represented. If majority, the most common allele at a locus within the cluster will be used. If unanimous, then the alleles used will be those for which almost all taxa within the cluster are the same. One error is allowed.
HaplotypeClusterer - Class in net.maizegenetics.analysis.clustering
HaplotypeClusterer clusters haplotypes by distance as defined in the Haplotype class. This class can be extended to apply different clustering rules.
HaplotypeClusterer(haplotypes) - Constructor for class net.maizegenetics.analysis.clustering.HaplotypeClusterer
 
HaplotypeClusterer(haplotypes) - Constructor for class net.maizegenetics.analysis.clustering.HaplotypeClusterer
 
HaplotypeClusterer.TYPE - Enum in net.maizegenetics.analysis.clustering
 
haplotypeNum - Variable in class net.maizegenetics.dna.tag.ReadsByTaxa
 
haplotypeOverlapSimilarity(h0, h1, overlap, haplength) - Static method in class net.maizegenetics.analysis.imputation.NucleotideImputationUtils
 
haplotypesFromParents(useparents) - Method in class net.maizegenetics.analysis.imputation.CallParentAllelesPlugin
 
HapMapHDF5Constants - Class in net.maizegenetics.dna.snp
Definition of fields and directories of the GenotypeTable in a HDF5 file format.
hapmapSites(file) - Static method in class net.maizegenetics.dna.map.TagsOnPhysicalMap
 
hapProbFile() - Method in class net.maizegenetics.analysis.imputation.ImputeProgenyStatesPlugin
The output file containing the new parent haplotype probabilities, binary format. A .bin extension will be appended if not present.
hapProbFile(value) - Method in class net.maizegenetics.analysis.imputation.ImputeProgenyStatesPlugin
Set Updated Haplotype Probabilities Output File. The output file containing the new parent haplotype probabilities, binary format. A .bin extension will be appended if not present.
hasAlleleProbabilities() - Method in class net.maizegenetics.dna.snp.CombineGenotypeTable
 
hasAlleleProbabilities() - Method in class net.maizegenetics.dna.snp.CoreGenotypeTable
 
hasAlleleProbabilities() - Method in interface net.maizegenetics.dna.snp.GenotypeTable
Returns true if this genotype table has allele probabilities.
hasAlleleProbabilities() - Method in class net.maizegenetics.dna.snp.MergedGenotypeTable
 
hasAlleleProbabilities() - Method in class net.maizegenetics.dna.snp.TOPMGenotypeTable
 
hasChildren() - Method in class net.maizegenetics.taxa.tree.SimpleNode
check whether this node is an internal node
hasClade(clade) - Method in class net.maizegenetics.taxa.tree.CladeSystem
+ test whether a clade is contained in this clade system (assuming the same leaf order)
hasDepth(value) - Method in class net.maizegenetics.analysis.data.HDF5SummaryPlugin
 
hasDepth() - Method in class net.maizegenetics.analysis.data.HDF5SummaryPlugin
 
hasDepth() - Method in class net.maizegenetics.dna.snp.CombineGenotypeTable
 
hasDepth() - Method in class net.maizegenetics.dna.snp.CoreGenotypeTable
 
hasDepth() - Method in interface net.maizegenetics.dna.snp.GenotypeTable
Returns true if this genotype table has sequencing depth.
hasDepth() - Method in class net.maizegenetics.dna.snp.MergedGenotypeTable
 
hasDepth() - Method in class net.maizegenetics.dna.snp.TOPMGenotypeTable
 
hasDosage() - Method in class net.maizegenetics.dna.snp.CombineGenotypeTable
 
hasDosage() - Method in class net.maizegenetics.dna.snp.CoreGenotypeTable
 
hasDosage() - Method in interface net.maizegenetics.dna.snp.GenotypeTable
Returns true if this genotype table has dosage.
hasDosage() - Method in class net.maizegenetics.dna.snp.MergedGenotypeTable
 
hasDosage() - Method in class net.maizegenetics.dna.snp.TOPMGenotypeTable
 
hasEdge(u, v) - Method in class net.maizegenetics.util.DirectedGraph
 
hasEdge(u, v) - Method in interface net.maizegenetics.util.Graph
Returns true if an edge exists in the graph
hasEdge(u, v) - Method in class net.maizegenetics.util.UndirectedGraph
 
hasGenotype() - Method in class net.maizegenetics.dna.snp.CombineGenotypeTable
 
hasGenotype() - Method in class net.maizegenetics.dna.snp.CoreGenotypeTable
 
hasGenotype() - Method in interface net.maizegenetics.dna.snp.GenotypeTable
Returns whether this Genotype Table has Genotype values.
hasGenotype() - Method in class net.maizegenetics.dna.snp.MergedGenotypeTable
 
hasGenotype() - Method in class net.maizegenetics.dna.snp.TOPMGenotypeTable
 
HASH_SHIFT_TO_TAG_BIN - Static variable in class net.maizegenetics.util.Tassel5HDF5Constants
 
hashCode() - Method in class net.maizegenetics.analysis.data.MeanR2FromLDPlugin.AccumulateR2
 
hashCode() - Method in class net.maizegenetics.analysis.gbs.repgen.RefTagData
 
hashCode() - Method in class net.maizegenetics.analysis.popgen.DonorHypoth
 
hashCode() - Method in class net.maizegenetics.dna.map.Chromosome
 
hashCode() - Method in class net.maizegenetics.dna.map.GeneralPosition
 
hashCode() - Method in class net.maizegenetics.dna.snp.SimpleAllele
 
hashCode() - Method in class net.maizegenetics.dna.tag.AbstractTag
 
hashCode() - Method in class net.maizegenetics.stats.linearmodels.BasicLevel
 
hashCode() - Method in class net.maizegenetics.taxa.Taxon
 
hashCode() - Method in class net.maizegenetics.util.db.DefaultDBTuple
 
hashCode() - Method in class net.maizegenetics.util.db.Pair
 
hashCode() - Method in class net.maizegenetics.util.OpenBitSet
 
hashCode() - Method in class net.maizegenetics.util.Tuple
 
hasIndel() - Method in class net.maizegenetics.dna.snp.genotypecall.Stats
 
hasListeners() - Method in class net.maizegenetics.plugindef.AbstractPlugin
 
hasMore() - Method in interface net.maizegenetics.stats.math.OrderEnumerator
If hasMore returns false reset should be called
hasNext() - Method in class net.maizegenetics.util.db.ResultSetIterator
 
hasNext() - Method in class net.maizegenetics.util.UndirectedGraph.UndirectedIterator
 
hasNode(n) - Method in class net.maizegenetics.util.DirectedGraph
 
hasNode(n) - Method in interface net.maizegenetics.util.Graph
Returns true if the graph contains the node n
hasNode(n) - Method in class net.maizegenetics.util.UndirectedGraph
 
hasPossibleValues() - Method in class net.maizegenetics.plugindef.PluginParameter
 
hasRange() - Method in class net.maizegenetics.plugindef.PluginParameter
 
hasReference() - Method in interface net.maizegenetics.dna.map.PositionList
Return whether this alignment has defined reference sequence.
hasReference() - Method in class net.maizegenetics.dna.snp.CombineGenotypeTable
 
hasReference() - Method in class net.maizegenetics.dna.snp.CoreGenotypeTable
 
hasReference() - Method in interface net.maizegenetics.dna.snp.GenotypeTable
Return whether this genotype table has defined reference sequence.
hasReference() - Method in class net.maizegenetics.dna.snp.MergedGenotypeTable
 
hasReference() - Method in class net.maizegenetics.dna.snp.TOPMGenotypeTable
 
hasReferenceProbablity() - Method in class net.maizegenetics.dna.snp.CombineGenotypeTable
 
hasReferenceProbablity() - Method in class net.maizegenetics.dna.snp.CoreGenotypeTable
 
hasReferenceProbablity() - Method in interface net.maizegenetics.dna.snp.GenotypeTable
Returns true if this genotype table has reference probability.
hasReferenceProbablity() - Method in class net.maizegenetics.dna.snp.MergedGenotypeTable
 
hasReferenceProbablity() - Method in class net.maizegenetics.dna.snp.TOPMGenotypeTable
 
hasSiteTranslations() - Method in class net.maizegenetics.dna.snp.CombineGenotypeTable
 
hasSiteTranslations() - Method in class net.maizegenetics.dna.snp.CoreGenotypeTable
 
hasSiteTranslations() - Method in interface net.maizegenetics.dna.snp.GenotypeTable
 
hasSiteTranslations() - Method in class net.maizegenetics.dna.snp.MergedGenotypeTable
 
hasSiteTranslations() - Method in class net.maizegenetics.dna.snp.TOPMGenotypeTable
 
hasSiteTranslations() - Method in class net.maizegenetics.dna.snp.Translate
 
hasSplit(split) - Method in class net.maizegenetics.taxa.tree.SplitSystem
+ test whether a split is contained in this split system (assuming the same leaf order)
hasTaxaAttribute() - Method in class net.maizegenetics.phenotype.CorePhenotype
 
hasTaxaAttribute() - Method in class net.maizegenetics.phenotype.FilterPhenotype
 
hasTaxaAttribute() - Method in interface net.maizegenetics.phenotype.Phenotype
 
hasTaxaTranslations() - Method in class net.maizegenetics.dna.snp.Translate
 
hasTranslations() - Method in class net.maizegenetics.dna.snp.TranslateIndex
Indicates whether this index translation has translations. If every index is translated to itself, there are no translations. If this represents a subset of the total indices, there are translations even if all indices in the subset translate to itself.
hasTwoVectors() - Method in class net.maizegenetics.stats.linearmodels.SolveByOrthogonalizing.Marker
 
hasVal(name) - Method in interface net.maizegenetics.util.db.DBTuple
 
hasValues() - Static method in class net.maizegenetics.plugindef.ParameterCache
Returns true if this cache has been loaded with values.
HDF5AlleleDepth - Class in net.maizegenetics.dna.snp.score
 
HDF5AlleleDepthBuilder - Class in net.maizegenetics.dna.snp.score
Builder to store information on DNA read depths.
HDF5Byte2D - Class in net.maizegenetics.dna.snp.byte2d
 
hdf5Filename(connection, datasetName) - Static method in class net.maizegenetics.analysis.gobii.GOBIIPostgresConnection
 
HDF5SummaryPlugin - Class in net.maizegenetics.analysis.data
Created by jgw87 on 5/28/14. This plugin is meant to take an HDF5 file and output a report of various summary statistics or information. INclude
HDF5SummaryPlugin(parentFrame, isInteractive) - Constructor for class net.maizegenetics.analysis.data.HDF5SummaryPlugin
 
HDF5TableReport - Class in net.maizegenetics.util
 
HDF5TableReport(filename) - Constructor for class net.maizegenetics.util.HDF5TableReport
 
HDF5Utils - Class in net.maizegenetics.util
 
heights2Lengths(node) - Static method in class net.maizegenetics.taxa.tree.NodeUtils
determines branch lengths of this and all descendent nodes from heights
heights2Lengths(node, respectMinimum) - Static method in class net.maizegenetics.taxa.tree.NodeUtils
determines branch lengths of this and all descendent nodes from heights
HelpDialog - Class in net.maizegenetics.tassel
 
HelpDialog(frame) - Constructor for class net.maizegenetics.tassel.HelpDialog
 
heteozygoteFilter(rbt) - Method in class net.maizegenetics.analysis.gbs.Clusters
 
heterozygosityThreshold() - Method in class net.maizegenetics.analysis.imputation.FILLINImputationPlugin
Threshold per taxon heterozygosity for treating taxon as heterozygous (no Viterbi, het thresholds).
heterozygosityThreshold(value) - Method in class net.maizegenetics.analysis.imputation.FILLINImputationPlugin
Set Heterozygosity threshold. Threshold per taxon heterozygosity for treating taxon as heterozygous (no Viterbi, het thresholds).
HETEROZYGOUS_COUNT - Static variable in class net.maizegenetics.dna.snp.genotypecall.AlleleFreqCache
 
heterozygousCount(site) - Method in class net.maizegenetics.dna.snp.CombineGenotypeTable
 
heterozygousCount(site) - Method in class net.maizegenetics.dna.snp.CoreGenotypeTable
 
heterozygousCount(site) - Method in interface net.maizegenetics.dna.snp.genotypecall.GenotypeCallTable
Returns number of heterozygous taxa at given site.
heterozygousCount(site) - Method in interface net.maizegenetics.dna.snp.GenotypeTable
Returns number of heterozygous taxa at given site.
heterozygousCount(site) - Method in class net.maizegenetics.dna.snp.MergedGenotypeTable
 
heterozygousCount(site) - Method in class net.maizegenetics.dna.snp.TOPMGenotypeTable
 
heterozygousCountForTaxon(taxon) - Method in class net.maizegenetics.dna.snp.CombineGenotypeTable
 
heterozygousCountForTaxon(taxon) - Method in class net.maizegenetics.dna.snp.CoreGenotypeTable
 
heterozygousCountForTaxon(taxon) - Method in interface net.maizegenetics.dna.snp.genotypecall.GenotypeCallTable
Returns number of heterozygous sites at given taxon.
heterozygousCountForTaxon(taxon) - Method in interface net.maizegenetics.dna.snp.GenotypeTable
Returns number of heterozygous sites at given taxon.
heterozygousCountForTaxon(taxon) - Method in class net.maizegenetics.dna.snp.MergedGenotypeTable
 
heterozygousCountForTaxon(taxon) - Method in class net.maizegenetics.dna.snp.TOPMGenotypeTable
 
HetsToUnknownPlugin - Class in net.maizegenetics.analysis.data
 
HetsToUnknownPlugin(parentFrame, isInteractive) - Constructor for class net.maizegenetics.analysis.data.HetsToUnknownPlugin
 
HighestDepthGenotypeMergeRule - Class in net.maizegenetics.dna.snp.genotypecall
 
highLDSSites() - Method in class net.maizegenetics.analysis.imputation.LDKNNiImputationHetV2Plugin
Number of sites in high LD to use in imputation
highLDSSites(value) - Method in class net.maizegenetics.analysis.imputation.LDKNNiImputationHetV2Plugin
Set High LD Sites. Number of sites in high LD to use in imputation
highLDSSites() - Method in class net.maizegenetics.analysis.imputation.LDKNNiImputationHetV3Plugin
Number of sites in high LD to use in imputation
highLDSSites(value) - Method in class net.maizegenetics.analysis.imputation.LDKNNiImputationHetV3Plugin
Set High LD Sites. Number of sites in high LD to use in imputation
highLDSSites() - Method in class net.maizegenetics.analysis.imputation.LDKNNiImputationPlugin
Maximum number of sites in high LD to use in imputation
highLDSSites(value) - Method in class net.maizegenetics.analysis.imputation.LDKNNiImputationPlugin
Set High LD Sites. Maximum number of sites in high LD to use in imputation
HistogramPanel - Class in net.maizegenetics.analysis.chart
Title:
HistogramPanel(theTable) - Constructor for class net.maizegenetics.analysis.chart.HistogramPanel
 
HistogramPanel(theTable, series1, series2, bins) - Constructor for class net.maizegenetics.analysis.chart.HistogramPanel
 
HMatrixPlugin - Class in net.maizegenetics.analysis.distance
 
HMatrixPlugin(parentFrame, isInteractive) - Constructor for class net.maizegenetics.analysis.distance.HMatrixPlugin
 
HOMOZYGOUS_COUNT - Static variable in class net.maizegenetics.dna.snp.genotypecall.AlleleFreqCache
 
hybridChar() - Method in class net.maizegenetics.analysis.data.CreateHybridGenotypesPlugin
String used to combine taxa names to create hybrid name.
hybridChar(value) - Method in class net.maizegenetics.analysis.data.CreateHybridGenotypesPlugin
Set Cross Char. String used to combine taxa names to create hybrid name.
hybridFile() - Method in class net.maizegenetics.analysis.data.CreateHybridGenotypesPlugin
Hybrid File
hybridFile(value) - Method in class net.maizegenetics.analysis.data.CreateHybridGenotypesPlugin
Set Hybrid File. Hybrid File
hybridFile() - Method in class net.maizegenetics.analysis.data.SubtractGenotypesPlugin
 
hybridFile(filename) - Method in class net.maizegenetics.analysis.data.SubtractGenotypesPlugin
Sets the name of the hybrid file.
HybridGenotypeCallTable - Class in net.maizegenetics.dna.snp.genotypecall
 
HybridGenotypeCallTable(base, firstParents, secondParents) - Constructor for class net.maizegenetics.dna.snp.genotypecall.HybridGenotypeCallTable
 

I

IBS_DISTANCE_MATRIX_AVE_TOTAL_SITES - Static variable in class net.maizegenetics.taxa.distance.DistanceMatrixBuilder
 
IBS_DISTANCE_MATRIX_NUM_ALLELES - Static variable in class net.maizegenetics.taxa.distance.DistanceMatrixBuilder
 
IBS_DISTANCE_MATRIX_TRUE_IBS - Static variable in class net.maizegenetics.taxa.distance.DistanceMatrixBuilder
 
IBS_DISTANCE_MATRIX_TYPE - Static variable in class net.maizegenetics.taxa.distance.DistanceMatrixBuilder
 
IBSDistanceMatrix - Class in net.maizegenetics.analysis.distance
This class calculates an identity by state matrix. It is scaled so only non-missing comparison are used. It conducts bit level calculations of IBS for genotypes. Only the two most common alleles are used in the distance calculations.
IBSDistanceMatrix2Alleles - Class in net.maizegenetics.analysis.distance
 
IBSDistanceMatrix3Alleles - Class in net.maizegenetics.analysis.distance
 
IBSDistanceMatrixOneByAll - Class in net.maizegenetics.analysis.distance
 
IBSERROR_DESC - Static variable in class net.maizegenetics.dna.snp.HapMapHDF5Constants
 
IBSERRORRATE_DESC - Static variable in class net.maizegenetics.dna.snp.HapMapHDF5Constants
 
IBSMAJORCORR_DESC - Static variable in class net.maizegenetics.dna.snp.HapMapHDF5Constants
 
IBSMINORCORR_DESC - Static variable in class net.maizegenetics.dna.snp.HapMapHDF5Constants
 
IBSMINORERRORRATE_DESC - Static variable in class net.maizegenetics.dna.snp.HapMapHDF5Constants
 
id() - Method in class net.maizegenetics.dna.map.GenomeFeature
 
id(id) - Method in class net.maizegenetics.dna.map.GenomeFeatureBuilder
 
IdentifierSynonymizer - Class in net.maizegenetics.taxa
User: Ed Date: Mar 30, 2005 Time: 1:39:47 PM
IdentifierSynonymizer(preferredTaxa, alternateTaxaSets) - Constructor for class net.maizegenetics.taxa.IdentifierSynonymizer
 
IdentifierSynonymizer(preferredTaxa, alternateTaxaSets, technique) - Constructor for class net.maizegenetics.taxa.IdentifierSynonymizer
 
IdentifierSynonymizer(preferredTaxa, alternateTaxaSets, technique, delimiter) - Constructor for class net.maizegenetics.taxa.IdentifierSynonymizer
 
IdentifierSynonymizer(preferredTaxa, alternateTaxa) - Constructor for class net.maizegenetics.taxa.IdentifierSynonymizer
 
identifySitesOfFlankingMarkers(site, chrVector, posVector, theGenotypesForCalculatingPCs, pg, chr) - Method in class net.maizegenetics.analysis.data.ProjectPcsAndRunModelSelectionPlugin
 
identity(n) - Method in class net.maizegenetics.matrixalgebra.Matrix.DoubleMatrixFactory
 
IdentityRecognitionPlugin - Class in net.maizegenetics.analysis.data
 
IdentityRecognitionPlugin(parentFrame, isInteractive) - Constructor for class net.maizegenetics.analysis.data.IdentityRecognitionPlugin
 
ifMap - Variable in class net.maizegenetics.dna.map.TagGWASMapInfo
If the tag is mapped by aligner
ifPAV - Variable in class net.maizegenetics.dna.map.TagsOnGeneticMap
 
ifRef - Variable in class net.maizegenetics.dna.map.TagGWASMapInfo
If the tag is reference tag
ifUnique - Variable in class net.maizegenetics.dna.map.TagGWASMapInfo
If the tag is unique to one position in genome
ignoreDepth() - Method in class net.maizegenetics.analysis.data.SplitHDF5ByChromosomePlugin
If genotypic depth information is present in the input file, ignore it (i.e., do not write depth information to the output files). Default: keep depth.
ignoreDepth(value) - Method in class net.maizegenetics.analysis.data.SplitHDF5ByChromosomePlugin
Set Ignore Depth. If genotypic depth information is present in the input file, ignore it (i.e., do not write depth information to the output files). Default: keep depth.
importAnnotatedTaxaList(filename) - Static method in class net.maizegenetics.taxa.TaxaListIOUtils
 
ImportAvro - Class in net.maizegenetics.analysis.avro
 
importJSONToFilter(filename) - Static method in class net.maizegenetics.dna.snp.io.FilterJSONUtils
 
importPositionListFromJSON(filename) - Static method in class net.maizegenetics.dna.snp.io.JSONUtils
 
importTaxaListFromJSON(filename) - Static method in class net.maizegenetics.dna.snp.io.JSONUtils
Imports taxa list from JSON file.
ImportUtils - Class in net.maizegenetics.dna.snp
Methods for importing GenotypeTables from various file formats.
improveImputedProgenyStates() - Method in class net.maizegenetics.analysis.imputation.ImputeCrossProgeny
 
ImputationAccuracyPlugin - Class in net.maizegenetics.analysis.imputation
This evaluates the accuracy of an imputed genotype. First input genotype should be the original. Second should be the masked genotype. Third should be the imputed genotype.
ImputationAccuracyPlugin() - Constructor for class net.maizegenetics.analysis.imputation.ImputationAccuracyPlugin
 
ImputationAccuracyPlugin(parentFrame, isInteractive) - Constructor for class net.maizegenetics.analysis.imputation.ImputationAccuracyPlugin
 
ImputationByMean - Class in net.maizegenetics.analysis.numericaltransform
Imputation of the missing data by mean of the respective column.
ImputationPlugin - Class in net.maizegenetics.analysis.numericaltransform
 
ImputationPlugin(parentFrame, isInteractive) - Constructor for class net.maizegenetics.analysis.numericaltransform.ImputationPlugin
Creates a new instance of the ImputationPlugin
ImputationUtils - Class in net.maizegenetics.analysis.imputation
 
impute(data) - Static method in class net.maizegenetics.analysis.numericaltransform.ImputationByMean
Impute the missing values.
impute(data, k, isManhattan, isCosine) - Static method in class net.maizegenetics.analysis.numericaltransform.kNearestNeighbors
Impute all the missing values.
IMPUTE_DOM - Static variable in class net.maizegenetics.analysis.modelfitter.AddPlusDomModelEffect
 
imputeAll() - Method in class net.maizegenetics.analysis.imputation.ImputeCrossProgeny
 
imputeAllHetCalls() - Method in class net.maizegenetics.analysis.imputation.FILLINImputationPlugin
Write all imputed heterozygous calls as such, even if the original file has a homozygous call. (Not recommended for inbred lines.)
imputeAllHetCalls(value) - Method in class net.maizegenetics.analysis.imputation.FILLINImputationPlugin
Set Impute all het calls. Write all imputed heterozygous calls as such, even if the original file has a homozygous call. (Not recommended for inbred lines.)
imputeCrossFromParents(progeny, hap0, hap1) - Method in class net.maizegenetics.analysis.imputation.ImputeCrossProgeny
 
imputeCrossFromParentsUsingProbabilities(progeny, hapProb0, hapProb1, probObsGivenState) - Method in class net.maizegenetics.analysis.imputation.ImputeCrossProgeny
 
ImputeCrossProgeny - Class in net.maizegenetics.analysis.imputation
 
imputed - Variable in class net.maizegenetics.analysis.imputation.PopulationData
 
imputedDominance() - Method in class net.maizegenetics.analysis.modelfitter.StepwiseAdditiveModelFitterPlugin
Should the plugin impute a value for dominance if data is missing. If false, the dominance score in the design matrix will be 0 for missing genotypes.
imputedDominance(value) - Method in class net.maizegenetics.analysis.modelfitter.StepwiseAdditiveModelFitterPlugin
Set Impute Dominance Score. Should the plugin impute a value for dominance if data is missing. If false, the dominance score in the design matrix will be 0 for missing genotypes.
imputedFile() - Method in class net.maizegenetics.analysis.imputation.ImputeProgenyStatesPlugin
The output file containing the imputed progeny genotypes in hapmap format.
imputedFile(value) - Method in class net.maizegenetics.analysis.imputation.ImputeProgenyStatesPlugin
Set Imputed Genotypes Output File. The output file containing the imputed progeny genotypes in hapmap format.
imputedHDF5GenotypeFile() - Method in class net.maizegenetics.analysis.imputation.ReImputeUpdatedTaxaByFILLINPlugin
Target, unfinished HDF5 (*.h5) file containing imputed genotypes to be updated
imputedHDF5GenotypeFile(value) - Method in class net.maizegenetics.analysis.imputation.ReImputeUpdatedTaxaByFILLINPlugin
Set Imputed HDF5 Genotype File. Target, unfinished HDF5 (*.h5) file containing imputed genotypes to be updated
imputeDonorFile() - Method in class net.maizegenetics.analysis.imputation.FILLINImputationPlugin
Impute the donor file itself
imputeDonorFile(value) - Method in class net.maizegenetics.analysis.imputation.FILLINImputationPlugin
Set Impute donor file. Impute the donor file itself
imputeLinkageMarkers(interval, hapmapFormat, origsnpFile, snpfilePattern, outfilePattern) - Static method in class net.maizegenetics.analysis.imputation.ImputationUtils
 
imputeLinkageMarkersAcrossFamilies(interval, hapmapFormat, excludeTaxa) - Static method in class net.maizegenetics.analysis.imputation.ImputationUtils
 
imputeLinkageMarkersFrom1106(interval) - Static method in class net.maizegenetics.analysis.imputation.ImputationUtils
 
ImputeProgenyStatesPlugin - Class in net.maizegenetics.analysis.imputation
 
ImputeProgenyStatesPlugin(parentFrame, isInteractive) - Constructor for class net.maizegenetics.analysis.imputation.ImputeProgenyStatesPlugin
 
imputeUsingViterbiFiveState(a, probHeterozygous, familyName) - Static method in class net.maizegenetics.analysis.imputation.NucleotideImputationUtils
 
imputeUsingViterbiFiveState(a, probHeterozygous, familyName, useVariableRecombitionRates) - Static method in class net.maizegenetics.analysis.imputation.NucleotideImputationUtils
 
inbredCoef - Variable in class net.maizegenetics.analysis.imputation.PopulationData
 
inbreedF(val) - Method in class net.maizegenetics.taxa.Taxon.Builder
Set inbreeding coefficient (default=Float.NaN)
InbreedFKey - Static variable in class net.maizegenetics.taxa.Taxon
Standard key for inbreeding coefficient of the taxon
includeBranchLengths() - Method in class net.maizegenetics.analysis.data.ExportPlugin
Whether to include branch lengths for Newick formatted files.
includeBranchLengths(value) - Method in class net.maizegenetics.analysis.data.ExportPlugin
Set Include Branch Lengths. Whether to include branch lengths for Newick formatted files.
includeGaps() - Method in class net.maizegenetics.analysis.gbs.DiscoverySNPCallerPlugin
Include sites where major or minor allele is a GAP
includeGaps(value) - Method in class net.maizegenetics.analysis.gbs.DiscoverySNPCallerPlugin
Set Include Gaps. Include sites where major or minor allele is a GAP
includeGaps() - Method in class net.maizegenetics.analysis.gbs.v2.DiscoverySNPCallerPluginV2
Include sites where major or minor allele is a GAP
includeGaps(value) - Method in class net.maizegenetics.analysis.gbs.v2.DiscoverySNPCallerPluginV2
Set Include Gaps. Include sites where major or minor allele is a GAP
includeParents(include) - Method in class net.maizegenetics.analysis.imputation.CallParentAllelesPlugin
 
includeRareAlleles() - Method in class net.maizegenetics.analysis.gbs.DiscoverySNPCallerPlugin
Include the rare alleles at site (3 or 4th states)
includeRareAlleles(value) - Method in class net.maizegenetics.analysis.gbs.DiscoverySNPCallerPlugin
Set Include Rare Alleles. Include the rare alleles at site (3 or 4th states)
includeSites() - Method in class net.maizegenetics.analysis.filter.FilterSiteBuilderPlugin
Include Sites
includeSites(value) - Method in class net.maizegenetics.analysis.filter.FilterSiteBuilderPlugin
Set Include Sites.
includeSites() - Method in class net.maizegenetics.dna.snp.FilterSite
 
includeTaxa() - Method in class net.maizegenetics.analysis.filter.FilterTaxaBuilderPlugin
Include Taxa
includeTaxa(value) - Method in class net.maizegenetics.analysis.filter.FilterTaxaBuilderPlugin
Set Include Taxa.
includeTaxa() - Method in class net.maizegenetics.dna.snp.FilterTaxa
 
includeTaxaAnnotations() - Method in class net.maizegenetics.analysis.data.ExportPlugin
Whether to include taxa annotations if format supports taxa annotations.
includeTaxaAnnotations(value) - Method in class net.maizegenetics.analysis.data.ExportPlugin
Set Include Taxa Annotations. Whether to include taxa annotations if format supports taxa annotations.
IncompatibleScoringSchemeException - Exception in net.maizegenetics.analysis.gbs.neobio
Signals that an scoring scheme is not compatible with the sequences being aligned.
IncompatibleScoringSchemeException() - Constructor for exception net.maizegenetics.analysis.gbs.neobio.IncompatibleScoringSchemeException
Constructs an IncompatibleScoringSchemeException with null as its error detail message.
IncompatibleScoringSchemeException(message) - Constructor for exception net.maizegenetics.analysis.gbs.neobio.IncompatibleScoringSchemeException
Constructs an IncompatibleScoringSchemeException with the specified detail message.
IncompatibleScoringSchemeException(cause) - Constructor for exception net.maizegenetics.analysis.gbs.neobio.IncompatibleScoringSchemeException
Constructs an IncompatibleScoringSchemeException with the specified cause (and a detail message that typically contains the class and detail message of cause).
IncompatibleScoringSchemeException(message, cause) - Constructor for exception net.maizegenetics.analysis.gbs.neobio.IncompatibleScoringSchemeException
Constructs an IncompatibleScoringSchemeException with the specified detail message and cause.
incompleteGammaP(a, x) - Static method in class net.maizegenetics.stats.math.GammaFunction
Incomplete Gamma function P(a,x) = 1-Q(a,x) (a cleanroom implementation of Numerical Recipes gammp(a,x); in Mathematica this function is 1-GammaRegularized)
incompleteGammaP(a, x, lnGammaA) - Static method in class net.maizegenetics.stats.math.GammaFunction
Incomplete Gamma function P(a,x) = 1-Q(a,x) (a cleanroom implementation of Numerical Recipes gammp(a,x); in Mathematica this function is 1-GammaRegularized)
incompleteGammaQ(a, x) - Static method in class net.maizegenetics.stats.math.GammaFunction
Incomplete Gamma function Q(a,x) (a cleanroom implementation of Numerical Recipes gammq(a,x); in Mathematica this function is called GammaRegularized)
increment(taxaNum) - Method in interface net.maizegenetics.dna.tag.TaxaDistribution
Add the taxa to do the distribution, with an additional depth of 1
increment(tissueNum, taxaNum) - Method in class net.maizegenetics.taxa.TaxaTissueDist
 
incrementScore(val) - Method in class net.maizegenetics.analysis.clustering.HaplotypeCluster
 
inDegree(n) - Method in class net.maizegenetics.util.DirectedGraph
Gets the number of nodes with an edge coming into the query node
indel(val) - Method in class net.maizegenetics.dna.map.GeneralPosition.Builder
Set whether position is indel (default=false)
INDEL_CHAR - Static variable in class net.maizegenetics.analysis.gbs.neobio.ScoringMatrix
The character that indicates the row and column for insertion and deletion penalties in the matrix.
indelInKnownVariant(knownVariants) - Static method in class net.maizegenetics.dna.snp.io.VCFUtil
 
indelMinusInKnownVariant(knownVariants) - Static method in class net.maizegenetics.dna.snp.io.VCFUtil
 
indelSize(site) - Method in interface net.maizegenetics.dna.map.PositionList
Return size of indel at given site.
indelSize(site) - Method in class net.maizegenetics.dna.snp.CombineGenotypeTable
 
indelSize(site) - Method in class net.maizegenetics.dna.snp.CoreGenotypeTable
 
indelSize(site) - Method in interface net.maizegenetics.dna.snp.GenotypeTable
Return size of indel at given site.
indelSize(site) - Method in class net.maizegenetics.dna.snp.MergedGenotypeTable
 
indelSize(site) - Method in class net.maizegenetics.dna.snp.TOPMGenotypeTable
 
IndelsToUnknownPlugin - Class in net.maizegenetics.analysis.data
 
IndelsToUnknownPlugin(parentFrame, isInteractive) - Constructor for class net.maizegenetics.analysis.data.IndelsToUnknownPlugin
 
index - Variable in class net.maizegenetics.analysis.modelfitter.SNP
 
index() - Method in class net.maizegenetics.dna.snp.genotypecall.Stats
 
index() - Method in enum net.maizegenetics.dna.WHICH_ALLELE
Sequential index that can be use for primitive arrays
indexComparator() - Static method in class net.maizegenetics.stats.linearmodels.BasicLevel
 
indexForAttrLabel(label) - Method in class net.maizegenetics.phenotype.CategoricalAttribute
 
indexOf(o) - Method in class net.maizegenetics.analysis.avro.GenericArrayPositions
 
indexOf(o) - Method in class net.maizegenetics.analysis.avro.GenericArrayTaxa
 
indexOf(o) - Method in class net.maizegenetics.dna.snp.FilterList
 
indexOf(name) - Method in interface net.maizegenetics.taxa.TaxaList
Return a list of all matching taxa indices for a given name.
indexOf(taxon) - Method in interface net.maizegenetics.taxa.TaxaList
Return a list of all matching taxa indices for a given name.
indexOfAttribute(attribute) - Method in class net.maizegenetics.phenotype.CorePhenotype
 
indexOfAttribute(attribute) - Method in class net.maizegenetics.phenotype.FilterPhenotype
 
indexOfAttribute(attribute) - Method in interface net.maizegenetics.phenotype.Phenotype
 
indexOfNthSetBit(n) - Method in interface net.maizegenetics.util.BitSet
Returns index of the nth set bit.
indexOfNthSetBit(n) - Method in class net.maizegenetics.util.OpenBitSet
 
indexOfNthSetBit(n) - Method in class net.maizegenetics.util.UnmodifiableBitSet
 
indicesOfSortByPosition - Variable in class net.maizegenetics.dna.map.AbstractTagsOnPhysicalMap
 
inDir() - Method in class net.maizegenetics.plugindef.PluginParameter.Builder
 
inFile() - Method in class net.maizegenetics.analysis.gobii.SplitFile_IFLFilePlugin
Name of file to split. It must have 1 and only 1 period in the name to separate dataset name from table name
inFile(value) - Method in class net.maizegenetics.analysis.gobii.SplitFile_IFLFilePlugin
Set Input FIle. Name of file to split. It must have 1 and only 1 period in the name to separate dataset name from table name
inFile() - Method in class net.maizegenetics.plugindef.PluginParameter.Builder
 
info - Variable in class net.maizegenetics.matrixalgebra.decomposition.BlasEigenvalueDecomposition
 
iniMatrix(tagLengthInLong, tagNum) - Method in class net.maizegenetics.dna.map.AbstractPETagsOnPhysicalMap
 
iniMatrix(tagLengthInLong, tagNum) - Method in class net.maizegenetics.dna.map.TagsOnGeneticMap
Initialize the matrix of TOGM
iniMatrix(tagLengthInLong, tagNum) - Method in class net.maizegenetics.dna.tag.AbstractPETags
Initialize the matrix of data structure extending AbstractPETags
iniMatrix(tagLengthInLong, tagNum) - Method in class net.maizegenetics.dna.tag.PETagCounts
 
init() - Method in class net.maizegenetics.analysis.association.CompressedDoubleMatrix
 
init(max_length, max_score) - Method in class net.maizegenetics.analysis.gbs.neobio.OutMatrix
Initialised this OUT matrix interface. This method needs to be executed only once per alignment.
init() - Method in class net.maizegenetics.matrixalgebra.decomposition.BlasEigenvalueDecomposition
 
init() - Method in class net.maizegenetics.stats.EMMA.EMMAforDoubleMatrix
 
init(n) - Method in class net.maizegenetics.taxa.tree.SimpleNode
 
init(n, keepId) - Method in class net.maizegenetics.taxa.tree.SimpleNode
Initialized node instance variables based on given Node. children are ignored.
init(n, keepId, lm) - Method in class net.maizegenetics.taxa.tree.SimpleNode
Initialized node instance variables based on given Node. children are ignored.
init(dataSource) - Static method in class net.maizegenetics.util.db.LambdaTuplesContext
 
init(schema, dataSource) - Static method in class net.maizegenetics.util.db.LambdaTuplesContext
 
init() - Method in class net.maizegenetics.util.db.ResultSetIterator
 
initialCutSiteRemnant - Static variable in class net.maizegenetics.analysis.gbs.ParseBarcodeRead
 
initialCutSiteRemnant - Variable in class net.maizegenetics.analysis.gbs.v2.EnzymeList.Enzyme
 
initialCutSiteRemnant() - Method in class net.maizegenetics.analysis.gbs.v2.EnzymeList.Enzyme
Deprecated. 
initialCutSiteRemnant() - Method in class net.maizegenetics.analysis.gbs.v2.GBSEnzyme
Deprecated.
 
initialGenotype - Variable in class net.maizegenetics.analysis.imputation.BiparentalHaplotypeFinder
 
initialize() - Method in class net.maizegenetics.analysis.association.PhenotypeLM
 
initialize() - Method in class net.maizegenetics.analysis.gbs.PolymorphismFinder
 
initialize() - Method in class net.maizegenetics.analysis.gbs.UTagPairFinder
 
initialize() - Method in class net.maizegenetics.analysis.imputation.ViterbiAlgorithm
 
initialize() - Method in class net.maizegenetics.analysis.imputation.ViterbiAlgorithmVariableStateNumber
 
initializeBarcodeTrie(taxaList, masterTaxaList, myEnzyme) - Static method in class net.maizegenetics.analysis.gbs.v2.GBSUtils
Produces a trie for sorting the read
initializeBarcodeTrie(taxaList, masterTaxaList, masterTissueList, myEnzyme) - Static method in class net.maizegenetics.analysis.gbs.v2.GBSUtils
 
initializeHDF5(tagGWASMapFileS) - Method in class net.maizegenetics.dna.map.TagGWASMap
 
initializeHDF5(inputFileS) - Method in class net.maizegenetics.dna.tag.AbstractTagsHDF5
Initialize a HDF5 file
initializeMatrix(tagCount, tagLengthInLong) - Method in class net.maizegenetics.dna.tag.AbstractTagsHDF5
Initialize tag matrix
initializeReportBuilders() - Method in class net.maizegenetics.analysis.association.AbstractFixedEffectLM
 
initializeReportBuilders() - Method in interface net.maizegenetics.analysis.association.FixedEffectLM
Initializes builders for the site and allele reports. The report names and column headers for a specific analysis are created in this method.
initialStateProbability(probs) - Method in class net.maizegenetics.analysis.imputation.BackwardForwardAlgorithm
 
initialStateProbability(probs) - Method in class net.maizegenetics.analysis.imputation.BackwardForwardVariableStateNumber
 
initiateAccuracy() - Method in class net.maizegenetics.analysis.imputation.FILLINImputationAccuracy
 
initMatrices(tagNum) - Method in class net.maizegenetics.dna.tag.TagCountMutable
 
initMatrices(tagNum) - Method in class net.maizegenetics.dna.tag.TagCounts
 
initMatrices(taxaNum, tagNum) - Method in interface net.maizegenetics.dna.tag.TagsByTaxa
Initializes the storage matrices for reading (unclear why in interface)
initMatrices(taxaNum, tagNum) - Method in class net.maizegenetics.dna.tag.TagsByTaxaByte
 
initMatrices(taxaNum, tagNum) - Method in class net.maizegenetics.dna.tag.TagsByTaxaByteFileMap
 
initMatrices(taxaNum, tagNum) - Method in class net.maizegenetics.dna.tag.TagsByTaxaByteFileMapSeq
 
initMatrices(taxaNum, tagNum) - Method in class net.maizegenetics.dna.tag.TagsByTaxaByteHDF5TagGroups
 
initMatrices(taxaNum, tagNum) - Method in class net.maizegenetics.dna.tag.TagsByTaxaByteHDF5TaxaGroups
 
initMatrices(taxaNum, tagNum) - Method in class net.maizegenetics.dna.tag.TagsByTaxaShort
 
innerProduct(x, y) - Static method in class net.maizegenetics.stats.linearmodels.SolveByOrthogonalizing
 
input() - Method in class net.maizegenetics.analysis.gbs.UTagPairToTOPMPlugin
Input file of matched tag pairs
input(value) - Method in class net.maizegenetics.analysis.gbs.UTagPairToTOPMPlugin
Set Input. Input file of matched tag pairs
input_border - Variable in class net.maizegenetics.analysis.gbs.neobio.OutMatrix
The input border of a block.
inputDB() - Method in class net.maizegenetics.analysis.gbs.repgen.RepGenAlignerPlugin
Input database file with tags and taxa distribution
inputDB(value) - Method in class net.maizegenetics.analysis.gbs.repgen.RepGenAlignerPlugin
Set Input DB. Input database file with tags and taxa distribution
inputDB() - Method in class net.maizegenetics.analysis.gbs.repgen.RepGenLDAnalysisPlugin
Input database file with tags and taxa distribution
inputDB(value) - Method in class net.maizegenetics.analysis.gbs.repgen.RepGenLDAnalysisPlugin
Set Input DB. Input database file with tags and taxa distribution
inputDB() - Method in class net.maizegenetics.analysis.gbs.repgen.RepGenPhase2AlignerPlugin
Input database file with tags and taxa distribution
inputDB(value) - Method in class net.maizegenetics.analysis.gbs.repgen.RepGenPhase2AlignerPlugin
Set Input DB. Input database file with tags and taxa distribution
inputDB() - Method in class net.maizegenetics.analysis.gbs.v2.DiscoverySNPCallerPluginV2
Input TagsByTaxa file (if hdf5 format, use .hdf or .h5 extension)
inputDB(value) - Method in class net.maizegenetics.analysis.gbs.v2.DiscoverySNPCallerPluginV2
Set Input Tags by Taxa File. Input TagsByTaxa file (if hdf5 format, use .hdf or .h5 extension)
inputDB() - Method in class net.maizegenetics.analysis.gbs.v2.GetTagSequenceFromDBPlugin
Input database file with tags and taxa distribution
inputDB(value) - Method in class net.maizegenetics.analysis.gbs.v2.GetTagSequenceFromDBPlugin
Set Input DB. Input database file with tags and taxa distribution
inputDB() - Method in class net.maizegenetics.analysis.gbs.v2.GetTagTaxaDistFromDBPlugin
Input database file with tags and taxa distribution
inputDB(value) - Method in class net.maizegenetics.analysis.gbs.v2.GetTagTaxaDistFromDBPlugin
Set Input DB. Input database file with tags and taxa distribution
inputDB() - Method in class net.maizegenetics.analysis.gbs.v2.SNPCutPosTagVerificationPlugin
Input database file with tags and taxa distribution
inputDB(value) - Method in class net.maizegenetics.analysis.gbs.v2.SNPCutPosTagVerificationPlugin
Set Input DB. Input database file with tags and taxa distribution
inputDB() - Method in class net.maizegenetics.analysis.gbs.v2.TagExportToFastqPlugin
Input database file with tags and taxa distribution
inputDB(value) - Method in class net.maizegenetics.analysis.gbs.v2.TagExportToFastqPlugin
Set Input DB. Input database file with tags and taxa distribution
inputDB() - Method in class net.maizegenetics.analysis.gbs.v2.UpdateSNPPositionQualityPlugin
Input database file with tags and taxa distribution
inputDB(value) - Method in class net.maizegenetics.analysis.gbs.v2.UpdateSNPPositionQualityPlugin
Set Input DB. Input database file with tags and taxa distribution
inputDB() - Method in class net.maizegenetics.analysis.rna.RNADeMultiplexProductionPlugin
Input Database file if using SQLite
inputDB(value) - Method in class net.maizegenetics.analysis.rna.RNADeMultiplexProductionPlugin
Set Input GBS Database. Input Database file if using SQLite
inputDir(value) - Method in class net.maizegenetics.analysis.gbs.FastqToTagCountPlugin
 
inputDir() - Method in class net.maizegenetics.analysis.gbs.FastqToTagCountPlugin
 
inputDir() - Method in class net.maizegenetics.analysis.rna.RNADeMultiplexProductionPlugin
Input directory containing fastq AND/OR qseq files.
inputDir(value) - Method in class net.maizegenetics.analysis.rna.RNADeMultiplexProductionPlugin
Set Input Directory. Input directory containing fastq AND/OR qseq files.
inputDirectory() - Method in class net.maizegenetics.analysis.gbs.MergeMultipleTagCountPlugin
 
inputDirectory(value) - Method in class net.maizegenetics.analysis.gbs.MergeMultipleTagCountPlugin
 
inputDirectory() - Method in class net.maizegenetics.analysis.gbs.ProductionPipeline
Input directory containing subdirectories with fastq AND/OR qseq files
inputDirectory(value) - Method in class net.maizegenetics.analysis.gbs.ProductionPipeline
Set Input Directory. Input directory containing subdirectories with fastq AND/OR qseq files
inputDirectory() - Method in class net.maizegenetics.analysis.gbs.ProductionSNPCallerPlugin
Input directory containing fastq AND/OR qseq files.
inputDirectory(value) - Method in class net.maizegenetics.analysis.gbs.ProductionSNPCallerPlugin
Set Input Directory. Input directory containing fastq AND/OR qseq files.
inputDirectory() - Method in class net.maizegenetics.analysis.gbs.repgen.RepGenLoadSeqToDBPlugin
Input directory containing FASTQ files in text or gzipped text. NOTE: Directory will be searched recursively and should be written WITHOUT a slash after its name.
inputDirectory(value) - Method in class net.maizegenetics.analysis.gbs.repgen.RepGenLoadSeqToDBPlugin
Set Input Directory. Input directory containing FASTQ files in text or gzipped text. NOTE: Directory will be searched recursively and should be written WITHOUT a slash after its name.
inputDirectory() - Method in class net.maizegenetics.analysis.gbs.repgen.RGBSProductionSNPCallerPlugin
Input directory containing fastq AND/OR qseq files.
inputDirectory(value) - Method in class net.maizegenetics.analysis.gbs.repgen.RGBSProductionSNPCallerPlugin
Set Input Directory. Input directory containing fastq AND/OR qseq files.
inputDirectory() - Method in class net.maizegenetics.analysis.gbs.SeqToTBTHDF5Plugin
Input directory containing .fastq files
inputDirectory(value) - Method in class net.maizegenetics.analysis.gbs.SeqToTBTHDF5Plugin
Set Input Directory. Input directory containing .fastq files
inputDirectory() - Method in class net.maizegenetics.analysis.gbs.v2.GBSSeqToTagDBPlugin
Input directory containing FASTQ files in text or gzipped text. NOTE: Directory will be searched recursively and should be written WITHOUT a slash after its name.
inputDirectory(value) - Method in class net.maizegenetics.analysis.gbs.v2.GBSSeqToTagDBPlugin
Set Input Directory. Input directory containing FASTQ files in text or gzipped text. NOTE: Directory will be searched recursively and should be written WITHOUT a slash after its name.
inputDirectory() - Method in class net.maizegenetics.analysis.gbs.v2.ProductionSNPCallerPluginV2
Input directory containing fastq AND/OR qseq files.
inputDirectory(value) - Method in class net.maizegenetics.analysis.gbs.v2.ProductionSNPCallerPluginV2
Set Input Directory. Input directory containing fastq AND/OR qseq files.
inputDirectory() - Method in class net.maizegenetics.analysis.rna.RNADeMultiPlexSeqToDBPlugin
Input directory containing FASTQ files in text or gzipped text. NOTE: Directory will be searched recursively and should be written WITHOUT a slash after its name.
inputDirectory(value) - Method in class net.maizegenetics.analysis.rna.RNADeMultiPlexSeqToDBPlugin
Set Input Directory. Input directory containing FASTQ files in text or gzipped text. NOTE: Directory will be searched recursively and should be written WITHOUT a slash after its name.
inputFile() - Method in class net.maizegenetics.analysis.data.BuildUnfinishedHDF5GenotypesPlugin
Input, unfinished HDF5 genotype (*.h5) file to be fininalized
inputFile(value) - Method in class net.maizegenetics.analysis.data.BuildUnfinishedHDF5GenotypesPlugin
Set Input file. Input, unfinished HDF5 genotype (*.h5) file to be fininalized
inputFile(filename) - Method in class net.maizegenetics.analysis.data.HDF5SummaryPlugin
 
inputFile() - Method in class net.maizegenetics.analysis.data.HDF5SummaryPlugin
 
inputFile() - Method in class net.maizegenetics.analysis.data.SortGenotypeFilePlugin
Input file
inputFile(value) - Method in class net.maizegenetics.analysis.data.SortGenotypeFilePlugin
Set Input file. Input file
inputFile() - Method in class net.maizegenetics.analysis.gbs.BinaryToTextPlugin
Input File
inputFile(value) - Method in class net.maizegenetics.analysis.gbs.BinaryToTextPlugin
Set Input File. Input File
inputFile() - Method in class net.maizegenetics.analysis.gbs.SAMConverterPlugin
 
inputFile(value) - Method in class net.maizegenetics.analysis.gbs.SAMConverterPlugin
 
inputFile() - Method in class net.maizegenetics.analysis.gbs.TagCountToFastqPlugin
 
inputFile(value) - Method in class net.maizegenetics.analysis.gbs.TagCountToFastqPlugin
 
inputFile() - Method in class net.maizegenetics.analysis.gbs.UTagCountToTagPairPlugin
Input file of merged tag counts
inputFile(value) - Method in class net.maizegenetics.analysis.gbs.UTagCountToTagPairPlugin
Set Input file. Input file of merged tag counts
inputFile() - Method in class net.maizegenetics.analysis.gobii.GWAS_IFLPlugin
Tab-delimited Input File containing a header line and entries, or Directory containing Tab-delimited files of gwas data. If parameter is a directory, each file must contain a header line, and the files must end with .txt or .txt.gz
inputFile(value) - Method in class net.maizegenetics.analysis.gobii.GWAS_IFLPlugin
Set Input File. Tab-delimited Input File containing a header line and entries, or Directory containing Tab-delimited files of gwas data. If parameter is a directory, each file must contain a header line, and the files must end with .txt or .txt.gz
inputFile() - Method in class net.maizegenetics.analysis.gobii.MarkerDNARun_IFLFilePlugin
hmp.txt file including, including the header line, which will be used to create marker related and dnarun related intermediary files for GOBII loading
inputFile(value) - Method in class net.maizegenetics.analysis.gobii.MarkerDNARun_IFLFilePlugin
Set inputFile. hmp.txt file including, including the header line, which will be used to create marker related and dnarun related intermediary files for GOBII loading
inputFile() - Method in class net.maizegenetics.analysis.monetdb.ColumnsToBinaryFullGenomeTablePlugin
File or a Directory containing Tab-delimited files with data to add to the database. Files must be named chr01.txt, chr02.txt etc!
inputFile(value) - Method in class net.maizegenetics.analysis.monetdb.ColumnsToBinaryFullGenomeTablePlugin
Set Input Directory. Directory containing Tab-delimited files with data to add to the database. Files must be named chr01.txt, chr02.txt etc!
inputFile() - Method in class net.maizegenetics.analysis.monetdb.ColumnsToBinarySNPOnlyTablePlugin
File or a Directory containing Tab-delimited files with data to add to the database. Files must be named chr01.txt, chr02.txt etc!
inputFile(value) - Method in class net.maizegenetics.analysis.monetdb.ColumnsToBinarySNPOnlyTablePlugin
Set Input Directory. Directory containing Tab-delimited files with data to add to the database. Files must be named chr01.txt, chr02.txt etc!
inputFile() - Method in class net.maizegenetics.util.ConvertOldFastqToModernFormatPlugin
Input file or directory containing FASTQ files in text or gzipped text. NOTE: Directory will be searched recursively
inputFile(value) - Method in class net.maizegenetics.util.ConvertOldFastqToModernFormatPlugin
Set Input Directory. Input file or directory containing FASTQ files in text or gzipped text. NOTE: Directory will be searched recursively
inputFileGlob - Static variable in class net.maizegenetics.analysis.gbs.v2.GBSUtils
 
inputFileGlob - Static variable in class net.maizegenetics.util.ConvertOldFastqToModernFormatPlugin
 
inputGBSDatabase() - Method in class net.maizegenetics.analysis.gbs.repgen.RGBSProductionSNPCallerPlugin
Input Database file if using SQLite
inputGBSDatabase(value) - Method in class net.maizegenetics.analysis.gbs.repgen.RGBSProductionSNPCallerPlugin
Set Input GBS Database. Input Database file if using SQLite
inputGBSDatabase() - Method in class net.maizegenetics.analysis.gbs.v2.ProductionSNPCallerPluginV2
Input Database file if using SQLite
inputGBSDatabase(value) - Method in class net.maizegenetics.analysis.gbs.v2.ProductionSNPCallerPluginV2
Set Input GBS Database. Input Database file if using SQLite
inputHDF5GenotypeFile() - Method in class net.maizegenetics.analysis.data.AddReferenceAlleleToHDF5Plugin
Input HDF5 genotype (*.h5) file to be annotated with the reference allele
inputHDF5GenotypeFile(value) - Method in class net.maizegenetics.analysis.data.AddReferenceAlleleToHDF5Plugin
Set Input HDF5 Genotype File. Input HDF5 genotype (*.h5) file to be annotated with the reference allele
inputHDF5GenotypeFile() - Method in class net.maizegenetics.analysis.data.SplitHDF5ByChromosomePlugin
Input HDF5 genotype (*.h5) file to be split by chromosome. The output files will be named *_chr#.h5 (where # = chromosome number)
inputHDF5GenotypeFile(value) - Method in class net.maizegenetics.analysis.data.SplitHDF5ByChromosomePlugin
Set Input HDF5 Genotype File. Input HDF5 genotype (*.h5) file to be split by chromosome. The output files will be named *_chr#.h5 (where # = chromosome number)
InputSource - Class in net.maizegenetics.util
convenience class to open input streams linked to files, stdin, and strings
inputTagsByTaxaFile() - Method in class net.maizegenetics.analysis.gbs.DiscoverySNPCallerPlugin
Input TagsByTaxa file (if hdf5 format, use .hdf or .h5 extension)
inputTagsByTaxaFile(value) - Method in class net.maizegenetics.analysis.gbs.DiscoverySNPCallerPlugin
Set Input Tags by Taxa File. Input TagsByTaxa file (if hdf5 format, use .hdf or .h5 extension)
inputTOPMFile() - Method in class net.maizegenetics.analysis.gbs.DiscoverySNPCallerPlugin
TagsOnPhysicalMap (TOPM) file containing genomic positions of tags
inputTOPMFile(value) - Method in class net.maizegenetics.analysis.gbs.DiscoverySNPCallerPlugin
Set Input TOPM File. TagsOnPhysicalMap (TOPM) file containing genomic positions of tags
inputTOPMFile() - Method in class net.maizegenetics.analysis.gbs.ProductionSNPCallerPlugin
Physical map file containing tags and corresponding variants (production TOPM)
inputTOPMFile(value) - Method in class net.maizegenetics.analysis.gbs.ProductionSNPCallerPlugin
Set Input TOPM File. Physical map file containing tags and corresponding variants (production TOPM)
inputVCFFile() - Method in class net.maizegenetics.analysis.data.AdjustPhasingPlugin
Input VCF file
inputVCFFile(value) - Method in class net.maizegenetics.analysis.data.AdjustPhasingPlugin
Set Input VCF File. Input file
INSERT_ALLELE - Static variable in class net.maizegenetics.dna.snp.NucleotideAlignmentConstants
 
INSERT_ALLELE_STR - Static variable in class net.maizegenetics.dna.snp.NucleotideAlignmentConstants
 
INSERT_DIPLOID_ALLELE - Static variable in class net.maizegenetics.dna.snp.NucleotideAlignmentConstants
 
insertChild(c, pos) - Method in interface net.maizegenetics.taxa.tree.Node
add new child node (insertion at a specific position)
insertChild(n, pos) - Method in class net.maizegenetics.taxa.tree.SimpleNode
add new child node (insertion at a specific position)
insertionPosition(val) - Method in class net.maizegenetics.dna.map.GeneralPosition.Builder
Set Insertion-position
instance(name) - Static method in class net.maizegenetics.dna.map.Chromosome
Creates Chromosome instance with specified name. Returns single instance given same name multiple times.
instance(name) - Static method in class net.maizegenetics.dna.map.Chromosome
Creates Chromosome instance with specified name. Returns single instance given same name multiple times.
instance(name, length, features) - Static method in class net.maizegenetics.dna.map.Chromosome
 
instance(fastaFileName) - Static method in class net.maizegenetics.dna.map.GenomeSequenceBuilder
Builds GenomeSequence from a fasta file.
instance(fastaFileName, charConversion) - Static method in class net.maizegenetics.dna.map.GenomeSequenceBuilder
Builds GenomeSequence from a fasta file. The char conversion provide a mechanism to convert upper and lower case or convert one case to N. This is useful if a case if used to define a certain class of bases
instance(chromosome, sequence) - Static method in class net.maizegenetics.dna.map.GenomeSequenceBuilder
Builds GenomeSequence from a String with one Chromosome.
instance(fastaFileName, gvcfFileName) - Static method in class net.maizegenetics.dna.map.GVCFGenomeSequenceBuilder
Builds GenomeSequence from a fasta file and a GVCF file.
instance(fastaFileName, charConversion, gvcfFileName) - Static method in class net.maizegenetics.dna.map.GVCFGenomeSequenceBuilder
Builds GenomeSequence from a fasta file. The char conversion provide a mechanism to convert upper and lower case or convert one case to N. This is useful if a case if used to define a certain class of bases
instance(base, maskedBitSet, filteredBitSet) - Static method in class net.maizegenetics.dna.map.GVCFGenomeSequenceBuilder
 
instance(vcf) - Static method in class net.maizegenetics.dna.snp.io.BuilderFromVCFUsingHTSJDK
 
instance(header, variants) - Static method in class net.maizegenetics.dna.snp.io.BuilderFromVCFUsingHTSJDK
 
instance(header, variants) - Static method in class net.maizegenetics.dna.snp.io.BuilderFromVCFUsingHTSJDK
 
instance(seq2Bit, length) - Static method in class net.maizegenetics.dna.tag.TagBuilder
 
instance(seq2BitInBytes, length) - Static method in class net.maizegenetics.dna.tag.TagBuilder
 
instance(sequence) - Static method in class net.maizegenetics.dna.tag.TagBuilder
 
INSTANCE - Static variable in class net.maizegenetics.util.ChangeLog
This outputs the change logs messages in HTML for tassel-5-source since this last "New Build Date" message. The results can be added to Tassel5ChangeHistory.html on the website.
INT_MISSING - Static variable in interface net.maizegenetics.dna.map.TOPMInterface
 
intDeflation - Static variable in class net.maizegenetics.dna.snp.HapMapHDF5Constants
 
intDeflation - Static variable in class net.maizegenetics.util.Tassel5HDF5Constants
 
intersect() - Method in class net.maizegenetics.phenotype.GenotypePhenotypeBuilder
Indicates that an intersect join should be performed. If necessary the GenotypeTable and Phenotype will be filtered before building the GenotypePhenotype. The filtered tables will have only the taxa common to both.
intersect(other) - Method in interface net.maizegenetics.util.BitSet
this = this AND other
intersect(other) - Method in class net.maizegenetics.util.OpenBitSet
this = this AND other
intersect(other) - Method in class net.maizegenetics.util.UnmodifiableBitSet
 
IntersectionAlignmentPlugin - Class in net.maizegenetics.analysis.data
 
IntersectionAlignmentPlugin(parentFrame, isInteractive) - Constructor for class net.maizegenetics.analysis.data.IntersectionAlignmentPlugin
Creates a new instance of IntersectionAlignmentPlugin
intersectionCount(a, b) - Static method in class net.maizegenetics.util.OpenBitSet
Returns the popcount or cardinality of the intersection of the two sets. Neither set is modified.
intersectJoin() - Method in class net.maizegenetics.phenotype.PhenotypeBuilder
 
intersects(other) - Method in interface net.maizegenetics.util.BitSet
Returns true if the sets have any elements in common
intersects(other) - Method in class net.maizegenetics.util.OpenBitSet
returns true if the sets have any elements in common
intersects(other) - Method in class net.maizegenetics.util.UnmodifiableBitSet
 
intervalFile() - Method in class net.maizegenetics.analysis.data.CountAssociationsPlugin
Interval File.
intervalFile(value) - Method in class net.maizegenetics.analysis.data.CountAssociationsPlugin
Set Intervals. Interval File.
intervalFile() - Method in class net.maizegenetics.analysis.data.MeanR2FromLDPlugin
Interval File.
intervalFile(value) - Method in class net.maizegenetics.analysis.data.MeanR2FromLDPlugin
Set Intervals. Interval File.
intervalMap(intervalFile) - Method in class net.maizegenetics.analysis.data.MeanR2FromLDPlugin
 
intValue(obs) - Method in class net.maizegenetics.phenotype.CategoricalAttribute
 
InvalidScoringMatrixException - Exception in net.maizegenetics.analysis.gbs.neobio
Signals that the substitution matrix does not comply with the specification (see class ScoringMatrix for details).
InvalidScoringMatrixException() - Constructor for exception net.maizegenetics.analysis.gbs.neobio.InvalidScoringMatrixException
Constructs an InvalidScoringMatrixException with null as its error detail message.
InvalidScoringMatrixException(message) - Constructor for exception net.maizegenetics.analysis.gbs.neobio.InvalidScoringMatrixException
Constructs an InvalidScoringMatrixException with the specified detail message.
InvalidScoringMatrixException(cause) - Constructor for exception net.maizegenetics.analysis.gbs.neobio.InvalidScoringMatrixException
Constructs an InvalidScoringMatrixException with the specified cause (and a detail message that typically contains the class and detail message of cause).
InvalidScoringMatrixException(message, cause) - Constructor for exception net.maizegenetics.analysis.gbs.neobio.InvalidScoringMatrixException
Constructs an InvalidScoringMatrixException with the specified detail message and cause.
InvalidSequenceException - Exception in net.maizegenetics.analysis.gbs.neobio
Signals that the sequence does not comply with the specification (see class CharSequence or class FactorSequence for details).
InvalidSequenceException() - Constructor for exception net.maizegenetics.analysis.gbs.neobio.InvalidSequenceException
Constructs an InvalidSequenceException with null as its error detail message.
InvalidSequenceException(message) - Constructor for exception net.maizegenetics.analysis.gbs.neobio.InvalidSequenceException
Constructs an InvalidSequenceException with the specified detail message.
InvalidSequenceException(cause) - Constructor for exception net.maizegenetics.analysis.gbs.neobio.InvalidSequenceException
Constructs an InvalidSequenceException with the specified cause (and a detail message that typically contains the class and detail message of cause).
InvalidSequenceException(message, cause) - Constructor for exception net.maizegenetics.analysis.gbs.neobio.InvalidSequenceException
Constructs an InvalidSequenceException with the specified detail message and cause.
inverse() - Method in class net.maizegenetics.matrixalgebra.Matrix.BlasDoubleMatrix
 
inverse() - Method in class net.maizegenetics.matrixalgebra.Matrix.ColtDoubleMatrix
 
inverse() - Method in interface net.maizegenetics.matrixalgebra.Matrix.DoubleMatrix
This returns the inverse or a square matrix, without modifying the original matrix.
inverse() - Method in class net.maizegenetics.matrixalgebra.Matrix.EJMLDoubleMatrix
 
inverseErf(z) - Static method in class net.maizegenetics.stats.math.ErrorFunction
inverse error function
invert() - Method in class net.maizegenetics.matrixalgebra.Matrix.BlasDoubleMatrix
 
invert() - Method in class net.maizegenetics.matrixalgebra.Matrix.ColtDoubleMatrix
 
invert() - Method in interface net.maizegenetics.matrixalgebra.Matrix.DoubleMatrix
This invers a square matrix, replacing the original with the inverse.
invert() - Method in class net.maizegenetics.matrixalgebra.Matrix.EJMLDoubleMatrix
 
invH - Variable in class net.maizegenetics.stats.EMMA.EMMAforDoubleMatrix
 
invXHX - Variable in class net.maizegenetics.stats.EMMA.EMMAforDoubleMatrix
 
isACGT(diploidAllele) - Static method in class net.maizegenetics.dna.snp.NucleotideAlignmentConstants
Return whether a simple DNA state (i.e. no indels or N). Heterozygous resolves to true also.
isAllPolymorphic() - Method in class net.maizegenetics.dna.snp.CombineGenotypeTable
 
isAllPolymorphic() - Method in class net.maizegenetics.dna.snp.CoreGenotypeTable
 
isAllPolymorphic() - Method in interface net.maizegenetics.dna.snp.genotypecall.GenotypeCallTable
Returns whether all sites are polymorphic.
isAllPolymorphic() - Method in interface net.maizegenetics.dna.snp.GenotypeTable
Returns whether all sites are polymorphic.
isAllPolymorphic() - Method in class net.maizegenetics.dna.snp.MergedGenotypeTable
 
isAllPolymorphic() - Method in class net.maizegenetics.dna.snp.TOPMGenotypeTable
 
isAncestor(possibleAncestor, node) - Static method in class net.maizegenetics.taxa.tree.NodeUtils
For two nodes in the tree true if the first node is the ancestor of the second
isAnnotatedWithValue(annoName, annoValue) - Method in interface net.maizegenetics.util.GeneralAnnotation
Returns whether the entity contains the annotation with the specified value. If either the annotation or the value is missing false is return
isAnnotatedWithValue(annoName, annoValue) - Method in class net.maizegenetics.util.GeneralAnnotationStorage
 
isB73HaplotypeA(a) - Static method in class net.maizegenetics.analysis.imputation.ImputationUtils
 
isBar() - Method in class net.maizegenetics.analysis.chart.ChartDisplayPlugin
 
isBlockSchematic() - Method in class net.maizegenetics.analysis.popgen.LinkageDiseqDisplayPlugin
 
isBoxWhisker() - Method in class net.maizegenetics.analysis.chart.ChartDisplayPlugin
 
isCanceled() - Method in class net.maizegenetics.gui.SelectFromAvailableDialog
 
isCaseSensitive() - Method in class net.maizegenetics.analysis.gbs.neobio.ScoringScheme
Tells whether this scoring scheme ignores the case of characters when computing their score.
isCellEditable(rowIndex, columnIndex) - Method in class net.maizegenetics.gui.AlignmentTableModel
Always returns false.
isCellEditable(rowIndex, columnIndex) - Method in class net.maizegenetics.gui.TableReportNoPagingTableModel
Always returns false.
isChromosomalView() - Method in class net.maizegenetics.analysis.popgen.LinkageDiseqDisplayPlugin
 
isColumnInnerLoop() - Method in interface net.maizegenetics.util.SuperByteMatrix
Returns true if the matrix stored for better performance when column loop inside row loop. False if matrix stored for better performance when row loop inside column loop.
isColumnInnerLoop() - Method in class net.maizegenetics.util.SuperByteMatrixMultiple
 
isColumnInnerLoop() - Method in class net.maizegenetics.util.SuperByteMatrixSingle
 
isColumnInnerLoop() - Method in class net.maizegenetics.util.SuperByteMatrixSingleValue
 
isColumnInnerLoop() - Method in class net.maizegenetics.util.SuperByteMatrixTranspose
 
isDoSlidingHaps() - Method in class net.maizegenetics.analysis.filter.FilterAlignmentPlugin
 
isEmpty() - Method in class net.maizegenetics.analysis.avro.GenericArrayPositions
 
isEmpty() - Method in class net.maizegenetics.analysis.avro.GenericArrayTaxa
 
isEmpty() - Method in class net.maizegenetics.analysis.avro.GenericMapAnnotations
 
isEmpty() - Method in class net.maizegenetics.analysis.rna.FindMatchByWordHash.Match
 
isEmpty() - Method in class net.maizegenetics.dna.snp.FilterList
 
isEmpty() - Method in class net.maizegenetics.plugindef.PluginParameter
 
isEmpty() - Method in interface net.maizegenetics.util.BitSet
Returns true if there are no set bits
isEmpty() - Method in class net.maizegenetics.util.OpenBitSet
Returns true if there are no set bits
isEmpty() - Method in class net.maizegenetics.util.UnmodifiableBitSet
 
isEqual(alleles1, alleles2) - Static method in class net.maizegenetics.dna.snp.GenotypeTableUtils
Returns whether two diploid allele values are equal ignoring order.
isEqual(diploidAllele1, diploidAllele2) - Static method in class net.maizegenetics.dna.snp.GenotypeTableUtils
Returns whether two diploid allele values are equal ignoring order.
isEqualOrUnknown(alleles1, alleles2) - Static method in class net.maizegenetics.dna.snp.GenotypeTableUtils
Returns whether two diploid allele values are equal ignoring order where unknown values equal anything.
isEqualOrUnknown(diploidAllele1, diploidAllele2) - Static method in class net.maizegenetics.dna.snp.GenotypeTableUtils
Returns whether two diploid allele values are equal ignoring order where unknown values equal anything.
isErrBar() - Method in class net.maizegenetics.analysis.chart.ChartDisplayPlugin
 
isExtractIndels() - Method in class net.maizegenetics.analysis.filter.FilterAlignmentPlugin
 
isFilterMinorSNPs() - Method in class net.maizegenetics.analysis.filter.FilterAlignmentPlugin
 
isFilterOutput() - Method in class net.maizegenetics.analysis.association.MLMPlugin
 
isFilterOutput() - Method in class net.maizegenetics.analysis.association.WeightedMLMPlugin
 
isFinal() - Method in class net.maizegenetics.analysis.phg.ParseGVCF.ProcessLines
 
isHDF5() - Method in class net.maizegenetics.dna.snp.GenotypeTableBuilder
 
isHDF5GenotypeLocked(reader) - Static method in class net.maizegenetics.util.HDF5Utils
 
isHDF5TagLocked(reader) - Static method in class net.maizegenetics.util.HDF5Utils
 
isHeader() - Method in class net.maizegenetics.analysis.phg.ParseGVCF.ProcessLines
 
isHeterozygous(taxon, site) - Method in class net.maizegenetics.dna.snp.CombineGenotypeTable
 
isHeterozygous(taxon, site) - Method in class net.maizegenetics.dna.snp.CoreGenotypeTable
 
isHeterozygous(taxon, site) - Method in interface net.maizegenetics.dna.snp.genotypecall.GenotypeCallTable
Returns whether allele values at given taxon and site are heterozygous. If two values returned by genotype() are different, this will return false.
isHeterozygous(taxon, site) - Method in interface net.maizegenetics.dna.snp.GenotypeTable
Returns whether allele values at given taxon and site are heterozygous. If two values returned by genotype() are different, this will return false.
isHeterozygous(diploidAllele) - Static method in class net.maizegenetics.dna.snp.GenotypeTableUtils
Returns whether diploid allele values are heterozygous. First 4 bits in byte is one allele value. Second 4 bits is other allele value.
isHeterozygous(taxon, site) - Method in class net.maizegenetics.dna.snp.MergedGenotypeTable
 
isHeterozygous(taxon, site) - Method in class net.maizegenetics.dna.snp.TOPMGenotypeTable
 
isHeterozygous(obs, site) - Method in class net.maizegenetics.phenotype.GenotypePhenotype
 
isHomozygous() - Method in class net.maizegenetics.analysis.phg.ParseGVCF.GVCFLine
 
isHomozygous(diploidAllele) - Static method in class net.maizegenetics.dna.snp.GenotypeTableUtils
Returns whether diploid allele values are homozygous. Unknown values return false.
isHomozygousACGT(diploidAllele) - Static method in class net.maizegenetics.dna.snp.NucleotideAlignmentConstants
Return whether a simple homozgyous DNA state (i.e. no indels or N).
isInbred() - Method in class net.maizegenetics.analysis.popgen.DonorHypoth
 
isInCurrentBlock(queryIndex) - Method in class net.maizegenetics.dna.tag.AbstractTagsHDF5
Return boolean value if an index belongs to current block
isIndel() - Method in class net.maizegenetics.dna.map.GeneralPosition
 
isIndel() - Method in interface net.maizegenetics.dna.map.Position
Whether the position includes indels, which would be defined in the variants
isIndel(site) - Method in interface net.maizegenetics.dna.map.PositionList
Returns whether give site is an indel.
isIndel(site) - Method in class net.maizegenetics.dna.snp.CombineGenotypeTable
 
isIndel(site) - Method in class net.maizegenetics.dna.snp.CoreGenotypeTable
 
isIndel(site) - Method in interface net.maizegenetics.dna.snp.GenotypeTable
Returns whether give site is an indel.
isIndel(site) - Method in class net.maizegenetics.dna.snp.MergedGenotypeTable
 
isIndel(site) - Method in class net.maizegenetics.dna.snp.TOPMGenotypeTable
 
isInteractive() - Method in class net.maizegenetics.plugindef.AbstractPlugin
If interactive = true, the plugin will create dialogs and panels to interacts with the user
isInteractive() - Method in interface net.maizegenetics.plugindef.Plugin
If interactive = true, the plugin will create dialogs and panels to interacts with the user
isLeaf() - Method in interface net.maizegenetics.taxa.tree.Node
check whether this node is an external node
isLeaf() - Method in class net.maizegenetics.taxa.tree.SimpleNode
check whether this node is an external node
isMasked(taxon, site) - Method in class net.maizegenetics.dna.snp.AbstractMaskMatrix
 
isMasked(taxon, site) - Method in class net.maizegenetics.dna.snp.MaskGenotypeMatrix
 
isMasked(taxon, site) - Method in class net.maizegenetics.dna.snp.MaskGenotypeStatsMatrix
 
isMergePossible() - Method in class net.maizegenetics.dna.snp.genotypecall.BasicGenotypeMergeRule
 
isMergePossible() - Method in interface net.maizegenetics.dna.snp.genotypecall.GenotypeMergeRule
Whether merge is even possible
isMergePossible() - Method in class net.maizegenetics.dna.snp.genotypecall.HighestDepthGenotypeMergeRule
 
isMergePossible() - Method in class net.maizegenetics.dna.snp.genotypecall.SetToNGenotypeMergeRule
 
isMissing(obs) - Method in class net.maizegenetics.phenotype.CategoricalAttribute
 
isMissing(obs, attrnum) - Method in class net.maizegenetics.phenotype.CorePhenotype
 
isMissing(obs, attrnum) - Method in class net.maizegenetics.phenotype.FilterPhenotype
 
isMissing(obs) - Method in class net.maizegenetics.phenotype.NumericAttribute
 
isMissing(obs, attrnum) - Method in interface net.maizegenetics.phenotype.Phenotype
 
isMissing(obs) - Method in interface net.maizegenetics.phenotype.PhenotypeAttribute
 
isMissing(obs) - Method in class net.maizegenetics.phenotype.TaxaAttribute
 
isMonomorphic(probs) - Static method in class net.maizegenetics.analysis.association.AssociationUtils
 
isNested(nested) - Method in class net.maizegenetics.analysis.modelfitter.StepwiseAdditiveModelFitter
 
isNested() - Method in class net.maizegenetics.analysis.modelfitter.StepwiseAdditiveModelFitterPlugin
Should SNPs/markers be nested within a factor, such as family?
isNested(value) - Method in class net.maizegenetics.analysis.modelfitter.StepwiseAdditiveModelFitterPlugin
Set Is Nested. Should SNPs/markers be nested within a factor, such as family?
isNucleotide() - Method in class net.maizegenetics.dna.map.GeneralPosition
 
isNucleotide() - Method in interface net.maizegenetics.dna.map.Position
Whether the position is a nucleotide position or another marker type (SSR, AFLP, RAPD, CNV, which are recoded with text states)
isNucleotideEncodings(alleleStates) - Static method in class net.maizegenetics.dna.snp.NucleotideAlignmentConstants
Returns whether given allele encodings are for Nucleotide Data.
isOkayChecked() - Method in class net.maizegenetics.gui.ReportDestinationDialog
 
isPartiallyEqual(genotype1, genotype2) - Static method in class net.maizegenetics.dna.snp.GenotypeTableUtils
Return true if either at least one allele agree
isPartialMatchSupported() - Method in class net.maizegenetics.analysis.gbs.neobio.BasicScoringScheme
Tells whether this scoring scheme supports partial matches, which it does not.
isPartialMatchSupported() - Method in class net.maizegenetics.analysis.gbs.neobio.ScoringMatrix
Tells whether this scoring scheme supports partial matches, which it does, although a particular scoring matrix loaded by this instace might not. A partial match is a situation when two characters are not equal but, for any reason, are regarded as similar by this scoring scheme, which then returns a positive score value. This is common for amino acid scoring matrices.
isPartialMatchSupported() - Method in class net.maizegenetics.analysis.gbs.neobio.ScoringScheme
Returns true if this scoring scheme supports partial matches, false otherwise. A partial match is a situation when two characters are not equal but, for any reason, are regarded as similar by this scoring scheme, which then returns a positive score. This is common when for scoring schemes that implement amino acid scoring matrices.
isPAV(index) - Method in class net.maizegenetics.dna.map.TagsOnGeneticMap
Return if this tag is a PAV
isPermutationNumber() - Method in class net.maizegenetics.analysis.popgen.LinkageDisequilibriumPlugin
 
isPhased() - Method in class net.maizegenetics.dna.snp.CombineGenotypeTable
 
isPhased() - Method in class net.maizegenetics.dna.snp.CoreGenotypeTable
 
isPhased() - Method in interface net.maizegenetics.dna.snp.genotypecall.GenotypeCallTable
Returns whether this alignment is phased.
isPhased(isPhased) - Method in class net.maizegenetics.dna.snp.genotypecall.GenotypeCallTableBuilder
 
isPhased() - Method in interface net.maizegenetics.dna.snp.GenotypeTable
Returns whether this genotype table is phased.
isPhased() - Method in class net.maizegenetics.dna.snp.MergedGenotypeTable
 
isPhased() - Method in class net.maizegenetics.dna.snp.TOPMGenotypeTable
 
isPhysicalPosition() - Method in class net.maizegenetics.gui.AlignmentTableModel
 
isPlugin(className) - Static method in interface net.maizegenetics.plugindef.Plugin
Returns whether given class name is Plugin.
isPluginParameter(key) - Method in class net.maizegenetics.plugindef.AbstractPlugin
 
isPolymorphic(site) - Method in class net.maizegenetics.dna.snp.CombineGenotypeTable
 
isPolymorphic(site) - Method in class net.maizegenetics.dna.snp.CoreGenotypeTable
 
isPolymorphic(site) - Method in interface net.maizegenetics.dna.snp.genotypecall.GenotypeCallTable
Return whether given site is polymorphic.
isPolymorphic(site) - Method in interface net.maizegenetics.dna.snp.GenotypeTable
Return whether given site is polymorphic.
isPolymorphic(site) - Method in class net.maizegenetics.dna.snp.MergedGenotypeTable
 
isPolymorphic(site) - Method in class net.maizegenetics.dna.snp.TOPMGenotypeTable
 
isPositiveStrand(site) - Method in interface net.maizegenetics.dna.map.PositionList
Return whether is positive strand at given site.
isPositiveStrand(site) - Method in class net.maizegenetics.dna.snp.CombineGenotypeTable
 
isPositiveStrand(site) - Method in class net.maizegenetics.dna.snp.CoreGenotypeTable
 
isPositiveStrand(site) - Method in interface net.maizegenetics.dna.snp.GenotypeTable
Return whether is positive strand at given site.
isPositiveStrand(site) - Method in class net.maizegenetics.dna.snp.MergedGenotypeTable
 
isPositiveStrand(site) - Method in class net.maizegenetics.dna.snp.TOPMGenotypeTable
 
isPowerOfTwo(v) - Static method in class net.maizegenetics.util.BitUtil
returns true if v is a power of two or zero
isPowerOfTwo(v) - Static method in class net.maizegenetics.util.BitUtil
returns true if v is a power of two or zero
isPresent() - Method in class net.maizegenetics.analysis.rna.FindMatchByWordHash.Match
 
isRapidAnalysis() - Method in class net.maizegenetics.analysis.popgen.LinkageDisequilibriumPlugin
 
isReference() - Method in class net.maizegenetics.dna.tag.AbstractTag
 
isReference() - Method in interface net.maizegenetics.dna.tag.Tag
 
isReferenceBlock() - Method in class net.maizegenetics.analysis.phg.ParseGVCF.GVCFLine
Returns whether this line specifies a range of positions that match the reference.
isRegression() - Method in class net.maizegenetics.analysis.chart.ChartDisplayPlugin
 
isRoot() - Method in interface net.maizegenetics.taxa.tree.Node
check whether this node is a root node
isRoot() - Method in class net.maizegenetics.taxa.tree.SimpleNode
check whether this node is a root node
isSame(s1, s2) - Static method in class net.maizegenetics.taxa.tree.CladeSystem
checks whether two clades are identical (assuming they are of the same length and use the same leaf order)
isSame(s1, s2) - Static method in class net.maizegenetics.taxa.tree.SplitUtils
checks whether two splits are identical (assuming they are of the same length and use the same leaf order)
isSingular(column) - Method in class net.maizegenetics.stats.linearmodels.SweepFast
 
isSiteMaskedHint(site) - Method in class net.maizegenetics.dna.snp.AbstractMaskMatrix
 
isSiteMaskedHint(site) - Method in interface net.maizegenetics.dna.snp.MaskMatrix
Returns false if specified site is definitely not masked. Otherwise returns true. A true returned doesn't necessarily mean this site is masked. This can be used to optimize performance of masked genotype table components. If false returned, checking for masking can be skipped.
isSiteMaskedHint(site) - Method in class net.maizegenetics.dna.snp.MaskSiteMatrix
Returns false if specified site is definitely not masked. Otherwise returns true. A true returned doesn't necessarily mean this site is masked. This can be used to optimize performance of masked genotype table components. If false returned, checking for masking can be skipped.
isSiteMaskedHint(site) - Method in class net.maizegenetics.dna.snp.MaskTaxaMatrix
Returns false if specified site is definitely not masked. Otherwise returns true. A true returned doesn't necessarily mean this site is masked. This can be used to optimize performance of masked genotype table components. If false returned, checking for masking can be skipped.
isSiteOptimized() - Method in class net.maizegenetics.dna.snp.AbstractMaskMatrix
 
isSiteOptimized() - Method in class net.maizegenetics.dna.snp.genotypecall.CombineGenotypeCallTable
 
isSiteOptimized() - Method in class net.maizegenetics.dna.snp.genotypecall.DifferenceGenotypeCallTable
 
isSiteOptimized() - Method in interface net.maizegenetics.dna.snp.genotypecall.GenotypeCallTable
This returns true if this Genotype performs better when processing whole sites at a time. Return false if performance is better when processing whole taxa.
isSiteOptimized() - Method in class net.maizegenetics.dna.snp.genotypecall.GOBIIAvroGenotypeCallTable
 
isSiteOptimized() - Method in class net.maizegenetics.dna.snp.genotypecall.GOBIIGenotypeCallTable
 
isSiteOptimized() - Method in class net.maizegenetics.dna.snp.genotypecall.HybridGenotypeCallTable
 
isSiteOptimized() - Method in class net.maizegenetics.dna.snp.genotypecall.LineIndexHapmapGenotypeCallTable
 
isSiteOptimized() - Method in class net.maizegenetics.dna.snp.genotypecall.MaskGenotypeCallTable
 
isSiteOptimized() - Method in class net.maizegenetics.dna.snp.genotypecall.MergedGenotypeCallTable
 
isSiteOptimized() - Method in class net.maizegenetics.dna.snp.genotypecall.ProjectionGenotypeCallTable
 
isSiteOptimized() - Method in interface net.maizegenetics.dna.snp.MaskMatrix
 
isSiteOptimized() - Method in class net.maizegenetics.dna.snp.MaskSiteMatrix
 
isSiteOptimized() - Method in class net.maizegenetics.dna.snp.MaskTaxaMatrix
 
isSlidingWindowAnalysis() - Method in class net.maizegenetics.analysis.popgen.SequenceDiversityPlugin
Whether this is sliding window analysis
isSlidingWindowAnalysis(value) - Method in class net.maizegenetics.analysis.popgen.SequenceDiversityPlugin
Set Sliding Window Analysis. Whether this is sliding window analysis
isSNP(taxon, site) - Method in class net.maizegenetics.dna.snp.TOPMGenotypeTable
 
isSymmetric() - Method in class net.maizegenetics.matrixalgebra.decomposition.EJMLEigenvalueDecomposition
 
isSymmetric() - Method in class net.maizegenetics.taxa.distance.DistanceMatrix
test whether this matrix is a symmetric distance matrix
isTASSEL4HDF5Format(reader) - Static method in class net.maizegenetics.util.HDF5Utils
 
isTaxaLocked(reader) - Static method in class net.maizegenetics.util.HDF5Utils
 
isTaxonMaskedHint(taxon) - Method in class net.maizegenetics.dna.snp.AbstractMaskMatrix
 
isTaxonMaskedHint(taxon) - Method in interface net.maizegenetics.dna.snp.MaskMatrix
Returns false if specified taxon is definitely not masked. Otherwise returns true. A true returned doesn't necessarily mean this taxon is masked. This can be used to optimize performance of masked genotype table components. If false returned, checking for masking can be skipped.
isTaxonMaskedHint(taxon) - Method in class net.maizegenetics.dna.snp.MaskSiteMatrix
Returns false if specified taxon is definitely not masked. Otherwise returns true. A true returned doesn't necessarily mean this taxon is masked. This can be used to optimize performance of masked genotype table components. If false returned, checking for masking can be skipped.
isTaxonMaskedHint(taxon) - Method in class net.maizegenetics.dna.snp.MaskTaxaMatrix
Returns false if specified taxon is definitely not masked. Otherwise returns true. A true returned doesn't necessarily mean this taxon is masked. This can be used to optimize performance of masked genotype table components. If false returned, checking for masking can be skipped.
isTypeCompatible(type) - Method in class net.maizegenetics.phenotype.CategoricalAttribute
 
isTypeCompatible(type) - Method in class net.maizegenetics.phenotype.NumericAttribute
 
isTypeCompatible(type) - Method in interface net.maizegenetics.phenotype.PhenotypeAttribute
 
isTypeCompatible(type) - Method in class net.maizegenetics.phenotype.TaxaAttribute
 
isUniqueRef() - Method in class net.maizegenetics.dna.map.TagGWASMapInfo
 
isUseAllSiteTypes() - Method in class net.maizegenetics.analysis.filter.FilterAlignmentPlugin
 
isUseGenotype() - Method in class net.maizegenetics.analysis.association.MLMPlugin
 
isUseGenotype() - Method in class net.maizegenetics.analysis.association.WeightedMLMPlugin
 
isUseP3D() - Method in class net.maizegenetics.analysis.association.MLMPlugin
 
isUseP3D() - Method in class net.maizegenetics.analysis.association.WeightedMLMPlugin
 
isUseRefProb() - Method in class net.maizegenetics.analysis.association.MLMPlugin
 
isUseRefProb() - Method in class net.maizegenetics.analysis.association.WeightedMLMPlugin
 
isWriteOutputToFile() - Method in class net.maizegenetics.analysis.association.MLMPlugin
 
isWriteOutputToFile() - Method in class net.maizegenetics.analysis.association.WeightedMLMPlugin
 
iterator() - Method in class net.maizegenetics.analysis.avro.GenericArrayPositions
 
iterator() - Method in class net.maizegenetics.analysis.avro.GenericArrayTaxa
 
iterator() - Method in class net.maizegenetics.dna.snp.FilterList
 
iterator() - Method in class net.maizegenetics.util.UndirectedGraph.UndirectedSet
 

J

jarFiles() - Method in class net.maizegenetics.analysis.ListPluginParameters
List of jar files.
jarFiles(value) - Method in class net.maizegenetics.analysis.ListPluginParameters
Set Name List. List of jar files.
joinChilds(node, n1, n2) - Static method in class net.maizegenetics.taxa.tree.NodeUtils
join two childs, introducing a new node/branch in the tree that replaces the first child
JSONUtils - Class in net.maizegenetics.dna.snp.io
 

K

K - Variable in class net.maizegenetics.stats.EMMA.EMMAforDoubleMatrix
 
keepAttributes(attributesToKeep) - Method in class net.maizegenetics.phenotype.PhenotypeBuilder
 
keepAttributes(indexOfAttributes) - Method in class net.maizegenetics.phenotype.PhenotypeBuilder
 
keepDepth() - Method in class net.maizegenetics.analysis.data.ExportPlugin
Whether to keep depth if format supports depth.
keepDepth(value) - Method in class net.maizegenetics.analysis.data.ExportPlugin
Set Keep Depth. Whether to keep depth if format supports depth.
keepDepth() - Method in class net.maizegenetics.analysis.data.FileLoadPlugin
Whether to keep depth if that's possible.
keepDepth(value) - Method in class net.maizegenetics.analysis.data.FileLoadPlugin
Set Keep Depth. Whether to keep depth if that's possible.
keepDepth() - Method in class net.maizegenetics.dna.snp.io.BuilderFromVCF
 
keepDepth(keep) - Method in class net.maizegenetics.dna.snp.io.BuilderFromVCFUsingHTSJDK
 
keepGenotypesOpen() - Method in class net.maizegenetics.analysis.gbs.ProductionSNPCallerPlugin
Keep hdf5 genotypes open for future runs that add more taxa or more depth
keepGenotypesOpen(value) - Method in class net.maizegenetics.analysis.gbs.ProductionSNPCallerPlugin
Set Keep Genotypes Open. Keep hdf5 genotypes open for future runs that add more taxa or more depth
keepGenotypesOpen() - Method in class net.maizegenetics.analysis.gbs.v2.ProductionSNPCallerPluginV2
Keep hdf5 genotypes open for future runs that add more taxa or more depth
keepGenotypesOpen(value) - Method in class net.maizegenetics.analysis.gbs.v2.ProductionSNPCallerPluginV2
Set Keep Genotypes Open. Keep hdf5 genotypes open for future runs that add more taxa or more depth
keepIndex(index) - Method in class net.maizegenetics.dna.snp.TranslateIndexBuilder
Keep specified index.
keepIndices(start, end) - Method in class net.maizegenetics.dna.snp.TranslateIndexBuilder
Keeps a range of indices from start (inclusive) to end (inclusive)
keepIndices(indices) - Method in class net.maizegenetics.dna.snp.TranslateIndexBuilder
 
keepSitesChrPos(input, chromosome, position) - Static method in class net.maizegenetics.dna.snp.GenotypeTableUtils
 
KeepSpecifiedReadsinFastqPlugin - Class in net.maizegenetics.analysis.gbs
 
KeepSpecifiedReadsinFastqPlugin(parentFrame) - Constructor for class net.maizegenetics.analysis.gbs.KeepSpecifiedReadsinFastqPlugin
 
KeepSpecifiedSitesInTOPMPlugin - Class in net.maizegenetics.analysis.gbs
 
KeepSpecifiedSitesInTOPMPlugin(parentFrame) - Constructor for class net.maizegenetics.analysis.gbs.KeepSpecifiedSitesInTOPMPlugin
 
keepTaxa(taxaToKeep) - Method in class net.maizegenetics.phenotype.PhenotypeBuilder
 
keepTaxa(parent, taxaToKeep) - Static method in class net.maizegenetics.taxa.distance.DistanceMatrixUtils
 
keepTaxa(parent, taxaToKeep) - Static method in class net.maizegenetics.taxa.distance.DistanceMatrixUtils
 
keepTempGenotypes() - Method in class net.maizegenetics.analysis.imputation.ReImputeUpdatedTaxaByFILLINPlugin
Keep the temporary hdf5 genotype files generated by this plugin (raw and imputed) rather than deleting them
keepTempGenotypes(value) - Method in class net.maizegenetics.analysis.imputation.ReImputeUpdatedTaxaByFILLINPlugin
Set Keep Temp Genotypes. Keep the temporary hdf5 genotype files generated by this plugin (raw and imputed) rather than deleting them
keyFile(value) - Method in class net.maizegenetics.analysis.gbs.FastqToTagCountPlugin
 
keyFile() - Method in class net.maizegenetics.analysis.gbs.FastqToTagCountPlugin
 
keyFile() - Method in class net.maizegenetics.analysis.gbs.ProductionSNPCallerPlugin
Key file listing barcodes distinguishing the samples
keyFile(value) - Method in class net.maizegenetics.analysis.gbs.ProductionSNPCallerPlugin
Set Key File. Key file listing barcodes distinguishing the samples
keyFile() - Method in class net.maizegenetics.analysis.gbs.repgen.RepGenLoadSeqToDBPlugin
Key file listing barcodes distinguishing the samples
keyFile(value) - Method in class net.maizegenetics.analysis.gbs.repgen.RepGenLoadSeqToDBPlugin
Set Key File. Key file listing barcodes distinguishing the samples
keyFile() - Method in class net.maizegenetics.analysis.gbs.repgen.RGBSProductionSNPCallerPlugin
Key file listing barcodes distinguishing the samples
keyFile(value) - Method in class net.maizegenetics.analysis.gbs.repgen.RGBSProductionSNPCallerPlugin
Set Key File. Key file listing barcodes distinguishing the samples
keyFile() - Method in class net.maizegenetics.analysis.gbs.SeqToTBTHDF5Plugin
Barcode key file
keyFile(value) - Method in class net.maizegenetics.analysis.gbs.SeqToTBTHDF5Plugin
Set Key File. Barcode key file
keyFile() - Method in class net.maizegenetics.analysis.gbs.v2.GBSSeqToTagDBPlugin
Key file listing barcodes distinguishing the samples
keyFile(value) - Method in class net.maizegenetics.analysis.gbs.v2.GBSSeqToTagDBPlugin
Set Key File. Key file listing barcodes distinguishing the samples
keyFile() - Method in class net.maizegenetics.analysis.gbs.v2.ProductionSNPCallerPluginV2
Key file listing barcodes distinguishing the samples
keyFile(value) - Method in class net.maizegenetics.analysis.gbs.v2.ProductionSNPCallerPluginV2
Set Key File. Key file listing barcodes distinguishing the samples
keyFile() - Method in class net.maizegenetics.analysis.rna.RNADeMultiplexProductionPlugin
Key file listing barcodes distinguishing the samples
keyFile(value) - Method in class net.maizegenetics.analysis.rna.RNADeMultiplexProductionPlugin
Set Key File. Key file listing barcodes distinguishing the samples
keyFile() - Method in class net.maizegenetics.analysis.rna.RNADeMultiPlexSeqToDBPlugin
Key file listing barcodes distinguishing the samples
keyFile(value) - Method in class net.maizegenetics.analysis.rna.RNADeMultiPlexSeqToDBPlugin
Set Key File. Key file listing barcodes distinguishing the samples
keyFile() - Method in class net.maizegenetics.util.ConvertOldFastqToModernFormatPlugin
Key file listing barcodes distinguishing the samples
keyFile(value) - Method in class net.maizegenetics.util.ConvertOldFastqToModernFormatPlugin
Set Key File. Key file listing barcodes distinguishing the samples
keyFileReturnChromInt(chromosome) - Static method in class net.maizegenetics.analysis.gbs.v2.DiscoverySNPCallerPluginV2
GIven a chromosome string value, search for it's corresponding number from the keyFileStringToInt map
keys() - Static method in class net.maizegenetics.plugindef.ParameterCache
 
keySet() - Method in class net.maizegenetics.analysis.avro.GenericMapAnnotations
 
kFolds() - Method in class net.maizegenetics.analysis.association.GenomicSelectionPlugin
Number of folds to use for k-fold cross-validation (default = 5)
kFolds(value) - Method in class net.maizegenetics.analysis.association.GenomicSelectionPlugin
Set Number of folds. Number of folds to use for k-fold cross-validation (default = 5)
Kinship - Class in net.maizegenetics.analysis.distance
Deprecated. 
Kinship.KINSHIP_TYPE - Enum in net.maizegenetics.analysis.distance
Deprecated.
 
kinshipMatrix - Variable in class net.maizegenetics.analysis.association.CompressedDoubleMatrix
 
kinshipMatrix - Variable in class net.maizegenetics.analysis.association.MLMPlugin
 
kinshipMatrix - Variable in class net.maizegenetics.analysis.association.WeightedMLMPlugin
 
kinshipMethod() - Method in class net.maizegenetics.analysis.distance.KinshipPlugin
The scaled_IBS method produces a kinship matrix that is scaled to give a reasonable estimate of additive genetic variance. The pairwise_IBS method, which is the method used by TASSEL ver.4, may result in an inflated estimate of genetic variance. Either will do a good job of controlling population structure in MLM. The pedigree method is used to calculate a kinship matrix from a pedigree information.
kinshipMethod(value) - Method in class net.maizegenetics.analysis.distance.KinshipPlugin
Set Kinship method. The scaled_IBS method produces a kinship matrix that is scaled to give a reasonable estimate of additive genetic variance. The pairwise_IBS method, which is the method used by TASSEL ver.4, may result in an inflated estimate of genetic variance. Either will do a good job of controlling population structure in MLM. The pedigree method is used to calculate a kinship matrix from a pedigree information.
KinshipPlugin - Class in net.maizegenetics.analysis.distance
 
KinshipPlugin(parentFrame, isInteractive) - Constructor for class net.maizegenetics.analysis.distance.KinshipPlugin
 
KinshipPlugin.ALGORITHM_VARIATION - Enum in net.maizegenetics.analysis.distance
 
KinshipPlugin.KINSHIP_METHOD - Enum in net.maizegenetics.analysis.distance
 
KmerCountingPlugin - Class in net.maizegenetics.analysis.data
 
KmerCountingPlugin(parentFrame, isInteractive) - Constructor for class net.maizegenetics.analysis.data.KmerCountingPlugin
 
KmerCountingPlugin() - Constructor for class net.maizegenetics.analysis.data.KmerCountingPlugin
 
KmerCountingPluginKt - Class in net.maizegenetics.analysis.data
 
kmerLen() - Method in class net.maizegenetics.analysis.gbs.repgen.RepGenAlignerPlugin
Length of kmers as tag sequences in the db
kmerLen(value) - Method in class net.maizegenetics.analysis.gbs.repgen.RepGenAlignerPlugin
Set Kmer length. Length of kmers to be stored as tag sequences in the db
kmerLen() - Method in class net.maizegenetics.analysis.gbs.repgen.RepGenPhase2AlignerPlugin
Length of kmers as tag sequences in the db
kmerLen(value) - Method in class net.maizegenetics.analysis.gbs.repgen.RepGenPhase2AlignerPlugin
Set Kmer length. Length of kmers to be stored as tag sequences in the db
kmerLength() - Method in class net.maizegenetics.analysis.data.KmerCountingPlugin
 
kmerLength() - Method in class net.maizegenetics.analysis.gbs.repgen.RepGenLoadSeqToDBPlugin
Maximum Tag Length
kmerLength(value) - Method in class net.maizegenetics.analysis.gbs.repgen.RepGenLoadSeqToDBPlugin
Set Maximum Tag Length. Maximum Tag Length
kmerLength() - Method in class net.maizegenetics.analysis.gbs.repgen.RGBSProductionSNPCallerPlugin
Maximum Tag Length
kmerLength(value) - Method in class net.maizegenetics.analysis.gbs.repgen.RGBSProductionSNPCallerPlugin
Set Maximum Tag Length: User should set this value equivalent to what was used in GBSSeqToTagDBPlugin for maximum tag length when creating the database. If the two values are not equal inconsistent results may occur.
kmerLength() - Method in class net.maizegenetics.analysis.gbs.v2.GBSSeqToTagDBPlugin
Maximum Tag Length
kmerLength(value) - Method in class net.maizegenetics.analysis.gbs.v2.GBSSeqToTagDBPlugin
Set Maximum Tag Length. Maximum Tag Length
kmerLength() - Method in class net.maizegenetics.analysis.gbs.v2.ProductionSNPCallerPluginV2
Maximum Tag Length
kmerLength(value) - Method in class net.maizegenetics.analysis.gbs.v2.ProductionSNPCallerPluginV2
Set Maximum Tag Length: User should set this value equivalent to what was used in GBSSeqToTagDBPlugin for maximum tag length when creating the database. If the two values are not equal inconsistent results may occur.
KmerToTagCountPlugin - Class in net.maizegenetics.analysis.gbs
Derives a tagCount list for each fastq file in the input directory. Keeps only good reads having a barcode and a cut site and no N's in the useful part of the sequence. Trims off the barcodes and truncates sequences that (1) have a second cut site, or (2) read into the common adapter.
KmerToTagCountPlugin() - Constructor for class net.maizegenetics.analysis.gbs.KmerToTagCountPlugin
 
KmerToTagCountPlugin(parentFrame) - Constructor for class net.maizegenetics.analysis.gbs.KmerToTagCountPlugin
 
KmerToTBTPlugin - Class in net.maizegenetics.analysis.gbs
This pipeline converts a series of fastq files to TagsByTaxa files (one per fastq file). It requires a list of existing tags (Tags object), which may come from a TagCounts file or TOPM file.
KmerToTBTPlugin() - Constructor for class net.maizegenetics.analysis.gbs.KmerToTBTPlugin
 
KmerToTBTPlugin(parentFrame) - Constructor for class net.maizegenetics.analysis.gbs.KmerToTBTPlugin
 
KNearestNeighbor(data, row, k, isManhattan) - Static method in class net.maizegenetics.analysis.numericaltransform.kNearestNeighbors
Rank the rows based on their distance from the given row.
kNearestNeighbors - Class in net.maizegenetics.analysis.numericaltransform
Imputation of the missing data by k-nearest neighbors.
knerLength(value) - Method in class net.maizegenetics.analysis.data.KmerCountingPlugin
 
knnTaxa() - Method in class net.maizegenetics.analysis.imputation.LDKNNiImputationHetV2Plugin
Number of neighbors to use in imputation
knnTaxa(value) - Method in class net.maizegenetics.analysis.imputation.LDKNNiImputationHetV2Plugin
Set Number of nearest neighbors. Number of neighbors to use in imputation
knnTaxa() - Method in class net.maizegenetics.analysis.imputation.LDKNNiImputationHetV3Plugin
Number of neighbors to use in imputation
knnTaxa(value) - Method in class net.maizegenetics.analysis.imputation.LDKNNiImputationHetV3Plugin
Set Number of nearest neighbors. Number of neighbors to use in imputation
knnTaxa() - Method in class net.maizegenetics.analysis.imputation.LDKNNiImputationPlugin
Maximum number of neighbours to use in imputation
knnTaxa(value) - Method in class net.maizegenetics.analysis.imputation.LDKNNiImputationPlugin
Set Number of nearest neighbors. Maximum number of neighbours to use in imputation
knownVariants(val) - Method in class net.maizegenetics.dna.map.GeneralPosition.Builder
Set text definition of variants (default=null)
knownVariants(val) - Method in class net.maizegenetics.dna.map.GeneralPosition.Builder
Set text definition of variants (default=null)

L

label(obs) - Method in class net.maizegenetics.phenotype.CategoricalAttribute
 
labelList() - Method in class net.maizegenetics.phenotype.CategoricalAttribute
 
LabelMapping - Class in net.maizegenetics.taxa.tree
 
lambda - Variable in class net.maizegenetics.stats.EMMA.EMMAforDoubleMatrix
 
LambdaTuplesContext - Class in net.maizegenetics.util.db
Created with IntelliJ IDEA. User: julian3 Date: 2013/11/10 Time: 7:13 PM PROJECT: ${PROJECT} DESCRIPTION: Code Borrowed from http://java.dzone.com/articles/adding-java-8-lambda-goodness Original package can be downloaded from https://github.com/jexenberger/lambda-tuples
laneField - Static variable in class net.maizegenetics.analysis.gbs.v2.GBSUtils
 
laneField - Static variable in class net.maizegenetics.util.ConvertOldFastqToModernFormatPlugin
 
lastIndexOf(o) - Method in class net.maizegenetics.analysis.avro.GenericArrayPositions
 
lastIndexOf(o) - Method in class net.maizegenetics.analysis.avro.GenericArrayTaxa
 
lastIndexOf(o) - Method in class net.maizegenetics.dna.snp.FilterList
 
LatitudeKey - Static variable in class net.maizegenetics.taxa.Taxon
Standard key for the latitude the taxon was sampled
layoutCL(label, fontMetrics, text, icon, viewR, iconR, textR) - Method in class net.maizegenetics.gui.VerticalLabelUI
 
lc - Variable in class net.maizegenetics.analysis.gbs.neobio.OutMatrix
The number of columns of the block.
LD_BINS - Static variable in class net.maizegenetics.dna.snp.HapMapHDF5Constants
 
LD_DESC - Static variable in class net.maizegenetics.dna.snp.HapMapHDF5Constants
 
ldakCommand() - Method in class net.maizegenetics.analysis.distance.VCAPScanPlugin
Ldak Command
ldakCommand(value) - Method in class net.maizegenetics.analysis.distance.VCAPScanPlugin
Set Ldak Command. Ldak Command
ldfilter(a, window, minR, filterBits) - Static method in class net.maizegenetics.analysis.imputation.NucleotideImputationUtils
 
LDKNNiImputationHetV2Plugin - Class in net.maizegenetics.analysis.imputation
This imputation algorithm uses LD to identify good predictors for each SNP, and then uses the high LD SNPs to identify K- Nearest Neighbors. The genotype is called with a weighted mode of the KNNs.
LDKNNiImputationHetV2Plugin() - Constructor for class net.maizegenetics.analysis.imputation.LDKNNiImputationHetV2Plugin
 
LDKNNiImputationHetV2Plugin(parentFrame, isInteractive) - Constructor for class net.maizegenetics.analysis.imputation.LDKNNiImputationHetV2Plugin
 
LDKNNiImputationHetV3Plugin - Class in net.maizegenetics.analysis.imputation
This imputation algorithm uses LD to identify good predictors for each SNP, and then uses the high LD SNPs to identify K- Nearest Neighbors. The genotype is called with a weighted mode of the KNNs.
LDKNNiImputationHetV3Plugin() - Constructor for class net.maizegenetics.analysis.imputation.LDKNNiImputationHetV3Plugin
 
LDKNNiImputationHetV3Plugin(parentFrame, isInteractive) - Constructor for class net.maizegenetics.analysis.imputation.LDKNNiImputationHetV3Plugin
 
LDKNNiImputationPlugin - Class in net.maizegenetics.analysis.imputation
This imputation algorithm uses LD to identify good predictors for each SNP, and then uses the high LD SNPs to identify K- Nearest Neighbors. The genotype is called with a weighted mode of the KNNs.
LDKNNiImputationPlugin() - Constructor for class net.maizegenetics.analysis.imputation.LDKNNiImputationPlugin
 
LDKNNiImputationPlugin(parentFrame, isInteractive) - Constructor for class net.maizegenetics.analysis.imputation.LDKNNiImputationPlugin
 
LDMinDist_DESC - Static variable in class net.maizegenetics.dna.snp.HapMapHDF5Constants
 
LDP_DESC - Static variable in class net.maizegenetics.dna.snp.HapMapHDF5Constants
 
LDPropLD_DESC - Static variable in class net.maizegenetics.dna.snp.HapMapHDF5Constants
 
LDR2_DESC - Static variable in class net.maizegenetics.dna.snp.HapMapHDF5Constants
 
LDResult - Class in net.maizegenetics.analysis.popgen
Container class for reporting LD results. This class could still be expanded to include the two sites with various sort approaches. The reason for this functionality is so that classes can calculate LD for billions of site pairs, but only retain the most significant.
LDResult(site1, site2, r2, dprime, p, n) - Constructor for class net.maizegenetics.analysis.popgen.LDResult
 
LDResult.Builder - Class in net.maizegenetics.analysis.popgen
 
ldResultFile() - Method in class net.maizegenetics.analysis.data.MeanR2FromLDPlugin
LD Output File.
ldResultFile(value) - Method in class net.maizegenetics.analysis.data.MeanR2FromLDPlugin
Set Ld Result File. LD Output File.
LEFT_DIRECTION - Static variable in class net.maizegenetics.analysis.gbs.neobio.CrochemoreLandauZivUkelson
A constant that indicates that the left direction must be followed to reach the source of an optimal path in a block during the trace back procedure to retrieve a high scoring alignment.
length() - Method in class net.maizegenetics.analysis.gbs.neobio.CharSequence
Returns the number of characters of this sequence.
length - Variable in class net.maizegenetics.analysis.gbs.neobio.Factor
The number of characters of the text represented by this factor.
length() - Method in class net.maizegenetics.analysis.gbs.neobio.Factor
Returns this factor's length.
lengths2Heights(root) - Static method in class net.maizegenetics.taxa.tree.NodeUtils
Converts lengths to heights, *without* assuming contemporaneous tips.
lengths2HeightsContemp() - Method in class net.maizegenetics.taxa.tree.SimpleNode
determines the height of this node and its descendants from branch lengths, assuming contemporaneous tips.
lengths2HeightsKeepTips(node, useMax) - Static method in class net.maizegenetics.taxa.tree.NodeUtils
Converts lengths to heights, but maintains tip heights.
Level - Interface in net.maizegenetics.stats.linearmodels
Created using IntelliJ IDEA. Author: Peter Bradbury Date: Dec 29, 2004 Time: 9:33:56 AM
LevenshteinDistance(s, t) - Static method in class net.maizegenetics.analysis.rna.FindMatchByWordHash
 
LikelihoodRatioTest - Class in net.maizegenetics.stats.statistics
Likelihood ratio test based on chi-square statistics
likelyReadEnd - Static variable in class net.maizegenetics.analysis.gbs.ParseBarcodeRead
 
likelyReadEnd - Variable in class net.maizegenetics.analysis.gbs.v2.EnzymeList.Enzyme
 
likelyReadEnd() - Method in class net.maizegenetics.analysis.gbs.v2.EnzymeList.Enzyme
Deprecated. 
likelyReadEnd() - Method in class net.maizegenetics.analysis.gbs.v2.GBSEnzyme
Deprecated.
 
limitNumberOfComponentsBy() - Method in class net.maizegenetics.analysis.data.PrincipalComponentsPlugin
This parameter determines the type of value that will be used to limit the number of principal components (axes) returned. The possible choices are number_of_components, min_eigenvalue, and total_variance.
limitNumberOfComponentsBy(value) - Method in class net.maizegenetics.analysis.data.PrincipalComponentsPlugin
Set limit number of components by. This parameter determines the type of value that will be used to limit the number of principal components (axes) returned. The possible choices are number_of_components, min_eigenvalue, and total_variance.
LINE_INDEX_FILE_EXTENSION - Static variable in class net.maizegenetics.dna.snp.io.LineIndexBuilder
 
LinearModelForStepwiseRegression - Class in net.maizegenetics.stats.linearmodels
 
LinearModelForStepwiseRegression(requiredEffects, data) - Constructor for class net.maizegenetics.stats.linearmodels.LinearModelForStepwiseRegression
 
LinearModelUtils - Class in net.maizegenetics.stats.linearmodels
 
LineIndex - Class in net.maizegenetics.dna.snp.io
 
LineIndex(magic, commentChar, numHeaderLinesToSkip, numLinesPerInterval, virtualFileOffsets) - Constructor for class net.maizegenetics.dna.snp.io.LineIndex
 
LineIndexBuilder - Class in net.maizegenetics.dna.snp.io
 
LineIndexBuilder(fileToIndex) - Constructor for class net.maizegenetics.dna.snp.io.LineIndexBuilder
 
LineIndexHapmapGenotypeCallTable - Class in net.maizegenetics.dna.snp.genotypecall
 
lineNum() - Method in class net.maizegenetics.analysis.phg.ParseGVCF.GVCFLine
Line number in the .g.vcf file
lines() - Method in class net.maizegenetics.analysis.phg.ParseGVCF.ProcessLines
 
lines(path, bufSize) - Static method in class net.maizegenetics.util.Utils
Read all lines from a file as a Stream. Unlike Path.readAllLines, this method does not read all lines into a List, but instead populates lazily as the stream is consumed.
linkageDiseq(genotype, ldType, windowSize, hetTreatment) - Static method in class net.maizegenetics.plugindef.GenerateRCode
 
LinkageDiseqDisplayPlugin - Class in net.maizegenetics.analysis.popgen
 
LinkageDiseqDisplayPlugin(parentFrame, isInteractive) - Constructor for class net.maizegenetics.analysis.popgen.LinkageDiseqDisplayPlugin
Creates a new instance of LinkageDiseqDisplayPlugin
LinkageDisequilibrium - Class in net.maizegenetics.analysis.popgen
This class calculates D' and r^2 estimates of linkage disequilibrium. It also calculates the significance of the LD by either Fisher Exact or the multinomial permutation test. This class can work with either normal alignments of annotated alignments. The alignments should be stripped of invariable numSites.
LinkageDisequilibrium(alignment, windowSize, LDType, testSite, listener, isAccumulativeReport, numAccumulateIntervals, sitesList, hetTreatment) - Constructor for class net.maizegenetics.analysis.popgen.LinkageDisequilibrium
Constructor for doing LD analysis
LinkageDisequilibrium.HetTreatment - Enum in net.maizegenetics.analysis.popgen
Approaches for dealing with heterozygous sites. Haplotype assumes fully phased heterozygous sites (any hets are double counted). This is the best approach for speed when things are fully phased. Homozygous converted all hets to missing. Genotype does a 3x3 genotype analysis (to be implemented)
LinkageDisequilibrium.testDesign - Enum in net.maizegenetics.analysis.popgen
Design of test matrix.
LinkageDisequilibriumComponent - Class in net.maizegenetics.analysis.popgen
An AWT Component for displaying information on linkage disequilibrium. Nice schematics are produced if an annotation alignment is used to construct LinkageDisequilibrium. It can portray things both on the gene and chromosomal scale.
LinkageDisequilibriumComponent(theLD, includeBlockSchematic, chromosomalScale, windowSize, windowX, windowY) - Constructor for class net.maizegenetics.analysis.popgen.LinkageDisequilibriumComponent
 
LinkageDisequilibriumMinimapComponent - Class in net.maizegenetics.analysis.popgen
 
LinkageDisequilibriumMinimapComponent(theLD, windowSize, windowX, windowY) - Constructor for class net.maizegenetics.analysis.popgen.LinkageDisequilibriumMinimapComponent
 
LinkageDisequilibriumPlugin - Class in net.maizegenetics.analysis.popgen
 
LinkageDisequilibriumPlugin(parentFrame, isInteractive) - Constructor for class net.maizegenetics.analysis.popgen.LinkageDisequilibriumPlugin
Creates a new instance of LinkageDisequilibriumPlugin
listFileNames(pattern, inputFile) - Static method in class net.maizegenetics.util.DirectoryCrawler
 
listFiles(pattern, inputArray) - Static method in class net.maizegenetics.util.DirectoryCrawler
Recursively searches the object's directory tree for a specific filename.
listFiles(pattern, inputFile) - Static method in class net.maizegenetics.util.DirectoryCrawler
 
listFiles(pattern) - Static method in class net.maizegenetics.util.DirectoryCrawler
 
listFiles(pattern, inputFile) - Static method in class net.maizegenetics.util.DirectoryCrawler
 
listFiles(pattern, inputFiles) - Static method in class net.maizegenetics.util.DirectoryCrawler
 
listIterator() - Method in class net.maizegenetics.analysis.avro.GenericArrayPositions
 
listIterator(index) - Method in class net.maizegenetics.analysis.avro.GenericArrayPositions
 
listIterator() - Method in class net.maizegenetics.analysis.avro.GenericArrayTaxa
 
listIterator(index) - Method in class net.maizegenetics.analysis.avro.GenericArrayTaxa
 
listIterator() - Method in class net.maizegenetics.dna.snp.FilterList
 
listIterator(index) - Method in class net.maizegenetics.dna.snp.FilterList
 
listOfCovariateIndices() - Method in class net.maizegenetics.gui.SelectFromAvailableSitesDialog
 
listOfFactorIndices() - Method in class net.maizegenetics.gui.SelectFromAvailableSitesDialog
 
listOfSelectedIndices() - Method in class net.maizegenetics.gui.SelectFromAvailableSitesDialog
 
listPaths(pattern, inputDirectory) - Static method in class net.maizegenetics.util.DirectoryCrawler
Return a list of file paths matching a specified pattern with the starting directory. This uses the preferred nio Paths over the prior File approach.
ListPluginParameters - Class in net.maizegenetics.analysis
 
ListPluginParameters(parentFrame, isInteractive) - Constructor for class net.maizegenetics.analysis.ListPluginParameters
 
ListPluginParameters() - Constructor for class net.maizegenetics.analysis.ListPluginParameters
 
ListPluginParameters.Companion - Class in net.maizegenetics.analysis
 
ListPluginParametersKt - Class in net.maizegenetics.analysis
 
ListPlugins - Class in net.maizegenetics.analysis
 
ListPlugins(parentFrame, isInteractive) - Constructor for class net.maizegenetics.analysis.ListPlugins
 
ListStats - Class in net.maizegenetics.dna.snp.genotypecall
 
ListStatsFilterSite - Class in net.maizegenetics.dna.snp.genotypecall
 
ListStatsFilterTaxa - Class in net.maizegenetics.dna.snp.genotypecall
 
ListStatsSite - Class in net.maizegenetics.dna.snp.genotypecall
 
ListStatsTaxa - Class in net.maizegenetics.dna.snp.genotypecall
 
listTaxaInCluster() - Method in class net.maizegenetics.analysis.clustering.HaplotypeCluster
 
LittleEndianDataOutputStream - Class in net.maizegenetics.analysis.monetdb
Monetdb used LittleEndian format while java writes to BigEndian This class writes the binary files to accepted monetdb format.
LittleEndianDataOutputStream(out) - Constructor for class net.maizegenetics.analysis.monetdb.LittleEndianDataOutputStream
 
LIXPlugin - Class in net.maizegenetics.analysis.data
 
LIXPlugin(parentFrame, isInteractive) - Constructor for class net.maizegenetics.analysis.data.LIXPlugin
 
lnGamma(alpha) - Static method in class net.maizegenetics.stats.math.GammaFunction
log Gamma function: ln(gamma(alpha)) for alpha>0, accurate to 10 decimal places
lnLikelihood - Variable in class net.maizegenetics.stats.EMMA.EMMAforDoubleMatrix
 
load(filename) - Static method in class net.maizegenetics.plugindef.ParameterCache
Loads the parameter cache with the values in the given java.util.Properties file.
loadAll(newAnnotations) - Method in class net.maizegenetics.dna.map.GenomeFeatureBuilder
Load all annotations from a hashmap. Keys become the annotations, and values the annotation value. Each key-value pair is added individually (instead of using a putAll() method) to allow for key standardization, etc.
loadDonorAndChunk(donorFile, unimpAlign, appoxSitesPerHaplotype, verboseOutput) - Static method in class net.maizegenetics.analysis.imputation.FILLINDonorGenotypeUtils
 
loadDonors(donorFile, unimpAlign, minTestSites, verboseOutput, appoxSitesPerDonorGenotypeTable) - Static method in class net.maizegenetics.analysis.imputation.FILLINDonorGenotypeUtils
 
loadDonors(donorFileRoot, unimpAlign, minTestSites, verboseOutput) - Static method in class net.maizegenetics.analysis.imputation.FILLINDonorGenotypeUtils
 
loadFile(theRecombinationBreakpoints, theHighDensityMarkers) - Method in class net.maizegenetics.analysis.data.ProjectPcsAndRunModelSelectionPlugin
 
loadFile(filename, fileType) - Method in class net.maizegenetics.pipeline.TasselPipeline
 
loadInIntervalFile(intervalFile) - Method in class net.maizegenetics.analysis.data.CountAssociationsPlugin
 
loadPlotInfo() - Method in class net.maizegenetics.analysis.imputation.PhaseHighCoverage
 
loadPreferences() - Method in class net.maizegenetics.tassel.TASSELMainFrame
 
LoadRNAContigsToGBSDBPlugin - Class in net.maizegenetics.analysis.rna
Develops a discovery TBT file from a set of GBS sequence files. Keeps only good reads having a barcode and a cut site and no N's in the useful part of the sequence. Trims off the barcodes and truncates sequences that (1) have a second cut site, or (2) read into the common adapter. Originally the reference throughout was to "tag". This is being changed to "kmer" as the pipeline is a kmer alignment process.
LoadRNAContigsToGBSDBPlugin() - Constructor for class net.maizegenetics.analysis.rna.LoadRNAContigsToGBSDBPlugin
 
LoadRNAContigsToGBSDBPlugin(parentFrame, isInteractive) - Constructor for class net.maizegenetics.analysis.rna.LoadRNAContigsToGBSDBPlugin
 
loadSequences(input1, input2) - Method in class net.maizegenetics.analysis.gbs.neobio.PairwiseAlignmentAlgorithm
Request subclasses to load the sequences according to their own needs. Any alignment and score already computed is lost. If no exception is raised, the loaded flag is set to true. Subclasses typically store the sequences in instances of an appropiate class and each can have its own contract, so check each algorithm to see what kind of sequences it produces. Input can come from any source provided they are encapsulated with a proper Reader. They must be ready to be read, i.e. the next read operation must return the sequence's first character.
loadSequencesInternal(input1, input2) - Method in class net.maizegenetics.analysis.gbs.neobio.CrochemoreLandauZivUkelson
Loads sequences into FactorSequence instances. In case of any error, an exception is raised by the constructor of FactorSequence (please check the specification of that class for specific requirements).
loadSequencesInternal(input1, input2) - Method in class net.maizegenetics.analysis.gbs.neobio.NeedlemanWunsch
Loads sequences into class CharSequence instances. In case of any error, an exception is raised by the constructor of CharSequence (please check the specification of that class for specific requirements).
loadSequencesInternal(input1, input2) - Method in class net.maizegenetics.analysis.gbs.neobio.PairwiseAlignmentAlgorithm
Subclasses must implement this method to load sequences according to their own needs and throw an exception in case of any failure. If no exception is raised, the loaded flag is set to true by the public method and the sequences are believed to be loaded (so an alignment or score can be requested).
loadSequencesInternal(input1, input2) - Method in class net.maizegenetics.analysis.gbs.neobio.SmithWaterman
Loads sequences into class CharSequence instances. In case of any error, an exception is raised by the constructor of CharSequence (please check the specification of that class for specific requirements).
LocalAlignmentBlock - Class in net.maizegenetics.analysis.gbs.neobio
This class is used by the class CrochemoreLandauZivUkelsonLocalAlignment algorithm to store the information of an alignment block. All fields are public (but final) in order to simplify the access to the data.
locale() - Method in class net.maizegenetics.tassel.PreferencesDialog
Default locale for TASSEL
locale(value) - Method in class net.maizegenetics.tassel.PreferencesDialog
Set Locale. Default locale for TASSEL
localHeights2Lengths(node, respectMinimum) - Static method in class net.maizegenetics.taxa.tree.NodeUtils
determines branch lengths of this node and its immediate descendent nodes from heights.
locateScore() - Method in class net.maizegenetics.analysis.gbs.neobio.CrochemoreLandauZivUkelson
Locates the score of the highest scoring alignment between the two sequences in the block table after is thas been computed. See subclasses for actual implementation.
locateScore() - Method in class net.maizegenetics.analysis.gbs.neobio.CrochemoreLandauZivUkelsonGlobalAlignment
Locate the score of the highest scoring global alignment in the block table. This value is found in the output border of the last block (last row, last column).
locateScore() - Method in class net.maizegenetics.analysis.gbs.neobio.CrochemoreLandauZivUkelsonLocalAlignment
Returns the score of the high scoring local alignment in the block table.
LOCI - Static variable in class net.maizegenetics.dna.snp.HapMapHDF5Constants
 
lockHDF5GenotypeModule(h5w) - Static method in class net.maizegenetics.util.HDF5Utils
 
lockHDF5TaxaModule(h5w) - Static method in class net.maizegenetics.util.HDF5Utils
 
locus - Variable in class net.maizegenetics.analysis.modelfitter.SNP
 
LOCUS_INDICES - Static variable in class net.maizegenetics.dna.snp.HapMapHDF5Constants
 
LOCUS_OFFSETS - Static variable in class net.maizegenetics.dna.snp.HapMapHDF5Constants
 
logExceptionCauses(exception, logger, priorty) - Static method in class net.maizegenetics.util.ExceptionUtils
This sends an exception's cause history to the specified logger.
logFile() - Method in class net.maizegenetics.analysis.gbs.DiscoverySNPCallerPlugin
TagLocus log file name
logFile(value) - Method in class net.maizegenetics.analysis.gbs.DiscoverySNPCallerPlugin
Set Log File. TagLocus log file name
logFile() - Method in class net.maizegenetics.analysis.gbs.SeqToTBTHDF5Plugin
Output log file
logFile(value) - Method in class net.maizegenetics.analysis.gbs.SeqToTBTHDF5Plugin
Set Log File. Output log file
LoggingUtils - Class in net.maizegenetics.util
 
logStackTrace(exception, logger) - Static method in class net.maizegenetics.util.ExceptionUtils
This sends an exception's stack trace to the specified logger. The max parameter defines the maximun number of entries to send to the logger. This logs the default number of entries defined by DEFAULT_MAX_NUMBER_ENTRIES at the default priorty of debug.
logStackTrace(exception, max, logger, priorty) - Static method in class net.maizegenetics.util.ExceptionUtils
This sends an exception's stack trace to the specified logger. The max parameter defines the maximun number of entries to send to the logger. Setting max to a negative number sends all the entries in the stack track to the logger.
logTransform(original) - Method in class net.maizegenetics.analysis.numericaltransform.TransformDataPlugin
 
logTransformation() - Method in class net.maizegenetics.analysis.numericaltransform.TransformDataDialog
 
longestPrefix(input) - Method in class net.maizegenetics.analysis.gbs.v2.BarcodeTrie
Find the longest prefix of a string
LongitudeKey - Static variable in class net.maizegenetics.taxa.Taxon
Standard key for the longitude the taxon was sampled
lowerlimit - Variable in class net.maizegenetics.stats.EMMA.EMMAforDoubleMatrix
 
LowLevelCopyOfHDF5 - Class in net.maizegenetics.analysis.data
Provides low level copy and migration tool.
lRatioMB - Variable in class net.maizegenetics.dna.map.TagGWASMapInfo
Likelihood ratio of the most significant chromosome Vs the median most significant chromosome, log10 value, unknown = 0
lRatioSB - Variable in class net.maizegenetics.dna.map.TagGWASMapInfo
Likelihood ratio of the most significant chromosome Vs the second most significant chromosome, log10 value, unknown = 0

M

maf - Variable in class net.maizegenetics.analysis.gbs.SimpleGenotypeSBit
 
MAF - Variable in class net.maizegenetics.analysis.imputation.FILLINImputationAccuracy
 
maf(val) - Method in class net.maizegenetics.dna.map.GeneralPosition.Builder
Set Minor Allele Frequency annotation (default=Float.NaN)
MAF - Static variable in class net.maizegenetics.dna.snp.HapMapHDF5Constants
 
MAF - Static variable in class net.maizegenetics.util.Tassel5HDF5Constants
 
MAFClass - Static variable in class net.maizegenetics.analysis.imputation.FILLINImputationPlugin
 
MAGIC_NUMBER - Static variable in class net.maizegenetics.dna.snp.io.LineIndexBuilder
 
magicNumber() - Method in class net.maizegenetics.dna.snp.io.LineIndex
 
main(args) - Static method in class net.maizegenetics.analysis.avro.ExportAvro
 
main(args) - Static method in class net.maizegenetics.analysis.avro.GenericRecordGenotype
 
main(args) - Static method in class net.maizegenetics.analysis.data.CountAssociationsPluginKt
 
main(args) - Static method in class net.maizegenetics.analysis.gbs.AnnotateTOPMwSAMPlugin
 
main(args) - Static method in class net.maizegenetics.analysis.gbs.MergeTagsByTaxaFilesByRowPlugin
 
main(args) - Static method in class net.maizegenetics.analysis.gbs.pana.PanAUsageExample
 
main(args) - Static method in class net.maizegenetics.analysis.gbs.ProductionPipelineMain
 
main(args) - Static method in class net.maizegenetics.analysis.gbs.repgen.RepGenAlignerPlugin
 
main(args) - Static method in class net.maizegenetics.analysis.gbs.repgen.RepGenLDAnalysisPlugin
 
main(args) - Static method in class net.maizegenetics.analysis.gbs.repgen.RepGenPhase2AlignerPlugin
 
main(args) - Static method in class net.maizegenetics.analysis.gbs.SAMWGMapConverterPlugin
 
main(args) - Static method in class net.maizegenetics.analysis.gbs.TagMatchFinder
 
main(args) - Static method in class net.maizegenetics.analysis.gbs.TerryPipelines
 
main(args) - Static method in class net.maizegenetics.analysis.gbs.v2.BarcodeTrie
 
main(args) - Static method in class net.maizegenetics.analysis.gbs.v2.EnzymeList
Prints default enzyme list and exists
main(args) - Static method in class net.maizegenetics.analysis.gbs.v2.GetTagTaxaDistFromDBPlugin
 
main(args) - Static method in class net.maizegenetics.analysis.gobii.BMSConnection
 
main(args) - Static method in class net.maizegenetics.analysis.gobii.GWAS_IFLPlugin
 
main(args) - Static method in class net.maizegenetics.analysis.gobii.HapBreakpoints_IFLFilePlugin
 
main(args) - Static method in class net.maizegenetics.analysis.gobii.MarkerDNARun_IFLFilePlugin
 
main(args) - Static method in class net.maizegenetics.analysis.gobii.UpdateMarkerAndDNA_idxes
 
main(args) - Static method in class net.maizegenetics.analysis.imputation.FILLINImputationPlugin
 
main(args) - Static method in class net.maizegenetics.analysis.imputation.FindMergeHaplotypesPlugin
 
main(args) - Static method in class net.maizegenetics.analysis.imputation.ImputationUtils
 
main(args) - Static method in class net.maizegenetics.analysis.imputation.LDKNNiImputationHetV2Plugin
 
main(args) - Static method in class net.maizegenetics.analysis.imputation.LDKNNiImputationHetV3Plugin
 
main(args) - Static method in class net.maizegenetics.analysis.imputation.LDKNNiImputationPlugin
 
main(args) - Static method in class net.maizegenetics.analysis.imputation.SelfedHaplotypeFinder
 
main(args) - Static method in class net.maizegenetics.analysis.monetdb.ColumnsToBinaryFullGenomeTablePlugin
 
main(args) - Static method in class net.maizegenetics.analysis.monetdb.ColumnsToBinarySNPOnlyTablePlugin
 
main(args) - Static method in class net.maizegenetics.analysis.numericaltransform.TransformDataDialog
 
main(args) - Static method in class net.maizegenetics.analysis.rna.RNADeMultiplexProductionPlugin
 
main(args) - Static method in class net.maizegenetics.dna.map.UpdateTOPMWithGeneticMapping
 
main(args) - Static method in class net.maizegenetics.dna.pd.FolderParser
 
main(args) - Static method in class net.maizegenetics.dna.pd.PDAnnotation
 
main(args) - Static method in class net.maizegenetics.dna.pd.PDReport
 
main(args) - Static method in class net.maizegenetics.dna.snp.genotypecall.GOBIIGenotypeCallTable
 
main(args) - Static method in class net.maizegenetics.dna.tag.TagsByTaxaByteFileMap
 
main(args) - Static method in class net.maizegenetics.dna.tag.TagsByTaxaByteHDF5TagGroups
 
main(args) - Static method in class net.maizegenetics.dna.tag.TagsByTaxaByteHDF5TaxaGroups
 
main(args) - Static method in class net.maizegenetics.dna.tag.TagsByTaxaUtils
 
main(args) - Static method in class net.maizegenetics.gui.ReportDestinationDialog
 
main(args) - Static method in class net.maizegenetics.pipeline.TasselPipeline
 
main(args) - Static method in class net.maizegenetics.plugindef.GenerateRCode
 
main(args) - Static method in class net.maizegenetics.tassel.TASSELMainApp
 
main(args) - Static method in class net.maizegenetics.util.ChangeLog
 
main(args) - Static method in class net.maizegenetics.util.Sizeof
 
MAJOR_ALLELE - Static variable in class net.maizegenetics.dna.snp.HapMapHDF5Constants
 
majorAllele(site) - Method in class net.maizegenetics.dna.snp.CombineGenotypeTable
 
majorAllele(site) - Method in class net.maizegenetics.dna.snp.CoreGenotypeTable
 
majorAllele(alleles) - Static method in class net.maizegenetics.dna.snp.genotypecall.AlleleFreqCache
 
majorAllele(site) - Method in interface net.maizegenetics.dna.snp.genotypecall.GenotypeCallTable
Return most common allele at given site. Gap is included as state. Heterozygous count one for each allele value. Homozygous counts two for the allele value.
majorAllele(index) - Method in class net.maizegenetics.dna.snp.genotypecall.ListStats
 
majorAllele() - Method in class net.maizegenetics.dna.snp.genotypecall.Stats
 
majorAllele(site) - Method in interface net.maizegenetics.dna.snp.GenotypeTable
Return most common allele at given site. Gap is included as state. Heterozygous count one for each allele value. Homozygous counts two for the allele value.
majorAllele(site) - Method in class net.maizegenetics.dna.snp.MergedGenotypeTable
 
majorAllele(site) - Method in class net.maizegenetics.dna.snp.TOPMGenotypeTable
 
majorAlleleAsString(site) - Method in class net.maizegenetics.dna.snp.CombineGenotypeTable
 
majorAlleleAsString(site) - Method in class net.maizegenetics.dna.snp.CoreGenotypeTable
 
majorAlleleAsString(site) - Method in interface net.maizegenetics.dna.snp.genotypecall.GenotypeCallTable
Return most common allele at given site. Gap is included as state. Heterozygous count one for each allele value. Homozygous counts two for the allele value.
majorAlleleAsString(site) - Method in interface net.maizegenetics.dna.snp.GenotypeTable
Return most common allele at given site. Gap is included as state. Heterozygous count one for each allele value. Homozygous counts two for the allele value.
majorAlleleAsString(site) - Method in class net.maizegenetics.dna.snp.MergedGenotypeTable
 
majorAlleleAsString(site) - Method in class net.maizegenetics.dna.snp.TOPMGenotypeTable
 
majorAlleleCount(site) - Method in class net.maizegenetics.dna.snp.CombineGenotypeTable
 
majorAlleleCount(site) - Method in class net.maizegenetics.dna.snp.CoreGenotypeTable
 
majorAlleleCount(site) - Method in interface net.maizegenetics.dna.snp.genotypecall.GenotypeCallTable
Returns the major allele count for given site.
majorAlleleCount(site) - Method in interface net.maizegenetics.dna.snp.GenotypeTable
Returns the major allele count for given site.
majorAlleleCount(site) - Method in class net.maizegenetics.dna.snp.MergedGenotypeTable
 
majorAlleleCount(site) - Method in class net.maizegenetics.dna.snp.TOPMGenotypeTable
 
majorAlleleForAllSites() - Method in interface net.maizegenetics.dna.snp.genotypecall.GenotypeCallTable
Returns major allele for all sites.
majorAlleleFrequency(site) - Method in class net.maizegenetics.dna.snp.CombineGenotypeTable
 
majorAlleleFrequency(site) - Method in class net.maizegenetics.dna.snp.CoreGenotypeTable
 
majorAlleleFrequency(alleles) - Static method in class net.maizegenetics.dna.snp.genotypecall.AlleleFreqCache
 
majorAlleleFrequency(site) - Method in interface net.maizegenetics.dna.snp.genotypecall.GenotypeCallTable
Return frequency for major allele at given site. Gap is included as state. Heterozygous count one for each allele value. Homozygous counts two for the allele value.
majorAlleleFrequency(index) - Method in class net.maizegenetics.dna.snp.genotypecall.ListStats
 
majorAlleleFrequency() - Method in class net.maizegenetics.dna.snp.genotypecall.Stats
 
majorAlleleFrequency(site) - Method in interface net.maizegenetics.dna.snp.GenotypeTable
Return frequency for major allele at given site. Gap is included as state. Heterozygous count one for each allele value. Homozygous counts two for the allele value.
majorAlleleFrequency(site) - Method in class net.maizegenetics.dna.snp.MergedGenotypeTable
 
majorAlleleFrequency(site) - Method in class net.maizegenetics.dna.snp.TOPMGenotypeTable
 
majorMinorCounts() - Method in class net.maizegenetics.dna.snp.CombineGenotypeTable
 
majorMinorCounts() - Method in class net.maizegenetics.dna.snp.CoreGenotypeTable
 
majorMinorCounts() - Method in interface net.maizegenetics.dna.snp.genotypecall.GenotypeCallTable
Returns counts of all major/minor allele combinations from highest frequency to lowest for whole alignment. Resulting double dimension array holds major/minor allele (Strings) in result[0]. And the counts are in result[1] (Longs).
majorMinorCounts() - Method in interface net.maizegenetics.dna.snp.GenotypeTable
Returns counts of all major/minor allele combinations from highest frequency to lowest for whole genotype table. Resulting double dimension array holds major/minor allele (Strings) in result[0]. And the counts are in result[1] (Longs).
majorMinorCounts() - Method in class net.maizegenetics.dna.snp.MergedGenotypeTable
 
majorMinorCounts() - Method in class net.maizegenetics.dna.snp.TOPMGenotypeTable
 
make(row, col) - Method in class net.maizegenetics.matrixalgebra.Matrix.DoubleMatrixFactory
 
make(row, col, values) - Method in class net.maizegenetics.matrixalgebra.Matrix.DoubleMatrixFactory
 
make(row, col, values, columnMajor) - Method in class net.maizegenetics.matrixalgebra.Matrix.DoubleMatrixFactory
 
make(values) - Method in class net.maizegenetics.matrixalgebra.Matrix.DoubleMatrixFactory
 
make(values) - Method in class net.maizegenetics.matrixalgebra.Matrix.DoubleMatrixFactory
 
make(row, col, val) - Method in class net.maizegenetics.matrixalgebra.Matrix.DoubleMatrixFactory
 
makeClusters() - Method in class net.maizegenetics.analysis.clustering.HaplotypeClusterer
Groups a list of Haplotypes into clusters. Clusters are created so that all Haplotypes in a cluster have 0 pairwise distance. Because of missing data a Haplotype can be assigned to more than one cluster.
makeHetsConsistent(seqIn) - Method in class net.maizegenetics.analysis.clustering.Haplotype
 
makePositionHashes(alignments) - Static method in class net.maizegenetics.analysis.data.MergeGenotypeTablesPlugin
Takes an array of GenotypeTables and returns a matching array of HashMaps linking each Position to its index
makeTaxaHashes(alignments) - Static method in class net.maizegenetics.analysis.data.MergeGenotypeTablesPlugin
Takes an array of GenotypeTables and returns a matching array of HashMaps linking each Taxon to its index
makeTree(theTree, isInteractive, frame) - Static method in class net.maizegenetics.analysis.tree.ArchaeopteryxPlugin
 
ManhattanDisplayPlugin - Class in net.maizegenetics.analysis.chart
 
ManhattanDisplayPlugin(parentFrame, isInteractive) - Constructor for class net.maizegenetics.analysis.chart.ManhattanDisplayPlugin
Creates a new instance of ManhattanDisplayPlugin
ManhattanNumberFormat - Class in net.maizegenetics.analysis.chart
 
ManhattanNumberFormat(base, actualPosition) - Constructor for class net.maizegenetics.analysis.chart.ManhattanNumberFormat
 
MAPBASE - Static variable in class net.maizegenetics.dna.tag.GBSHDF5Constants
 
mapFile() - Method in class net.maizegenetics.analysis.data.PlinkLoadPlugin
Map File
mapFile(value) - Method in class net.maizegenetics.analysis.data.PlinkLoadPlugin
Set Map File. Map File
mapFilename() - Method in class net.maizegenetics.analysis.data.ConvertAlignmentCoordinatesPlugin
Map File
mapFilename(value) - Method in class net.maizegenetics.analysis.data.ConvertAlignmentCoordinatesPlugin
Set Map File. Map File
mapP - Variable in class net.maizegenetics.dna.map.TagMappingInfo
Genetic mapping probability Round(Log2(P)), unknown Byte.MIN_VALUE
mapP - Variable in class net.maizegenetics.dna.map.TagMappingInfoV3
Genetic mapping probability Round(Log2(P)), unknown= Byte.MIN_VALUE
mappedTags() - Method in class net.maizegenetics.dna.map.AbstractTagsOnPhysicalMap
 
mappingApproach(value) - Method in class net.maizegenetics.analysis.gbs.v2.SAMToGBSdbPlugin
Set Mapper (one of 'Bowtie2', 'BWA', or 'bwaMem').
mappingApproach() - Method in class net.maizegenetics.analysis.gbs.v2.SAMToGBSdbPlugin
Get Mapper (one of 'Bowtie2', 'BWA', or 'bwaMem').
mappingDistribution() - Method in class net.maizegenetics.dna.map.TagsOnPhysicalMap
Returns an array whose indices are the number of mappings and whose elements are the number of tags with that mapping.
mappingFile() - Method in class net.maizegenetics.analysis.gobii.MarkerDNARun_IFLFilePlugin
tab-delimited File containing columns for taxaname, name, MGID, libraryID, project_id, experiment_name, platform_name, reference_name and dataset_name
mappingFile(value) - Method in class net.maizegenetics.analysis.gobii.MarkerDNARun_IFLFilePlugin
Set mappingFile. tab-delimited File containing columns for taxaname, name, MGID, libraryID, project_id, experiment_name, platform_name, reference_name and dataset_name
mappingFile() - Method in class net.maizegenetics.analysis.gobii.PreProcessGOBIIMappingFilePlugin
tab-delimited File containing columns: taxaColumn, name, MGID, GID,libraryID, plate_code, well, species, type, project_id, experiment_name, platform_name, reference_name and dataset_name
mappingFile(value) - Method in class net.maizegenetics.analysis.gobii.PreProcessGOBIIMappingFilePlugin
Set mappingFile. tab-delimited File containing columns: taxaColumn, name, MGID, GID,libraryID, plate_code, well, species, type, project_id, experiment_name, platform_name, reference_name and dataset_name
mappingNum - Variable in class net.maizegenetics.dna.map.TagsOnPhysicalMapV3
Number of physical positions from different aligner or aligner with different parameters
mappingRank - Variable in class net.maizegenetics.dna.map.TagMappingInfoV3
The rank of this mapping based on the scores from one aligner, starting from 0. If there are two 0, the rank of the third one is 1
mappingResultToTagGWASMapPlugin() - Method in class net.maizegenetics.analysis.gbs.pana.PanAUsageExample
 
mappingScore - Variable in class net.maizegenetics.dna.map.TagMappingInfoV3
The mapping score of this mapping, unknown = Byte.MIN_VALUE
mappingSource - Variable in class net.maizegenetics.dna.map.TagMappingInfoV3
Code of mappingSource.0: Bowtie2; 1: BWA; 2: BLAST; 3: BWAMEM; 4: PE one end; 5: PE the other end; 6: Genetic Mapping; missing = Byte.MIN_VALUE
mapset() - Method in class net.maizegenetics.analysis.gobii.HapBreakpoints_IFLFilePlugin
Name of the mapset to which these breakpoints refer. Must match an existing name in the mapset table, e.g AGPV3
mapset(value) - Method in class net.maizegenetics.analysis.gobii.HapBreakpoints_IFLFilePlugin
Set mapset. Name of the mapset to which these breakpoints refer. Must match an existing name in the mapset table, e.g AGPV3
mapsetName() - Method in class net.maizegenetics.analysis.gobii.MarkerDNARun_IFLFilePlugin
Integer identifying the mapset_id from the linkage group table to use when mapping to marker_linkage_group.
mapsetName(value) - Method in class net.maizegenetics.analysis.gobii.MarkerDNARun_IFLFilePlugin
Set mapsetId
Marker(pos, values, df) - Constructor for class net.maizegenetics.stats.linearmodels.SolveByOrthogonalizing.Marker
 
Marker(pos, additive, dominant, df) - Constructor for class net.maizegenetics.stats.linearmodels.SolveByOrthogonalizing.Marker
 
MarkerDNARun_IFLFilePlugin - Class in net.maizegenetics.analysis.gobii
BEWARE: Whenever you "pull" to update the GOBII projects, there could be changes that effect these plugins. Need to check if the .nmap or .dupmap files have changed, and make corresponding changes here as required. This class takes a hmp.txt file(s) or vcf file(s) with a mapping file and creates the intermediate files for the marker, marker_linkage_group, dataset_marker, dnarun, and dataset_dnarun tables. The inputFile variable can be a file or a directory. If it is a directory, the code will look for all files with format *(hmp.txt,hmp.txt.gz,vcf,vcf.gz) and process them. It is assumed all files use the same taxa. Because we assume it is all the same taxa, the dnarun and dataset_dnarun files are created from the first *.hmp.txt file processed. These are the intermediate files that map this dnarun to a dataset, and contain one entry for each taxa which contains the taxa name (in the name field), libraryPrepID (as the code field), and ids into experiment and dnasample tables. The "mapping file" needs to contain columnns for the following data: taxaname: as appears in the vcf/hmp file name: taxa name it maps to (do I need this?) MGID: MGID for this taxa name GID: GID for this dnarun libraryID: same as in dnasample file project_name: db will be queried to get project_id from project name. Needed by IFL get get dnasample_id experiment_name: name of experiment needed for dnarun table (IFL maps to id) platform_name: name of platform needed for marker table, (IFL maps to ID) reference_name: name of reference table (IFL maps to ID) dataset_name: needed for dataset_dnarun and dataset_marker tables (IFL Maps to ID) samplename: will be used for table dnasample.name field The mapping file needs an entry for all taxa that may appear in the data input file. It is ok if multiple taxa names appear with the same MGID/GID/etc. These are synonyms. We mostly aren't storing the names, just the MGID. It must be identified in the mapping file. THe dataset id must be gotten from the database. Check the dataset from the mapping file, query the database to get the dataset_id. GOBII creates the data_table and data_file names from the GUI when it creates the ID. It always names them DS_.h5 and DS_ for the table. We must do this by hand as we want to maintain consistency. The marker_linkage_group: Their mapping now requires both marker_name and platform_id. So Platform_name must also be a parameter. The software will query the db to get the platform_id from platform name. Both the marker and the marker_linkage_group intermediate files need the platform_name. This could be moved to the mapping file, but currently is an input parameter. VCF file headers have these fields: #CHROM POS ID REF ALT QUAL FILTER INFO FORMAT taxa1 taxa2 ... HMP.txt file headers have these fields: rs# alleles chrom pos strand assembly# center protLSID assayLSID panelLSID QCcode taxa1 ... Class Gobii_IFLUtils is used to find chrom,pos, alt and strand values based on file type of hmp or vcf. THe type of file is determined by the file suffix (hmp.txt, hmp.txt.gz, vcf or vcf.gz) July 6, 2016: In addition, this method will create a file to be used with PostProcessMarkerPlugin(). This file will contain the marker name, platformid and alts array. It may be used at a future date to find existing markers in the DB and update the alts array. See PostProcessMarkerPlugin() for details. Currently any allele in A/C/G/T that is not the reference will appear on the alt list. This is per Ed who says given a large enough population, each allele will appear as an alternate. August 3: BEcause we continue to change the data that makes up the sample name (was GID:plate:well, now is extraction_id) I have added a column called "SampleName" to the mapping file. The software will take whatever is stored here and use it as the dnasample name. Biologists can then change at will without a need to change the software Problems with GOBII loaders: The GOBII dnarun.nmap file now takes "num" instead of "platename" EIther one can be a problem for BL as they are not required fields, and we often don't have values for these columns. The IFL scripts preprocessor_ifile.py does not check for IS NULL. It merely checks if the input file and exsiting db column match. You can't compare blank to null in postgres. BEcause of this, I changed our copy of the dnarun.nmap file and removed "num" as a mapping criteria. I have left it in this code to alert me if I do a "pull" on GOBII and move over new scripts. Uploading DS_X.dnarun should reulst in no entries, which will hopefully remind me to chaneg the mapping script again.
MarkerDNARun_IFLFilePlugin(parentFrame, isInteractive) - Constructor for class net.maizegenetics.analysis.gobii.MarkerDNARun_IFLFilePlugin
 
MarkerDNARun_IFLFilePlugin() - Constructor for class net.maizegenetics.analysis.gobii.MarkerDNARun_IFLFilePlugin
 
MarkerDNARun_IFLFilePlugin.HmpTaxaData - Class in net.maizegenetics.analysis.gobii
 
markerEffectCIReportBuilder - Variable in class net.maizegenetics.analysis.modelfitter.StepwiseAdditiveModelFitter
 
markerEffectReportBuilder - Variable in class net.maizegenetics.analysis.modelfitter.StepwiseAdditiveModelFitter
 
markerpvalueColumn - Variable in class net.maizegenetics.analysis.association.AbstractFixedEffectLM
 
markerSSdf - Variable in class net.maizegenetics.analysis.association.AbstractFixedEffectLM
 
mask() - Method in class net.maizegenetics.dna.snp.score.MaskAlleleDepth
 
mask() - Method in class net.maizegenetics.dna.snp.score.MaskAlleleProbability
 
MaskAlleleDepth - Class in net.maizegenetics.dna.snp.score
 
MaskAlleleDepth(depth, mask) - Constructor for class net.maizegenetics.dna.snp.score.MaskAlleleDepth
 
MaskAlleleProbability - Class in net.maizegenetics.dna.snp.score
 
MaskAlleleProbability(probability, mask) - Constructor for class net.maizegenetics.dna.snp.score.MaskAlleleProbability
 
MaskDosage - Class in net.maizegenetics.dna.snp.score
 
MaskedGenotypes - Class in net.maizegenetics.dna.snp.genotypecall
 
MaskedGenotypes(numTaxa, numSites) - Constructor for class net.maizegenetics.dna.snp.genotypecall.MaskedGenotypes
 
maskForSite(site) - Method in class net.maizegenetics.dna.snp.AbstractMaskMatrix
 
maskForSite(site) - Method in interface net.maizegenetics.dna.snp.MaskMatrix
Mask for specified site
maskForSite(site) - Method in class net.maizegenetics.dna.snp.MaskSiteMatrix
Mask for specified site
maskForSite(site) - Method in class net.maizegenetics.dna.snp.MaskTaxaMatrix
Mask for specified site
maskForTaxon(taxon) - Method in class net.maizegenetics.dna.snp.AbstractMaskMatrix
 
maskForTaxon(taxon) - Method in interface net.maizegenetics.dna.snp.MaskMatrix
Mask for specified taxon
maskForTaxon(taxon) - Method in class net.maizegenetics.dna.snp.MaskSiteMatrix
Mask for specified taxon
maskForTaxon(taxon) - Method in class net.maizegenetics.dna.snp.MaskTaxaMatrix
Mask for specified taxon
MaskGenotypeCallTable - Class in net.maizegenetics.dna.snp.genotypecall
 
MaskGenotypeCallTable(base, mask) - Constructor for class net.maizegenetics.dna.snp.genotypecall.MaskGenotypeCallTable
 
MaskGenotypeMatrix - Class in net.maizegenetics.dna.snp
 
MaskGenotypePlugin - Class in net.maizegenetics.analysis.data
The purpose of this class is to mask (make UNKNOWN) a portion of the genotypes of the given GenotypeTable. The resulting GenotypeTable will be the same except some genotypes will have been changed to Unknown.
MaskGenotypePlugin(parentFrame, isInteractive) - Constructor for class net.maizegenetics.analysis.data.MaskGenotypePlugin
 
MaskGenotypeStatsMatrix - Class in net.maizegenetics.dna.snp
 
maskKeyAlign - Static variable in class net.maizegenetics.analysis.imputation.FILLINImputationPlugin
 
MaskMatrix - Interface in net.maizegenetics.dna.snp
 
MaskMatrixBuilder - Class in net.maizegenetics.dna.snp
 
MaskReferenceProbability - Class in net.maizegenetics.dna.snp.score
 
MaskSiteMatrix - Class in net.maizegenetics.dna.snp
 
MaskTaxaMatrix - Class in net.maizegenetics.dna.snp
 
match(seq) - Method in class net.maizegenetics.analysis.rna.FindMatchByWordHash
Return the first unique kmer match found starting at the 5' end of the sequence.
Match(mapIndex, quality) - Constructor for class net.maizegenetics.analysis.rna.FindMatchByWordHash.Match
 
Match() - Constructor for class net.maizegenetics.analysis.rna.FindMatchByWordHash.Match
 
match_reward - Variable in class net.maizegenetics.analysis.gbs.neobio.BasicScoringScheme
The reward for a match (a substitution of equal characters).
match_reward() - Method in class net.maizegenetics.analysis.gbs.repgen.RampSeqAlignFromBlastTags
Parameter sent to Smith Waterman aligner for use in calculating reward when base pairs match.
match_reward(value) - Method in class net.maizegenetics.analysis.gbs.repgen.RampSeqAlignFromBlastTags
Set Match Reward Amount. Parameter sent to Smith Waterman aligner for use in calculating reward when base pairs match.
match_reward() - Method in class net.maizegenetics.analysis.gbs.repgen.RepGenAlignerPlugin
Parameter sent to Smith Waterman aligner for use in calculating reward when base pairs match.
match_reward(value) - Method in class net.maizegenetics.analysis.gbs.repgen.RepGenAlignerPlugin
Set Match Reward Amount. Parameter sent to Smith Waterman aligner for use in calculating reward when base pairs match.
match_reward() - Method in class net.maizegenetics.analysis.gbs.repgen.RepGenPhase2AlignerPlugin
Parameter sent to Smith Waterman aligner for use in calculating reward when base pairs match.
match_reward(value) - Method in class net.maizegenetics.analysis.gbs.repgen.RepGenPhase2AlignerPlugin
Set Match Reward Amount. Parameter sent to Smith Waterman aligner for use in calculating reward when base pairs match.
MATCH_TAG - Static variable in class net.maizegenetics.analysis.gbs.neobio.PairwiseAlignmentAlgorithm
Tag character that signals a match in the score tag line of an alignment. Its use is conditioned by the use_match_tag flag.
matchCount(site1, site2, a) - Static method in class net.maizegenetics.analysis.imputation.NucleotideImputationUtils
 
matchingType() - Method in class net.maizegenetics.analysis.rna.RNADeMultiplexProductionPlugin
Approach used for matching the reads to the contigs
matchingType(value) - Method in class net.maizegenetics.analysis.rna.RNADeMultiplexProductionPlugin
Set Matching approach. Approach used for matching the reads to the contigs
matchTagsToTaxa(fastqFileS, keyFileS, enzyme, theMasterTags, outputDir, minCount, useTBTByte, useTBTShort) - Static method in class net.maizegenetics.analysis.gbs.FastqToTBTPlugin
Uses an existing Tags object to create one TagsByTaxa file for each fastq file in the input directory. Output TBT files written to the outputDir, using fastq file names with extension changed to .tbt.bin (or .tbt.txt)
matchTagsToTaxa(fastqFileS, theMasterTags, outputDir, minCount, useTBTByte, useTBTShort) - Static method in class net.maizegenetics.analysis.gbs.KmerToTBTPlugin
Uses an existing Tags object to create one TagsByTaxa file for each fastq file in the input directory. Output TBT files written to the outputDir, using fastq file names with extension changed to .tbt.bin (or .tbt.txt)
matchTagsToTaxa(qseqFileS, keyFileS, enzyme, theMasterTags, outputDir, minCount, useTBTByte) - Static method in class net.maizegenetics.analysis.gbs.QseqToTBTPlugin
Uses an existing Tags object to create one TagsByTaxa file for each qseq file in the input directory. Output TBT files written to the outputDir, using qseq file names with extension changed to .tbt.bin (or .tbt.txt)
matchTagsToTaxa(fastqFileS, keyFileS, enzyme, theMasterTags, outputTBT, outputLog) - Method in class net.maizegenetics.analysis.gbs.SeqToTBTHDF5Plugin
Uses an existing Tags object to create one TagsByTaxa file for each fastq file in the input directory. Output TBT files written to the outputDir, using fastq file names with extension changed to .tbt.bin (or .tbt.txt)
matchType(matchType) - Method in class net.maizegenetics.analysis.rna.FindMatchByWordHash.Builder
 
Matrix - Interface in net.maizegenetics.analysis.gbs.neobio
This interface defines a minimal set of operations that a matrix must implement. This interface is used by the class Smawk class to provide a general services regardless of how the matrix is actually stored.
matrix - Variable in class net.maizegenetics.analysis.gbs.neobio.NeedlemanWunsch
The dynamic programming matrix. Each position (i, j) represents the best score between the firsts i characters of seq1 and j characters of seq2.
matrix - Variable in class net.maizegenetics.analysis.gbs.neobio.ScoringMatrix
Stores values for each operation (substitution, insertion or deletion) defined by this matrix.
matrix - Variable in class net.maizegenetics.analysis.gbs.neobio.Smawk
A pointer to the matrix that is being manipulated.
matrix - Variable in class net.maizegenetics.analysis.gbs.neobio.SmithWaterman
The dynamic programming matrix. Each position (i, j) represents the best score between a suffic of the firsts i characters of seq1 and a suffix of the first j characters of seq2.
matrix - Variable in class net.maizegenetics.analysis.gbs.SmithWaterman
The dynamic programming matrix. Each position (i, j) represents the best score between a suffic of the firsts i characters of seq1 and a suffix of the first j characters of seq2.
MATRIX_ALGORITHM_VARIATION - Static variable in class net.maizegenetics.taxa.distance.DistanceMatrixBuilder
 
MATRIX_MULTIPLIER - Static variable in class net.maizegenetics.analysis.distance.Kinship
Deprecated.
 
MATRIX_TYPE - Static variable in class net.maizegenetics.taxa.distance.DistanceMatrixBuilder
 
max(v1, v2) - Method in class net.maizegenetics.analysis.gbs.neobio.PairwiseAlignmentAlgorithm
Helper method to compute the the greater of two values.
max(v1, v2, v3) - Method in class net.maizegenetics.analysis.gbs.neobio.PairwiseAlignmentAlgorithm
Helper method to compute the the greater of three values.
max(v1, v2, v3, v4) - Method in class net.maizegenetics.analysis.gbs.neobio.PairwiseAlignmentAlgorithm
Helper method to compute the the greater of four values.
max(v1, v2) - Method in class net.maizegenetics.analysis.gbs.SmithWaterman
Helper method to compute the the greater of two values.
max(v1, v2, v3) - Method in class net.maizegenetics.analysis.gbs.SmithWaterman
Helper method to compute the the greater of three values.
max(v1, v2, v3, v4) - Method in class net.maizegenetics.analysis.gbs.SmithWaterman
Helper method to compute the the greater of four values.
max_absolute_score - Variable in class net.maizegenetics.analysis.gbs.neobio.BasicScoringScheme
The maximum absolute score that this scoring scheme can return, which is the maximum absolute value among match_reward, mismatch_penalty and gap_cost.
max_absolute_score - Variable in class net.maizegenetics.analysis.gbs.neobio.ScoringMatrix
The maximum absolute score that this matrix can return for any substitution, deletion or insertion.
max_col - Variable in class net.maizegenetics.analysis.gbs.neobio.CrochemoreLandauZivUkelsonLocalAlignment
The column index of a block (in the block table) where the high scoring local alignment ends.
max_col - Variable in class net.maizegenetics.analysis.gbs.neobio.SmithWaterman
Indicate the column of where an optimal local alignment can be found in the matrix.
max_col - Variable in class net.maizegenetics.analysis.gbs.SmithWaterman
Indicate the column of where an optimal local alignment can be found in the matrix.
max_length - Variable in class net.maizegenetics.analysis.gbs.neobio.OutMatrix
The length of the longest sequence (number of characters) being aligned. It needs to be set only once per alignment.
MAX_NUM_ALLELES - Static variable in class net.maizegenetics.dna.snp.HapMapHDF5Constants
 
max_path_type - Variable in class net.maizegenetics.analysis.gbs.neobio.CrochemoreLandauZivUkelsonLocalAlignment
The type of the high scoring local alignment found.
max_row - Variable in class net.maizegenetics.analysis.gbs.neobio.CrochemoreLandauZivUkelsonLocalAlignment
The row index of a block (in the block table) where the high scoring local alignment ends.
max_row - Variable in class net.maizegenetics.analysis.gbs.neobio.SmithWaterman
Indicate the row of where an optimal local alignment can be found in the matrix..
max_row - Variable in class net.maizegenetics.analysis.gbs.SmithWaterman
Indicate the row of where an optimal local alignment can be found in the matrix..
max_score - Variable in class net.maizegenetics.analysis.gbs.neobio.CrochemoreLandauZivUkelsonLocalAlignment
The score of the high scoring local alignment found.
max_score - Variable in class net.maizegenetics.analysis.gbs.neobio.OutMatrix
The maximum absolute score that the current scoring scheme can return. It needs to be set only once per alignment.
max_source_index - Variable in class net.maizegenetics.analysis.gbs.neobio.CrochemoreLandauZivUkelsonLocalAlignment
If the high scoring local alignment ends in an E-path at a block B, this field contains the index of the entry in the input border of B that where the E-path starts.
maxAbsoluteScore() - Method in class net.maizegenetics.analysis.gbs.neobio.BasicScoringScheme
Returns the maximum absolute score that this scoring scheme can return for any substitution, deletion or insertion, which is the maximum absolute value among match_reward, mismatch_penalty and gap_cost.
maxAbsoluteScore() - Method in class net.maizegenetics.analysis.gbs.neobio.ScoringMatrix
Returns the maximum absolute score that this scoring scheme can return for any substitution, deletion or insertion.
maxAbsoluteScore() - Method in class net.maizegenetics.analysis.gbs.neobio.ScoringScheme
Returns the maximum absolute score that this scoring scheme can return for any substitution, deletion or insertion.
maxAlleles() - Method in class net.maizegenetics.analysis.distance.KinshipPlugin
Max Alleles
maxAlleles(value) - Method in class net.maizegenetics.analysis.distance.KinshipPlugin
Set Max Alleles. Max Alleles
MAXARC - Variable in interface net.maizegenetics.taxa.tree.BranchLimits
maximum branch length
maxCombinedErrorToImputeTwoDonors() - Method in class net.maizegenetics.analysis.imputation.FILLINFindHaplotypesPlugin
The maximum genetic divergence allowable to cluster taxa
maxCombinedErrorToImputeTwoDonors(value) - Method in class net.maizegenetics.analysis.imputation.FILLINFindHaplotypesPlugin
Set Max combined error to impute two donors. The maximum genetic divergence allowable to cluster taxa
maxCombinedErrorToImputeTwoDonors() - Method in class net.maizegenetics.analysis.imputation.FILLINImputationPlugin
Maximum error rate for applying Viterbi with to haplotypes to entire site window
maxCombinedErrorToImputeTwoDonors(value) - Method in class net.maizegenetics.analysis.imputation.FILLINImputationPlugin
Set Max combined error to impute two donors. Maximum error rate for applying Viterbi with to haplotypes to entire site window
maxCores() - Method in class net.maizegenetics.analysis.imputation.LDKNNiImputationHetV2Plugin
Maximum number of cores to be used for processing
maxCores(value) - Method in class net.maizegenetics.analysis.imputation.LDKNNiImputationHetV2Plugin
Set Maximum number of cores for processing. Maximum number of cores to be used for processing
maxCores() - Method in class net.maizegenetics.analysis.imputation.LDKNNiImputationHetV3Plugin
Maximum number of cores to be used for processing
maxCores(value) - Method in class net.maizegenetics.analysis.imputation.LDKNNiImputationHetV3Plugin
Set Maximum number of cores for processing. Maximum number of cores to be used for processing
maxDiff() - Method in class net.maizegenetics.analysis.imputation.FSFHapImputationPlugin
use to decide if two haplotypes are equivalent
maxDiff(value) - Method in class net.maizegenetics.analysis.imputation.FSFHapImputationPlugin
Set Max Diff. use to decide if two haplotypes are equivalent
maxDifferenceScore - Variable in class net.maizegenetics.analysis.imputation.BiparentalHaplotypeFinder
Haplotypes with a difference score less than or equal to maxDifferenceScore will be assigned to the same cluster. The difference between two non-equal homozygotes is 2, between a homozygote and heterozygote is 1.
maxDistance() - Method in class net.maizegenetics.analysis.imputation.LDKNNiImputationHetV2Plugin
Maximum physical distance between sites to search for LD (-1 for no distance cutoff - unlinked chromosomes will be tested)
maxDistance(value) - Method in class net.maizegenetics.analysis.imputation.LDKNNiImputationHetV2Plugin
Set Max distance between site to find LD. Maximum physical distance between sites to search for LD (-1 for no distance cutoff - unlinked chromosomes will be tested)
maxDistance() - Method in class net.maizegenetics.analysis.imputation.LDKNNiImputationHetV3Plugin
Maximum physical distance between sites to search for LD (-1 for no distance cutoff - unlinked chromosomes will be tested)
maxDistance(value) - Method in class net.maizegenetics.analysis.imputation.LDKNNiImputationHetV3Plugin
Set Max distance between site to find LD. Maximum physical distance between sites to search for LD (-1 for no distance cutoff - unlinked chromosomes will be tested)
maxDistance() - Method in class net.maizegenetics.analysis.imputation.LDKNNiImputationPlugin
Maximum physical distance between sites to look for LD (-1 for no distance cutoff - unlinked chromosomes will be tested)
maxDistance(value) - Method in class net.maizegenetics.analysis.imputation.LDKNNiImputationPlugin
Set Max distance between site to find LD. Maximum physical distance between sites to look for LD (-1 for no distance cutoff - unlinked chromosomes will be tested)
maxDistanceFromNN() - Method in class net.maizegenetics.analysis.imputation.LDKNNiImputationHetV2Plugin
Maximum distance from Nearest Neighbor
maxDistanceFromNN(value) - Method in class net.maizegenetics.analysis.imputation.LDKNNiImputationHetV2Plugin
Set Maximum distance from Nearest Neighbor. Maximum distance from Nearest Neighbor
maxDistanceFromNN() - Method in class net.maizegenetics.analysis.imputation.LDKNNiImputationHetV3Plugin
Maximum distance from Nearest Neighbor
maxDistanceFromNN(value) - Method in class net.maizegenetics.analysis.imputation.LDKNNiImputationHetV3Plugin
Set Maximum distance from Nearest Neighbor. Maximum distance from Nearest Neighbor
maxDivergence() - Method in class net.maizegenetics.analysis.gbs.repgen.RGBSProductionSNPCallerPlugin
Maximum divergence (edit distance) between new read and previously mapped read (Default: 0 = perfect matches only)
maxDivergence(value) - Method in class net.maizegenetics.analysis.gbs.repgen.RGBSProductionSNPCallerPlugin
Set Max Divergence. Maximum divergence (edit distance) between new read and previously mapped read (Default: 0 = perfect matches only)
maxDivergence - Static variable in class net.maizegenetics.analysis.gbs.TagMatchFinder
 
maxDivergence() - Method in class net.maizegenetics.analysis.gbs.v2.ProductionSNPCallerPluginV2
Maximum divergence (edit distance) between new read and previously mapped read (Default: 0 = perfect matches only)
maxDivergence(value) - Method in class net.maizegenetics.analysis.gbs.v2.ProductionSNPCallerPluginV2
Set Max Divergence. Maximum divergence (edit distance) between new read and previously mapped read (Default: 0 = perfect matches only)
maxDivergenceFromFounder() - Method in class net.maizegenetics.analysis.imputation.FILLINFindHaplotypesPlugin
Maximum genetic divergence from founder haplotype to cluster sequences
maxDivergenceFromFounder(value) - Method in class net.maizegenetics.analysis.imputation.FILLINFindHaplotypesPlugin
Set Max divergence from founder. Maximum genetic divergence from founder haplotype to cluster sequences
maxDonorHypotheses() - Method in class net.maizegenetics.analysis.imputation.FILLINImputationPlugin
Maximum number of donor hypotheses to be explored
maxDonorHypotheses(value) - Method in class net.maizegenetics.analysis.imputation.FILLINImputationPlugin
Set Max donor hypotheses. Maximum number of donor hypotheses to be explored
maxErrorToImputeOneDonor() - Method in class net.maizegenetics.analysis.imputation.FILLINImputationPlugin
Maximum error rate for applying one haplotype to entire site window
maxErrorToImputeOneDonor(value) - Method in class net.maizegenetics.analysis.imputation.FILLINImputationPlugin
Set Max error to impute one donor. Maximum error rate for applying one haplotype to entire site window
maxFrequencyMissingPerHaplotype() - Method in class net.maizegenetics.analysis.imputation.FILLINFindHaplotypesPlugin
Maximum frequency of missing data in the output haplotype
maxFrequencyMissingPerHaplotype(value) - Method in class net.maizegenetics.analysis.imputation.FILLINFindHaplotypesPlugin
Set Max frequency missing per haplotype. Maximum frequency of missing data in the output haplotype
maxGoodReads(value) - Method in class net.maizegenetics.analysis.gbs.FastqToTagCountPlugin
 
maxGoodReads() - Method in class net.maizegenetics.analysis.gbs.FastqToTagCountPlugin
 
maxGoodReads() - Method in class net.maizegenetics.analysis.gbs.SeqToTBTHDF5Plugin
Max good reads per lane.
maxGoodReads(value) - Method in class net.maizegenetics.analysis.gbs.SeqToTBTHDF5Plugin
Set Max Good Reads. Max good reads per lane.
maxHaplotypesPerSegment() - Method in class net.maizegenetics.analysis.imputation.FILLINFindHaplotypesPlugin
Maximum number of haplotypes per segment
maxHaplotypesPerSegment(value) - Method in class net.maizegenetics.analysis.imputation.FILLINFindHaplotypesPlugin
Set Max haplotypes per segment. Maximum number of haplotypes per segment
maxHetDeviation - Variable in class net.maizegenetics.analysis.imputation.BiparentalHaplotypeFinder
Filter out sites more than maxHetDeviation * (standard deviation) different from the mean percent heterozygosity.;
maxHeterozygosityOfOutputHaplotypes() - Method in class net.maizegenetics.analysis.imputation.FILLINFindHaplotypesPlugin
Maximum heterozygosity of output haplotype. Heterozygosity results from clustering sequences that either have residual heterozygosity or clustering sequences that do not share all minor alleles.
maxHeterozygosityOfOutputHaplotypes(value) - Method in class net.maizegenetics.analysis.imputation.FILLINFindHaplotypesPlugin
Set Max heterozygosity of output haplotypes. Maximum heterozygosity of output haplotype. Heterozygosity results from clustering sequences that either have residual heterozygosity or clustering sequences that do not share all minor alleles.
maxHeterozygous() - Method in class net.maizegenetics.analysis.filter.FilterSiteBuilderPlugin
Max Heterozygous Proportion
maxHeterozygous(value) - Method in class net.maizegenetics.analysis.filter.FilterSiteBuilderPlugin
Set Max Heterozygous Proportion. Max Heterozygous Proportion
maxHeterozygous() - Method in class net.maizegenetics.analysis.filter.FilterTaxaBuilderPlugin
Max Heterozygous Proportion
maxHeterozygous(value) - Method in class net.maizegenetics.analysis.filter.FilterTaxaBuilderPlugin
Set Max Heterozygous Proportion. Max Heterozygous Proportion
maxHeterozygous() - Method in class net.maizegenetics.dna.snp.FilterSite
 
maxHeterozygous() - Method in class net.maizegenetics.dna.snp.FilterTaxa
 
maxHeterozygousProportion() - Method in class net.maizegenetics.analysis.filter.FilterTaxaPropertiesPlugin
Max Heterozygous Proportion
maxHeterozygousProportion(value) - Method in class net.maizegenetics.analysis.filter.FilterTaxaPropertiesPlugin
Set Max Heterozygous Proportion. Max Heterozygous Proportion
maximumKmerNumber(value) - Method in class net.maizegenetics.analysis.gbs.repgen.RepGenLoadSeqToDBPlugin
Set maximum number of kmers
maximumKmerNumber(value) - Method in class net.maizegenetics.analysis.gbs.v2.GBSSeqToTagDBPlugin
Set maximum number of kmers
maximumMismatchInBarcodeAndOverhang - Variable in class net.maizegenetics.analysis.gbs.ParseBarcodeRead
 
maximumNumberOfPCs() - Method in class net.maizegenetics.stats.PCA.ClassicMds
 
maxiter - Variable in class net.maizegenetics.stats.EMMA.EMMAforDoubleMatrix
 
maxMajorAllelesTaxa(a, numMaxTaxa, alleleNumber) - Static method in class net.maizegenetics.analysis.imputation.FILLINFindHaplotypesPlugin
 
maxMajorAllelesTaxa(a, numMaxTaxa, alleleNumber) - Static method in class net.maizegenetics.analysis.imputation.FindMergeHaplotypesPlugin
 
MAXMAPPING - Static variable in class net.maizegenetics.dna.tag.GBSHDF5Constants
 
maxMissing() - Method in class net.maizegenetics.analysis.imputation.FSFHapImputationPlugin
filter out sites with proportion missing > maxMissing
maxMissing(value) - Method in class net.maizegenetics.analysis.imputation.FSFHapImputationPlugin
Set Max Missing. filter out sites with proportion missing > maxMissing
maxNumAlleles() - Method in class net.maizegenetics.dna.snp.CombineGenotypeTable
 
maxNumAlleles() - Method in class net.maizegenetics.dna.snp.CoreGenotypeTable
 
maxNumAlleles() - Method in interface net.maizegenetics.dna.snp.genotypecall.GenotypeCallTable
Return max number of alleles defined for any given site.
maxNumAlleles() - Method in interface net.maizegenetics.dna.snp.GenotypeTable
Return max number of alleles defined for any given site.
maxNumAlleles() - Method in class net.maizegenetics.dna.snp.MergedGenotypeTable
 
maxNumAlleles() - Method in class net.maizegenetics.dna.snp.TOPMGenotypeTable
 
maxNumberOfMarkers() - Method in class net.maizegenetics.analysis.modelfitter.StepwiseOLSModelFitterPlugin
The maximum number of markers that will be fit, if the enter limit is not reached first
maxNumberOfMarkers(value) - Method in class net.maizegenetics.analysis.modelfitter.StepwiseOLSModelFitterPlugin
Set Maximum markers. The maximum number of markers that will be fit, if the enter limit is not reached first
maxP - Variable in class net.maizegenetics.analysis.association.AbstractFixedEffectLM
 
maxP(maxP) - Method in class net.maizegenetics.analysis.association.AbstractFixedEffectLM
 
maxp() - Method in class net.maizegenetics.analysis.association.FastMultithreadedAssociationPlugin
The maximum p-value that will be output by the analysis.
maxp(value) - Method in class net.maizegenetics.analysis.association.FastMultithreadedAssociationPlugin
Set MaxPValue. The maximum p-value that will be output by the analysis.
maxP(maxP) - Method in interface net.maizegenetics.analysis.association.FixedEffectLM
 
maxPercentNaN() - Method in class net.maizegenetics.analysis.distance.RemoveNaNFromDistanceMatrixPlugin
Maximum percent of NaN allowed
maxPercentNaN(value) - Method in class net.maizegenetics.analysis.distance.RemoveNaNFromDistanceMatrixPlugin
Set Maximum Percent NaN. Maximum percent of NaN allowed
maxPValue() - Method in class net.maizegenetics.analysis.association.EqtlAssociationPlugin
The maximum p-value that will be output by the analysis.
maxPValue(value) - Method in class net.maizegenetics.analysis.association.EqtlAssociationPlugin
Set MaxPValue. The maximum p-value that will be output by the analysis.
maxPvalue() - Method in class net.maizegenetics.analysis.association.FixedEffectLMPlugin
Only results with p <= maxPvalue will be reported. Default = 1.0.
maxPvalue(value) - Method in class net.maizegenetics.analysis.association.FixedEffectLMPlugin
Set max P value. Only results with p <= maxPvalue will be reported. Default = 1.0.
maxSitesInModel - Variable in class net.maizegenetics.analysis.modelfitter.StepwiseAdditiveModelFitter
 
maxSitesInModel(maxSites) - Method in class net.maizegenetics.analysis.modelfitter.StepwiseAdditiveModelFitter
 
maxSize() - Method in class net.maizegenetics.analysis.gobii.SplitFile_IFLFilePlugin
Maximum size of each file after splitting.
maxSize(value) - Method in class net.maizegenetics.analysis.gobii.SplitFile_IFLFilePlugin
Set Maximum file size. Maximum size of each file after splitting.
maxTagsPerCutSite() - Method in class net.maizegenetics.analysis.gbs.v2.DiscoverySNPCallerPluginV2
Maximum number of tags per cut site (for alignment)
maxTagsPerCutSite(value) - Method in class net.maizegenetics.analysis.gbs.v2.DiscoverySNPCallerPluginV2
Set maxTagsPerCutSite. This is the maximum number of tags allowed per cute site when performaing an alignment. Too many tags and biojava 4 getMultipleSequenceAlignment grinds to a halt.
maxTaxa() - Method in interface net.maizegenetics.dna.tag.TaxaDistribution
Number of taxa that depth is being recorded for. Maximum taxa index = (maxTaxa-1)
maxTerms() - Method in class net.maizegenetics.analysis.modelfitter.StepwiseAdditiveModelFitterPlugin
The maximum number of SNPs/markers that will be fit. If the model selection criterion is met first, then the fitting process will stop at that point.
maxTerms(value) - Method in class net.maizegenetics.analysis.modelfitter.StepwiseAdditiveModelFitterPlugin
Set Max SNPs/markers. The maximum number of SNPs/markers that will be fit. If the model selection criterion is met first, then the fitting process will stop at that point.
maxThreads() - Method in class net.maizegenetics.analysis.association.FastMultithreadedAssociationPlugin
the maximum number of threads to be used by this plugin.
maxThreads(value) - Method in class net.maizegenetics.analysis.association.FastMultithreadedAssociationPlugin
Set Max Threads. the maximum number of threads to be used by this plugin.
maxVariants - Variable in class net.maizegenetics.analysis.modelfitter.AbstractForwardRegression
 
MAXVARIANTS - Static variable in class net.maizegenetics.dna.tag.GBSHDF5Constants
 
maxWordCopies(maxWordCopies) - Method in class net.maizegenetics.analysis.rna.FindMatchByWordHash.Builder
 
maxWordRepeats() - Method in class net.maizegenetics.analysis.rna.RNADeMultiplexProductionPlugin
Maximum repetitiveness of the word
maxWordRepeats(value) - Method in class net.maizegenetics.analysis.rna.RNADeMultiplexProductionPlugin
Set Maximum repeats of word. Maximum repetitiveness of the word
mbic(RSS, N, modelDf, numberOfSites) - Static method in class net.maizegenetics.analysis.modelfitter.StepwiseAdditiveModelFitter
 
mean(col, data) - Static method in class net.maizegenetics.analysis.numericaltransform.ImputationByMean
 
mean(n) - Static method in class net.maizegenetics.stats.statistics.ApproxFastChiSquareDistribution
mean of the chi-square distribution
mean(n) - Static method in class net.maizegenetics.stats.statistics.ChiSquareDistribution
mean of the chi-square distribution
mean(lambda) - Static method in class net.maizegenetics.stats.statistics.ExponentialDistribution
mean of the exponential distribution
mean(shape, scale) - Static method in class net.maizegenetics.stats.statistics.GammaDistribution
mean of the Gamma distribution
mean(m, sd) - Static method in class net.maizegenetics.stats.statistics.NormalDistribution
mean
mean(k, m) - Static method in class net.maizegenetics.stats.statistics.ParetoDistribution
mean of the Pareto distribution
MEAN_CLADE_HEIGHT - Variable in interface net.maizegenetics.taxa.tree.AttributeNode
attribute name for the mean height of this clade in a group of trees.
meanDistance() - Method in class net.maizegenetics.taxa.distance.DistanceMatrix
Returns the mean pairwise distance of this matrix
MeanR2FromLDPlugin - Class in net.maizegenetics.analysis.data
 
MeanR2FromLDPlugin(parentFrame, isInteractive) - Constructor for class net.maizegenetics.analysis.data.MeanR2FromLDPlugin
 
MeanR2FromLDPlugin() - Constructor for class net.maizegenetics.analysis.data.MeanR2FromLDPlugin
 
MeanR2FromLDPlugin.AccumulateR2 - Class in net.maizegenetics.analysis.data
 
meanStdDev(data) - Method in class net.maizegenetics.analysis.numericaltransform.TransformDataPlugin
 
members - Variable in class net.maizegenetics.analysis.imputation.PopulationData
 
MemoryByte2D - Class in net.maizegenetics.dna.snp.byte2d
 
memorySize() - Method in interface net.maizegenetics.dna.tag.TaxaDistribution
Estimated memory footprint of this taxa distribution. Can be used to estimate the size of the Map containing these distributions.
MemoryUsagePlugin - Class in net.maizegenetics.analysis.data
 
MemoryUsagePlugin(parentFrame, isInteractive) - Constructor for class net.maizegenetics.analysis.data.MemoryUsagePlugin
 
mendelErrorComparison(mjT, mnT, mj1, mn1, mj2, mn2) - Static method in class net.maizegenetics.analysis.imputation.FILLINImputationUtils
Determines the number of sites in which the target (T) sequence cannot be explained by the genotypes of either donor (1 & 2). Only sites where the genotype for all taxa can be tested.
mendelianErrors - Variable in class net.maizegenetics.analysis.popgen.DonorHypoth
 
merge() - Method in class net.maizegenetics.analysis.imputation.FSFHapImputationPlugin
merge families and chromosomes
merge(value) - Method in class net.maizegenetics.analysis.imputation.FSFHapImputationPlugin
Set Merge. merge families and chromosomes
merge(filenames) - Static method in class net.maizegenetics.dna.map.TagsOnPhysicalMap
Merges several TOPM files into one, removing duplicate rows. Variants from matching tags are combined in the output file. If there are more variants in the input files than can fit in the output, extra variants are discarded with no particular order.
merge(ifPrintAlignment) - Method in class net.maizegenetics.dna.read.PEFastqChunk
Merge PE to Pcontig
merge(ifPrintAlignment) - Method in class net.maizegenetics.dna.read.PERead
 
merge(base, translate) - Static method in class net.maizegenetics.dna.snp.TranslateIndexBuilder
 
merge(second) - Method in interface net.maizegenetics.util.db.DBTuple
 
MergeAlignmentsSameSitesPlugin - Class in net.maizegenetics.analysis.data
 
MergeAlignmentsSameSitesPlugin(parentFrame) - Constructor for class net.maizegenetics.analysis.data.MergeAlignmentsSameSitesPlugin
 
MergeBreakpointFilesPlugin - Class in net.maizegenetics.analysis.imputation
 
MergeBreakpointFilesPlugin() - Constructor for class net.maizegenetics.analysis.imputation.MergeBreakpointFilesPlugin
 
MergeBreakpointFilesPlugin(parentFrame, isInteractive) - Constructor for class net.maizegenetics.analysis.imputation.MergeBreakpointFilesPlugin
 
mergeCalls(calls) - Static method in class net.maizegenetics.analysis.data.MergeGenotypeTablesPlugin
Take an array of Byte genotype calls and merge TODO: Make this smarter; currently just uses the last call (to be same as in TASSEL4)
mergeCalls(geno1, geno2) - Method in class net.maizegenetics.dna.snp.genotypecall.BasicGenotypeMergeRule
 
mergeCalls(geno1, geno2) - Method in interface net.maizegenetics.dna.snp.genotypecall.GenotypeMergeRule
Merges diploid genotypic calls into one
mergeCalls(geno1, geno2) - Method in class net.maizegenetics.dna.snp.genotypecall.HighestDepthGenotypeMergeRule
 
mergeCalls(geno1, geno2) - Method in class net.maizegenetics.dna.snp.genotypecall.SetToNGenotypeMergeRule
 
mergeChunks(chunkFileNames, outputFileName, minCount) - Method in class net.maizegenetics.analysis.gbs.MergeMultipleTagCountPlugin
 
mergeClusters(maxdiff) - Method in class net.maizegenetics.analysis.clustering.HaplotypeClusterer
Merges clusters whose maximum pairwise difference is less than maxdiff. Clusters are tested sequentially. That is, if two clusters are merged, they become the new head cluster against which remaining clusters are tested for merging.
MergedGenotypeCallTable - Class in net.maizegenetics.dna.snp.genotypecall
 
MergedGenotypeTable - Class in net.maizegenetics.dna.snp
 
MergedGenotypeTable(genoTables, taxaList, positionList) - Constructor for class net.maizegenetics.dna.snp.MergedGenotypeTable
 
MergeDuplicateSNPsPlugin - Class in net.maizegenetics.analysis.gbs
This class is intended to be run directly after DiscoverySNPCallerPlugin, using the HapMap file from that step as input. It finds duplicate SNPs in the HapMap file, and merges them if they have the same pair of alleles (not necessarily in the same maj/min order) and if there mismatch rate is no greater than the threshold (-maxMisMat). If -callHets is on, then genotypic disagreements will be called heterozygotes (otherwise set to 'N' = default). By default, any remaining unmerged duplicate SNPs (but not indels) will be deleted. They can be kept by invoking the -kpUnmergDups option. If the germplasm is not fully inbred, and still contains residual heterozygosity (like the maize NAM or IBM populations do) then -callHets should be on and -maxMisMat should be set fairly high (0.1 to 0.2, depending on the amount of heterozygosity). Todo the VCF support has been commented out, but this should all be merged into the main pipeline.
MergeDuplicateSNPsPlugin() - Constructor for class net.maizegenetics.analysis.gbs.MergeDuplicateSNPsPlugin
 
MergeDuplicateSNPsPlugin(parentFrame) - Constructor for class net.maizegenetics.analysis.gbs.MergeDuplicateSNPsPlugin
 
mergeFiles(mergeFiles, idcol, datacol, colOrder, outfile) - Static method in class net.maizegenetics.analysis.imputation.ImputationUtils
 
mergeGenotypeTables(alignments) - Static method in class net.maizegenetics.analysis.data.MergeGenotypeTablesPlugin
Merge an array of GenotypeTables into a single GenotypeTable
MergeGenotypeTablesPlugin - Class in net.maizegenetics.analysis.data
Merge alignments into a single alignment containing all taxa and positions. TODO: Add capacity for depth
MergeGenotypeTablesPlugin(parentFrame, isInteractive) - Constructor for class net.maizegenetics.analysis.data.MergeGenotypeTablesPlugin
 
MergeGenotypeTablesPluginV2 - Class in net.maizegenetics.analysis.data
 
MergeGenotypeTablesPluginV2(parentFrame, isInteractive) - Constructor for class net.maizegenetics.analysis.data.MergeGenotypeTablesPluginV2
 
MergeGenotypeTablesPluginV2.CALL_MERGE - Enum in net.maizegenetics.analysis.data
 
MergeGenotypeTablesPluginV2.DEPTH_MERGE - Enum in net.maizegenetics.analysis.data
 
MergeGenotypeTablesPluginV2.MERGE_TYPES - Enum in net.maizegenetics.analysis.data
 
mergeHDF5GenoTables() - Method in class net.maizegenetics.analysis.data.MergeHDF5GenotypesSameSitesPlugin
 
MergeHDF5GenotypesSameSitesPlugin - Class in net.maizegenetics.analysis.data
 
MergeHDF5GenotypesSameSitesPlugin() - Constructor for class net.maizegenetics.analysis.data.MergeHDF5GenotypesSameSitesPlugin
 
MergeHDF5GenotypesSameSitesPlugin(parentFrame) - Constructor for class net.maizegenetics.analysis.data.MergeHDF5GenotypesSameSitesPlugin
 
mergeMajorHaplotypes(clusterMaker, minClusterSize) - Method in class net.maizegenetics.analysis.imputation.BiparentalHaplotypeFinder
 
mergeMappingResultPlugin() - Method in class net.maizegenetics.analysis.gbs.pana.PanAUsageExample
 
MergeMultipleTagCountPlugin - Class in net.maizegenetics.analysis.gbs
 
MergeMultipleTagCountPlugin() - Constructor for class net.maizegenetics.analysis.gbs.MergeMultipleTagCountPlugin
 
MergeMultipleTagCountPlugin(parentFrame, isInteractive) - Constructor for class net.maizegenetics.analysis.gbs.MergeMultipleTagCountPlugin
 
mergeMultipleTagCountPlugin() - Method in class net.maizegenetics.analysis.gbs.pana.PanAUsageExample
 
MergeMultipleTOPMPlugin - Class in net.maizegenetics.analysis.gbs
 
MergeMultipleTOPMPlugin(parentFrame) - Constructor for class net.maizegenetics.analysis.gbs.MergeMultipleTOPMPlugin
 
mergeNonconsensusFiles(dir, match, outfileName) - Static method in class net.maizegenetics.analysis.imputation.ImputationUtils
 
mergePETagCount() - Method in class net.maizegenetics.analysis.gbs.MergePETagCountPlugin
Merge each individual PETagCounts file into one master PETagCounts file
MergePETagCountPlugin - Class in net.maizegenetics.analysis.gbs
Merge PETagCounts file of each taxon into one master PETagCounts file (collapsed and sorted)
MergePETagCountPlugin() - Constructor for class net.maizegenetics.analysis.gbs.MergePETagCountPlugin
 
MergePETagCountPlugin(parentFrame) - Constructor for class net.maizegenetics.analysis.gbs.MergePETagCountPlugin
 
mergePosition(a, b) - Method in class net.maizegenetics.analysis.data.MergeGenotypeTablesPluginV2
 
MergeRenameDeleteTaxaPlugin - Class in net.maizegenetics.analysis.data
 
MergeRenameDeleteTaxaPlugin() - Constructor for class net.maizegenetics.analysis.data.MergeRenameDeleteTaxaPlugin
 
MergeRenameDeleteTaxaPlugin(parentFrame, isInteractive) - Constructor for class net.maizegenetics.analysis.data.MergeRenameDeleteTaxaPlugin
 
MergeTagsByTaxaFilesByRowPlugin - Class in net.maizegenetics.analysis.gbs
Merges multiple TagsByTaxa files that are too large to fit in memory when combined. Currently, the output file stores only presence or absence of a tag in a taxon, so the merged count is the boolean OR of the individual counts. The program loops over files to determine their size, creates a RandomAccessFile object large enough to hold the merged data, then loops over each file again to fill the RandomAccessFile.
MergeTagsByTaxaFilesByRowPlugin() - Constructor for class net.maizegenetics.analysis.gbs.MergeTagsByTaxaFilesByRowPlugin
 
MergeTagsByTaxaFilesByRowPlugin(parentFrame) - Constructor for class net.maizegenetics.analysis.gbs.MergeTagsByTaxaFilesByRowPlugin
 
MergeTagsByTaxaFilesPlugin - Class in net.maizegenetics.analysis.gbs
Merges multiple TagsByTaxa files that are too large to fit in memory when combined. Currently, the output file stores only presence or absence of a tag in a taxon, so the merged count is the boolean OR of the individual counts. The program loops over files to determine their size, creates a RandomAccessFile object large enough to hold the merged data, then loops over each file again to fill the RandomAccessFile.
MergeTagsByTaxaFilesPlugin() - Constructor for class net.maizegenetics.analysis.gbs.MergeTagsByTaxaFilesPlugin
 
MergeTagsByTaxaFilesPlugin(parentFrame) - Constructor for class net.maizegenetics.analysis.gbs.MergeTagsByTaxaFilesPlugin
 
mergeTaxa() - Method in class net.maizegenetics.analysis.gbs.ModifyTBTHDF5Plugin
 
mergeTaxa(value) - Method in class net.maizegenetics.analysis.gbs.ModifyTBTHDF5Plugin
 
mergeTaxaByName(inputFileName, outputFileName, format, caseSensitive) - Static method in class net.maizegenetics.dna.tag.TagsByTaxaUtils
Merge taxa with identical names (merge their (binary) tag counts into a single column). The input must be a TagsByTaxaBit file in either binary or text format. The output is written in binary TagsByTaxaBit format. Other TagsByTaxa formats (Byte, Short, etc) are not currently supported.
mergeTaxaIncremental(existingHDF5File, mergeRule) - Static method in class net.maizegenetics.dna.snp.GenotypeTableBuilder
Merges taxa to an existing HDF5 file. The position list is derived from the positions already in the existing HDF5 file.
mergeTaxon(a, b) - Method in class net.maizegenetics.analysis.data.MergeGenotypeTablesPluginV2
 
mergeTOGM(another) - Method in class net.maizegenetics.dna.map.TagsOnGeneticMap
 
mergeToMutableHDF5(infiles, newMerge) - Static method in class net.maizegenetics.dna.snp.io.BuilderFromGenotypeHDF5
This merge multiple alignment together into one ByteNucleotideHDF5 File. This is designed for putting multiple chromosomes together into one whole genome file.
mergeTrees(trees) - Static method in class net.maizegenetics.taxa.tree.NewickUtils
This merges two or more trees into one tree. Nodes are merged when the names are the same.
MergeTreesPlugin - Class in net.maizegenetics.analysis.tree
 
MergeTreesPlugin(parentFrame, isInteractive) - Constructor for class net.maizegenetics.analysis.tree.MergeTreesPlugin
 
MergeTreesPlugin() - Constructor for class net.maizegenetics.analysis.tree.MergeTreesPlugin
 
MergeTreesPluginKt - Class in net.maizegenetics.analysis.tree
 
mergeTwoClusters(c0, c1) - Static method in class net.maizegenetics.analysis.clustering.HaplotypeClusterer
Merges two clusters, c0 and c1.
mergeWithDepth(geno1depths, geno2depths) - Method in class net.maizegenetics.dna.snp.genotypecall.BasicGenotypeMergeRule
 
mergeWithDepth(geno1depths, geno2depths) - Method in interface net.maizegenetics.dna.snp.genotypecall.GenotypeMergeRule
Merges sequencing depths of two taxa
mergeWithDepth(geno1depths, geno2depths) - Method in class net.maizegenetics.dna.snp.genotypecall.HighestDepthGenotypeMergeRule
 
mergeWithDepth(geno1depths, geno2depths) - Method in class net.maizegenetics.dna.snp.genotypecall.SetToNGenotypeMergeRule
 
MersenneTwisterFast - Class in net.maizegenetics.stats.math
MersenneTwisterFast: A simulation quality fast random number generator (MT19937) with the same public methods as java.util.Random.
MersenneTwisterFast() - Constructor for class net.maizegenetics.stats.math.MersenneTwisterFast
Constructor using the time of day as default seed.
MersenneTwisterFast(seed) - Constructor for class net.maizegenetics.stats.math.MersenneTwisterFast
Constructor using a given seed. Though you pass this seed in as a long, it's best to make sure it's actually an integer.
metaphone2(s1, ignoreCase, ignoreWhite, ignorePunc) - Static method in class net.maizegenetics.taxa.IdentifierSynonymizer
 
method() - Method in class net.maizegenetics.analysis.distance.VCAPScanPlugin
Scan method
method(value) - Method in class net.maizegenetics.analysis.distance.VCAPScanPlugin
Set Scan method. Scan method
method() - Method in class net.maizegenetics.analysis.gobii.HapBreakpoints_IFLFilePlugin
Method used to created the breakpoints, e.g. FILLIN, beagle, etc
method(value) - Method in class net.maizegenetics.analysis.gobii.HapBreakpoints_IFLFilePlugin
Set Breakpoint Method. Method used to created the breakpoints, e.g. FILLIN, beagle, etc
methodIds() - Method in class net.maizegenetics.analysis.gobii.GWAS_IFLPlugin
Name of GWAS method as it appears in the name field of the gwas_method table
methodIds(value) - Method in class net.maizegenetics.analysis.gobii.GWAS_IFLPlugin
Set Method Name. Name of GWAS method as it appears in the name field of the gwas_method table
MigrateHDF5FromT4T5 - Class in net.maizegenetics.analysis.data
Provides a migration tool from TASSEL4 HDF5 to TASSEL5 HDF5
MIN_HETS - Static variable in class net.maizegenetics.analysis.modelfitter.AddPlusDomModelEffect
 
minAlignLength() - Method in class net.maizegenetics.analysis.gbs.v2.SAMToGBSdbPlugin
Minimum length of bps aligning to store the SAM entry
minAlignLength(value) - Method in class net.maizegenetics.analysis.gbs.v2.SAMToGBSdbPlugin
Set SAM Min Align Length. Minimum length of bps aligning to store the SAM entry
minAlignProportion() - Method in class net.maizegenetics.analysis.gbs.v2.SAMToGBSdbPlugin
Minimum proportion of sequence that must align to store the SAM entry
minAlignProportion(value) - Method in class net.maizegenetics.analysis.gbs.v2.SAMToGBSdbPlugin
Set SAM Min Align Proportion. Minimum proportion of sequence that must align to store the SAM entry
MINARC - Variable in interface net.maizegenetics.taxa.tree.BranchLimits
minimum branch length
minCallBestGenoRatio() - Method in class net.maizegenetics.analysis.imputation.LDKNNiImputationHetV2Plugin
Minimum ratio between best and second best genotype to make a call
minCallBestGenoRatio(value) - Method in class net.maizegenetics.analysis.imputation.LDKNNiImputationHetV2Plugin
Set Minimum support ratio for best genotype. Minimum ratio between best and second best genotype to make a call
minCallBestGenoRatio() - Method in class net.maizegenetics.analysis.imputation.LDKNNiImputationHetV3Plugin
Minimum ratio between best and second best genotype to make a call
minCallBestGenoRatio(value) - Method in class net.maizegenetics.analysis.imputation.LDKNNiImputationHetV3Plugin
Set Minimum support ratio for best genotype. Minimum ratio between best and second best genotype to make a call
minClassSize - Variable in class net.maizegenetics.analysis.association.AbstractFixedEffectLM
 
minClassSize() - Method in class net.maizegenetics.analysis.association.FixedEffectLMPlugin
The minimum acceptable genotype class size. Genotypes in a class with a smaller size will be set to missing.
minClassSize(value) - Method in class net.maizegenetics.analysis.association.FixedEffectLMPlugin
Set Minimum Class Size. The minimum acceptable genotype class size. Genotypes in a class with a smaller size will be set to missing.
minClusterSize - Variable in class net.maizegenetics.analysis.imputation.BiparentalHaplotypeFinder
Only use clusters with minClusterSize taxa as parent haplotypes
minCount() - Method in class net.maizegenetics.analysis.gbs.MergeMultipleTagCountPlugin
 
minCount(value) - Method in class net.maizegenetics.analysis.gbs.MergeMultipleTagCountPlugin
 
minCount() - Method in class net.maizegenetics.analysis.gbs.TagCountToFastqPlugin
 
minCount(value) - Method in class net.maizegenetics.analysis.gbs.TagCountToFastqPlugin
 
minCount() - Method in class net.maizegenetics.analysis.gbs.v2.TagExportToFastqPlugin
Minimum count of reads for a tag to be output
minCount(value) - Method in class net.maizegenetics.analysis.gbs.v2.TagExportToFastqPlugin
Set Min Count. Minimum count of reads for a tag to be output
minCoverage - Variable in class net.maizegenetics.analysis.imputation.BiparentalHaplotypeFinder
Filter out sites with coverage less than minCoverage.
minCoverageForDonors() - Method in class net.maizegenetics.analysis.imputation.LDKNNiImputationHetV2Plugin
Minimum coverage for donor genotype and LD calculation
minCoverageForDonors(value) - Method in class net.maizegenetics.analysis.imputation.LDKNNiImputationHetV2Plugin
Set Minimum coverage for donors and LD. Minimum coverage for donor genotype and LD calculation
minCoverageForDonors() - Method in class net.maizegenetics.analysis.imputation.LDKNNiImputationHetV3Plugin
Minimum coverage for donor genotype and LD calculation
minCoverageForDonors(value) - Method in class net.maizegenetics.analysis.imputation.LDKNNiImputationHetV3Plugin
Set Minimum coverage for donors and LD. Minimum coverage for donor genotype and LD calculation
minDepth() - Method in class net.maizegenetics.analysis.data.MaskGenotypePlugin
Minimum depth required before masking.
minDepth(value) - Method in class net.maizegenetics.analysis.data.MaskGenotypePlugin
Set Min Depth. Minimum depth required before masking.
minDepth() - Method in class net.maizegenetics.analysis.data.SetLowDepthGenosToMissingPlugin
Min Depth
minDepth(value) - Method in class net.maizegenetics.analysis.data.SetLowDepthGenosToMissingPlugin
Set Min Depth. Min Depth
minDist() - Method in class net.maizegenetics.analysis.data.ThinSitesByPositionPlugin
Minimum distance in bp between adjacent sites
minDist(value) - Method in class net.maizegenetics.analysis.data.ThinSitesByPositionPlugin
Set Minimum distance. Minimum distance in bp between adjacent sites
minHap() - Method in class net.maizegenetics.analysis.imputation.FSFHapImputationPlugin
haplotype must be observed at least this often
minHap(value) - Method in class net.maizegenetics.analysis.imputation.FSFHapImputationPlugin
Set Min Hap. haplotype must be observed at least this often
minHeterozygous() - Method in class net.maizegenetics.analysis.filter.FilterSiteBuilderPlugin
Min Heterozygous Proportion
minHeterozygous(value) - Method in class net.maizegenetics.analysis.filter.FilterSiteBuilderPlugin
Set Min Heterozygous Proportion. Min Heterozygous Proportion
minHeterozygous() - Method in class net.maizegenetics.analysis.filter.FilterTaxaBuilderPlugin
Min Heterozygous Proportion
minHeterozygous(value) - Method in class net.maizegenetics.analysis.filter.FilterTaxaBuilderPlugin
Set Min Heterozygous Proportion. Min Heterozygous Proportion
minHeterozygous() - Method in class net.maizegenetics.dna.snp.FilterSite
 
minHeterozygous() - Method in class net.maizegenetics.dna.snp.FilterTaxa
 
minHeterozygousProportion() - Method in class net.maizegenetics.analysis.filter.FilterTaxaPropertiesPlugin
Min Heterozygous Proportion
minHeterozygousProportion(value) - Method in class net.maizegenetics.analysis.filter.FilterTaxaPropertiesPlugin
Set Min Heterozygous Proportion. Min Heterozygous Proportion
minHets() - Method in class net.maizegenetics.analysis.modelfitter.StepwiseAdditiveModelFitterPlugin
The minimum number of individuals that are heterozygous at a site for the dominance term to be included. If the number of hets is less than minHets at a site, an additive only model will be fit for that site.
minHets(value) - Method in class net.maizegenetics.analysis.modelfitter.StepwiseAdditiveModelFitterPlugin
Set Minimum number of heterozygotes. The minimum number of individuals that are heterozygous at a site for the dominance term to be included. If the number of hets is less than minHets at a site, an additive only model will be fit for that site.
minHitCount() - Method in class net.maizegenetics.analysis.gbs.repgen.RepGenAlignerPlugin
Minimum count of hits in a cluster for a reference tag to be created for this cluster
minHitCount(value) - Method in class net.maizegenetics.analysis.gbs.repgen.RepGenAlignerPlugin
Set Min Count. Minimum count of hits in a cluster for a reference tag to be created fro this cluster
minimumClassSize(minsize) - Method in class net.maizegenetics.analysis.association.AbstractFixedEffectLM
 
minimumClassSize(minsize) - Method in interface net.maizegenetics.analysis.association.FixedEffectLM
 
minimumEigenvalue() - Method in class net.maizegenetics.analysis.data.PrincipalComponentsPlugin
All principal components with an eigenvalue greater than or equal to this value will be returned.
minimumEigenvalue(value) - Method in class net.maizegenetics.analysis.data.PrincipalComponentsPlugin
Set minimum eigenvalue. All principal components with an eigenvalue greater than or equal to this value will be returned.
minimumF() - Method in class net.maizegenetics.analysis.gbs.DiscoverySNPCallerPlugin
Minimum F (inbreeding coefficient)
minimumF(value) - Method in class net.maizegenetics.analysis.gbs.DiscoverySNPCallerPlugin
Set Minimum F. Minimum F (inbreeding coefficient)
minimumKmerLength() - Method in class net.maizegenetics.analysis.gbs.repgen.RepGenLoadSeqToDBPlugin
Minimum Tag Length
minimumKmerLength(value) - Method in class net.maizegenetics.analysis.gbs.repgen.RepGenLoadSeqToDBPlugin
Set Minimum Tag Length. Minimum Tag Length
minimumKmerLength() - Method in class net.maizegenetics.analysis.gbs.v2.GBSSeqToTagDBPlugin
Minimum Tag Length
minimumKmerLength(value) - Method in class net.maizegenetics.analysis.gbs.v2.GBSSeqToTagDBPlugin
Set Minimum Tag Length. Minimum Tag Length
minimumKmerLength() - Method in class net.maizegenetics.analysis.rna.RNADeMultiPlexSeqToDBPlugin
Minimum Tag Length
minimumKmerLength(value) - Method in class net.maizegenetics.analysis.rna.RNADeMultiPlexSeqToDBPlugin
Set Minimum Tag Length. Minimum Tag Length
minimumQualityScore() - Method in class net.maizegenetics.analysis.gbs.repgen.RepGenLoadSeqToDBPlugin
Minimum quality score within the barcode and read length to be accepted
minimumQualityScore(value) - Method in class net.maizegenetics.analysis.gbs.repgen.RepGenLoadSeqToDBPlugin
Set Minimum quality score. Minimum quality score within the barcode and read length to be accepted
minimumQualityScore() - Method in class net.maizegenetics.analysis.gbs.repgen.RGBSProductionSNPCallerPlugin
Minimum quality score within the barcode and read length to be accepted
minimumQualityScore(value) - Method in class net.maizegenetics.analysis.gbs.repgen.RGBSProductionSNPCallerPlugin
Set Minimum quality score. Minimum quality score within the barcode and read length to be accepted
minimumQualityScore() - Method in class net.maizegenetics.analysis.gbs.v2.GBSSeqToTagDBPlugin
Minimum quality score within the barcode and read length to be accepted
minimumQualityScore(value) - Method in class net.maizegenetics.analysis.gbs.v2.GBSSeqToTagDBPlugin
Set Minimum quality score. Minimum quality score within the barcode and read length to be accepted
minimumQualityScore() - Method in class net.maizegenetics.analysis.gbs.v2.ProductionSNPCallerPluginV2
Minimum quality score within the barcode and read length to be accepted
minimumQualityScore(value) - Method in class net.maizegenetics.analysis.gbs.v2.ProductionSNPCallerPluginV2
Set Minimum quality score. Minimum quality score within the barcode and read length to be accepted
minimumQualityScore() - Method in class net.maizegenetics.analysis.rna.RNADeMultiPlexSeqToDBPlugin
Minimum quality score within the barcode and read length to be accepted
minimumQualityScore(value) - Method in class net.maizegenetics.analysis.rna.RNADeMultiPlexSeqToDBPlugin
Set Minimum quality score. Minimum quality score within the barcode and read length to be accepted
minKmerCount() - Method in class net.maizegenetics.analysis.gbs.repgen.RepGenLoadSeqToDBPlugin
Minimum tag count
minKmerCount(value) - Method in class net.maizegenetics.analysis.gbs.repgen.RepGenLoadSeqToDBPlugin
Set Min Tag Count. Minimum tag count
minKmerCount() - Method in class net.maizegenetics.analysis.gbs.v2.GBSSeqToTagDBPlugin
Minimum tag count
minKmerCount(value) - Method in class net.maizegenetics.analysis.gbs.v2.GBSSeqToTagDBPlugin
Set Min Tag Count. Minimum tag count
minKmerCount() - Method in class net.maizegenetics.analysis.rna.RNADeMultiPlexSeqToDBPlugin
Minimum tag count
minKmerCount(value) - Method in class net.maizegenetics.analysis.rna.RNADeMultiPlexSeqToDBPlugin
Set Min Tag Count. Minimum tag count
minLocusCoverage() - Method in class net.maizegenetics.analysis.gbs.DiscoverySNPCallerPlugin
Minimum locus coverage (proportion of Taxa with a genotype)
minLocusCoverage(value) - Method in class net.maizegenetics.analysis.gbs.DiscoverySNPCallerPlugin
Set Min Locus Coverage. Minimum locus coverage (proportion of Taxa with a genotype)
minLocusCoverage() - Method in class net.maizegenetics.analysis.gbs.v2.DiscoverySNPCallerPluginV2
Minimum locus coverage (proportion of Taxa with a genotype)
minLocusCoverage(value) - Method in class net.maizegenetics.analysis.gbs.v2.DiscoverySNPCallerPluginV2
Set Min Locus Coverage. Minimum locus coverage (proportion of Taxa with a genotype)
minMaf - Variable in class net.maizegenetics.analysis.imputation.BiparentalHaplotypeFinder
Filter out sites with minimum allele frequency less than minMaf.
minMaf() - Method in class net.maizegenetics.analysis.imputation.FSFHapImputationPlugin
filter out sites with less than minimumMinorAlleleFrequency
minMaf(value) - Method in class net.maizegenetics.analysis.imputation.FSFHapImputationPlugin
Set Min Maf. filter out sites with less than minimumMinorAlleleFrequency
minMAPQ() - Method in class net.maizegenetics.analysis.gbs.v2.SAMToGBSdbPlugin
Minimum value of MAPQ to store the SAM entry
minMAPQ(value) - Method in class net.maizegenetics.analysis.gbs.v2.SAMToGBSdbPlugin
Set SAM minimum MAPQ value. Minimum value of MAPQ to store the SAM entry
minMinorAlleleCount() - Method in class net.maizegenetics.analysis.gbs.DiscoverySNPCallerPlugin
Minimum minor allele count
minMinorAlleleCount(value) - Method in class net.maizegenetics.analysis.gbs.DiscoverySNPCallerPlugin
Set Min Minor Allele Count. Minimum minor allele count
minMinorAlleleFreq() - Method in class net.maizegenetics.analysis.gbs.DiscoverySNPCallerPlugin
Minimum minor allele frequency
minMinorAlleleFreq(value) - Method in class net.maizegenetics.analysis.gbs.DiscoverySNPCallerPlugin
Set Min Minor Allele Freq. Minimum minor allele frequency
minMinorAlleleFreq() - Method in class net.maizegenetics.analysis.gbs.v2.DiscoverySNPCallerPluginV2
Minimum minor allele frequency
minMinorAlleleFreq(value) - Method in class net.maizegenetics.analysis.gbs.v2.DiscoverySNPCallerPluginV2
Set Min Minor Allele Freq. Minimum minor allele frequency
minNotMissing() - Method in class net.maizegenetics.analysis.filter.FilterTaxaBuilderPlugin
Min Proportion of Sites Present
minNotMissing(value) - Method in class net.maizegenetics.analysis.filter.FilterTaxaBuilderPlugin
Set Min Proportion of Sites Present. Min Proportion of Sites Present
minNotMissing() - Method in class net.maizegenetics.dna.snp.FilterTaxa
 
minNotMissingProportion - Variable in class net.maizegenetics.analysis.imputation.BiparentalHaplotypeFinder
Only cluster haplotypes with a minimum number of non missing values.
minNumOfMinorAllelesToCompare() - Method in class net.maizegenetics.analysis.imputation.FILLINImputationPlugin
Minimum number of informative minor alleles in the search window (or 10X major)
minNumOfMinorAllelesToCompare(value) - Method in class net.maizegenetics.analysis.imputation.FILLINImputationPlugin
Set Min num of minor alleles to compare. Minimum number of informative minor alleles in the search window (or 10X major)
MINOR_ALLELE - Static variable in class net.maizegenetics.dna.snp.HapMapHDF5Constants
 
minorAllele(site) - Method in class net.maizegenetics.dna.snp.CombineGenotypeTable
 
minorAllele(site) - Method in class net.maizegenetics.dna.snp.CoreGenotypeTable
 
minorAllele(alleles) - Static method in class net.maizegenetics.dna.snp.genotypecall.AlleleFreqCache
 
minorAllele(site) - Method in interface net.maizegenetics.dna.snp.genotypecall.GenotypeCallTable
Return most common minor allele at given site. Gap is included as state. Heterozygous count one for each allele value. Homozygous counts two for the allele value.
minorAllele(index) - Method in class net.maizegenetics.dna.snp.genotypecall.ListStats
 
minorAllele() - Method in class net.maizegenetics.dna.snp.genotypecall.Stats
 
minorAllele(site) - Method in interface net.maizegenetics.dna.snp.GenotypeTable
Return most common minor allele at given site. Gap is included as state. Heterozygous count one for each allele value. Homozygous counts two for the allele value.
minorAllele(site) - Method in class net.maizegenetics.dna.snp.MergedGenotypeTable
 
minorAllele(site) - Method in class net.maizegenetics.dna.snp.TOPMGenotypeTable
 
minorAlleleAsString(site) - Method in class net.maizegenetics.dna.snp.CombineGenotypeTable
 
minorAlleleAsString(site) - Method in class net.maizegenetics.dna.snp.CoreGenotypeTable
 
minorAlleleAsString(site) - Method in interface net.maizegenetics.dna.snp.genotypecall.GenotypeCallTable
Return most common minor allele at given site. Gap is included as state. Heterozygous count one for each allele value. Homozygous counts two for the allele value.
minorAlleleAsString(site) - Method in interface net.maizegenetics.dna.snp.GenotypeTable
Return most common minor allele at given site. Gap is included as state. Heterozygous count one for each allele value. Homozygous counts two for the allele value.
minorAlleleAsString(site) - Method in class net.maizegenetics.dna.snp.MergedGenotypeTable
 
minorAlleleAsString(site) - Method in class net.maizegenetics.dna.snp.TOPMGenotypeTable
 
minorAlleleCount(site) - Method in class net.maizegenetics.dna.snp.CombineGenotypeTable
 
minorAlleleCount(site) - Method in class net.maizegenetics.dna.snp.CoreGenotypeTable
 
minorAlleleCount(site) - Method in interface net.maizegenetics.dna.snp.genotypecall.GenotypeCallTable
Returns the minor allele count for given site.
minorAlleleCount(site) - Method in interface net.maizegenetics.dna.snp.GenotypeTable
Returns the minor allele count for given site.
minorAlleleCount(site) - Method in class net.maizegenetics.dna.snp.MergedGenotypeTable
 
minorAlleleCount(site) - Method in class net.maizegenetics.dna.snp.TOPMGenotypeTable
 
minorAlleleForAllSites() - Method in interface net.maizegenetics.dna.snp.genotypecall.GenotypeCallTable
Returns minor allele for all sites.
minorAlleleFrequency(site) - Method in class net.maizegenetics.dna.snp.CombineGenotypeTable
 
minorAlleleFrequency(site) - Method in class net.maizegenetics.dna.snp.CoreGenotypeTable
 
minorAlleleFrequency(alleles) - Static method in class net.maizegenetics.dna.snp.genotypecall.AlleleFreqCache
 
minorAlleleFrequency(site) - Method in interface net.maizegenetics.dna.snp.genotypecall.GenotypeCallTable
Return frequency for most common minor allele at given site. Gap is included as state. Heterozygous count one for each allele value. Homozygous counts two for the allele value.
minorAlleleFrequency(index) - Method in class net.maizegenetics.dna.snp.genotypecall.ListStats
 
minorAlleleFrequency() - Method in class net.maizegenetics.dna.snp.genotypecall.Stats
 
minorAlleleFrequency(site) - Method in interface net.maizegenetics.dna.snp.GenotypeTable
Return frequency for most common minor allele at given site. Gap is included as state. Heterozygous count one for each allele value. Homozygous counts two for the allele value.
minorAlleleFrequency(site) - Method in class net.maizegenetics.dna.snp.MergedGenotypeTable
 
minorAlleleFrequency(site) - Method in class net.maizegenetics.dna.snp.TOPMGenotypeTable
 
minorAlleles(site) - Method in class net.maizegenetics.dna.snp.CombineGenotypeTable
 
minorAlleles(site) - Method in class net.maizegenetics.dna.snp.CoreGenotypeTable
 
minorAlleles(site) - Method in interface net.maizegenetics.dna.snp.genotypecall.GenotypeCallTable
Return all minor alleles at given site. Gap is included as state. Heterozygous count one for each allele value. Homozygous counts two for the allele value.
minorAlleles(site) - Method in interface net.maizegenetics.dna.snp.GenotypeTable
Return all minor alleles at given site. Gap is included as state. Heterozygous count one for each allele value. Homozygous counts two for the allele value.
minorAlleles(site) - Method in class net.maizegenetics.dna.snp.MergedGenotypeTable
 
minorAlleles(site) - Method in class net.maizegenetics.dna.snp.TOPMGenotypeTable
 
minP - Variable in class net.maizegenetics.analysis.association.AbstractFixedEffectLM
 
minProportionOfSitesPresent() - Method in class net.maizegenetics.analysis.filter.FilterTaxaPropertiesPlugin
Min Proportion of Sites Present
minProportionOfSitesPresent(value) - Method in class net.maizegenetics.analysis.filter.FilterTaxaPropertiesPlugin
Set Min Proportion of Sites Present. Min Proportion of Sites Present
minQualScore() - Method in class net.maizegenetics.analysis.rna.RNADeMultiplexProductionPlugin
Minimum quality score within the barcode and read length to be accepted
minQualScore(value) - Method in class net.maizegenetics.analysis.rna.RNADeMultiplexProductionPlugin
Set Minimum quality score. Minimum quality score within the barcode and read length to be accepted
minR() - Method in class net.maizegenetics.analysis.imputation.FSFHapImputationPlugin
filter out sites not correlated with neighboring sites
minR(value) - Method in class net.maizegenetics.analysis.imputation.FSFHapImputationPlugin
Set Min R. filter out sites not correlated with neighboring sites
minR2 - Variable in class net.maizegenetics.analysis.imputation.BiparentalHaplotypeFinder
Filter out sites with less than minR2 average r-square with neighboring sites (window size = 50).
minSitesToCluster() - Method in class net.maizegenetics.analysis.imputation.FILLINFindHaplotypesPlugin
The minimum number of sites present in two taxa to compare genetic distance to evaluate similarity for clustering
minSitesToCluster(value) - Method in class net.maizegenetics.analysis.imputation.FILLINFindHaplotypesPlugin
Set Min sites to cluster. The minimum number of sites present in two taxa to compare genetic distance to evaluate similarity for clustering
minSitesToTestMatch() - Method in class net.maizegenetics.analysis.imputation.FILLINFindHaplotypesPlugin
Minimum number of present sites within input sequence to do the search
minSitesToTestMatch(value) - Method in class net.maizegenetics.analysis.imputation.FILLINFindHaplotypesPlugin
Set Min sites to test match. Minimum number of present sites within input sequence to do the search
minSitesToTestMatch() - Method in class net.maizegenetics.analysis.imputation.FILLINImputationPlugin
Minimum number of sites to test for IBS between haplotype and target in focus block
minSitesToTestMatch(value) - Method in class net.maizegenetics.analysis.imputation.FILLINImputationPlugin
Set Min sites to test match. Minimum number of sites to test for IBS between haplotype and target in focus block
minTagCount(value) - Method in class net.maizegenetics.analysis.gbs.FastqToTagCountPlugin
 
minTagCount() - Method in class net.maizegenetics.analysis.gbs.FastqToTagCountPlugin
 
minTagCount() - Method in class net.maizegenetics.analysis.gbs.repgen.RampSeqAlignFromBlastTags
Minimum count of reads for a tag to be aligned
minTagCount(value) - Method in class net.maizegenetics.analysis.gbs.repgen.RampSeqAlignFromBlastTags
Set Min Tag Count. Minimum count of reads for a tag to be aligned
minTagCount() - Method in class net.maizegenetics.analysis.gbs.repgen.RepGenAlignerPlugin
Minimum count of reads for a tag to be output
minTagCount(value) - Method in class net.maizegenetics.analysis.gbs.repgen.RepGenAlignerPlugin
Set Min Count. Minimum count of reads for a tag to be output
minTagCount() - Method in class net.maizegenetics.analysis.gbs.repgen.RepGenPhase2AlignerPlugin
Minimum count of reads for a tag to be output
minTagCount(value) - Method in class net.maizegenetics.analysis.gbs.repgen.RepGenPhase2AlignerPlugin
Set Min Count. Minimum count of reads for a tag to be output
minTaxa() - Method in class net.maizegenetics.analysis.gbs.repgen.RepGenLDAnalysisPlugin
Minimum number of taxa that must be present for R-squared to be calculated.
minTaxa(value) - Method in class net.maizegenetics.analysis.gbs.repgen.RepGenLDAnalysisPlugin
Set Min Taxa for RSquared. Minimum number of taxa that must be present for R-squared to be calculated.
minTaxa() - Method in class net.maizegenetics.analysis.gbs.repgen.RepGenLoadSeqToDBPlugin
Minimum taxa containing tag
minTaxa(value) - Method in class net.maizegenetics.analysis.gbs.repgen.RepGenLoadSeqToDBPlugin
Set Min Taxa Count. Minimum Taxa count
minTaxaToGenerateAHaplotype() - Method in class net.maizegenetics.analysis.imputation.FILLINFindHaplotypesPlugin
Minimum number of taxa to generate a haplotype
minTaxaToGenerateAHaplotype(value) - Method in class net.maizegenetics.analysis.imputation.FILLINFindHaplotypesPlugin
Set Min taxa to generate a haplotype. Minimum number of taxa to generate a haplotype
minus(dm) - Method in class net.maizegenetics.matrixalgebra.Matrix.BlasDoubleMatrix
 
minus(dm) - Method in class net.maizegenetics.matrixalgebra.Matrix.ColtDoubleMatrix
 
minus(dm) - Method in interface net.maizegenetics.matrixalgebra.Matrix.DoubleMatrix
 
minus(dm) - Method in class net.maizegenetics.matrixalgebra.Matrix.EJMLDoubleMatrix
 
minus(parent, taxaToRemove) - Static method in class net.maizegenetics.taxa.distance.DistanceMatrixUtils
Returns a distance matrix with the specified taxa removed.
minusEquals(dm) - Method in class net.maizegenetics.matrixalgebra.Matrix.BlasDoubleMatrix
 
minusEquals(dm) - Method in class net.maizegenetics.matrixalgebra.Matrix.ColtDoubleMatrix
 
minusEquals(dm) - Method in interface net.maizegenetics.matrixalgebra.Matrix.DoubleMatrix
This function subtracts dm, modifying the original matrix
minusEquals(dm) - Method in class net.maizegenetics.matrixalgebra.Matrix.EJMLDoubleMatrix
 
minusLog10P(p) - Method in class net.maizegenetics.analysis.gbs.AnnotateTOPM
Return -log10(p-value), if p-value doesn't exist(p < 0), reutrn Double.NEGATIVE_INFINITY
mismatch_penalty - Variable in class net.maizegenetics.analysis.gbs.neobio.BasicScoringScheme
The penalty for a mismatch (a substitution of different characters).
mismatch_penalty() - Method in class net.maizegenetics.analysis.gbs.repgen.RampSeqAlignFromBlastTags
Parameter sent to Smith Waterman aligner for use in calculating penalty when base pairs are mis-matched.
mismatch_penalty(value) - Method in class net.maizegenetics.analysis.gbs.repgen.RampSeqAlignFromBlastTags
Set Mismatch Penalty Amount. Parameter sent to Smith Waterman aligner for use in calculating penalty when base pairs are mis-matched.
mismatch_penalty() - Method in class net.maizegenetics.analysis.gbs.repgen.RepGenAlignerPlugin
Parameter sent to Smith Waterman aligner for use in calculating penalty when base pairs are mis-matched.
mismatch_penalty(value) - Method in class net.maizegenetics.analysis.gbs.repgen.RepGenAlignerPlugin
Set Mismatch Penalty Amount. Parameter sent to Smith Waterman aligner for use in calculating penalty when base pairs are mis-matched.
mismatch_penalty() - Method in class net.maizegenetics.analysis.gbs.repgen.RepGenPhase2AlignerPlugin
Parameter sent to Smith Waterman aligner for use in calculating penalty when base pairs are mis-matched.
mismatch_penalty(value) - Method in class net.maizegenetics.analysis.gbs.repgen.RepGenPhase2AlignerPlugin
Set Mismatch Penalty Amount. Parameter sent to Smith Waterman aligner for use in calculating penalty when base pairs are mis-matched.
MISMATCH_TAG - Static variable in class net.maizegenetics.analysis.gbs.neobio.PairwiseAlignmentAlgorithm
Character that signals a mismatch in the score tag line of an alignment.
missing - Variable in class net.maizegenetics.analysis.modelfitter.StepwiseAdditiveModelFitter
 
missing() - Method in class net.maizegenetics.phenotype.CategoricalAttribute
 
missing() - Method in class net.maizegenetics.phenotype.NumericAttribute
 
missing() - Method in interface net.maizegenetics.phenotype.PhenotypeAttribute
 
missing() - Method in class net.maizegenetics.phenotype.TaxaAttribute
 
missingObsForSite - Variable in class net.maizegenetics.analysis.association.AbstractFixedEffectLM
 
missingValue - Static variable in class net.maizegenetics.phenotype.CategoricalAttribute
 
missToZero() - Method in class net.maizegenetics.analysis.monetdb.ColumnsToBinaryFullGenomeTablePlugin
Will set missing float denoted column values to zero (otherwise they are set to Float.MIN
missToZero(value) - Method in class net.maizegenetics.analysis.monetdb.ColumnsToBinaryFullGenomeTablePlugin
Set Missing float values to zero?. Will set missing float denoted column values to zero (otherwise they are set to Float.MIN
missToZero() - Method in class net.maizegenetics.analysis.monetdb.ColumnsToBinarySNPOnlyTablePlugin
Will set missing float denoted column values to zero (otherwise they are set to Float.MIN
missToZero(value) - Method in class net.maizegenetics.analysis.monetdb.ColumnsToBinarySNPOnlyTablePlugin
Set Missing float values to zero?. Will set missing float denoted column values to zero (otherwise they are set to Float.MIN
mkFastaFile(fFastaFileS, bFastaFileS) - Method in class net.maizegenetics.dna.tag.AbstractPETags
Write forword and backword fasta files of PE tag for Bowtie2 alignment, the sequence is in format of index_f/b_c/n, where f means forward, b means backword, c means contig, n means no contig When contig exist, the forward and backword tags are the contig and reverse complement of the contig, respectively.
mkFastaFile(tagsFFastaFileS, tagsBFastaFileS, contigFastaFileS) - Method in class net.maizegenetics.dna.tag.AbstractPETags
Deprecated. 
MLMPlugin - Class in net.maizegenetics.analysis.association
 
MLMPlugin(parentFrame, isInteractive) - Constructor for class net.maizegenetics.analysis.association.MLMPlugin
 
MLMPlugin.CompressionType - Enum in net.maizegenetics.analysis.association
 
model(missingObs, numberOfNonmissingObs) - Method in class net.maizegenetics.analysis.association.PhenotypeLM
 
modelCriterion() - Method in class net.maizegenetics.analysis.modelfitter.StepwiseAdditiveModelFitterPlugin
The model selection criterion used to determine which terms enter the model and how many. Value must be one of pval, bic, mbic, or aic
modelCriterion(value) - Method in class net.maizegenetics.analysis.modelfitter.StepwiseAdditiveModelFitterPlugin
Set Model selection criterion. The model selection criterion used to determine which terms enter the model and how many. Value must be one of pval, bic, mbic, or aic
ModelEffect - Interface in net.maizegenetics.stats.linearmodels
 
ModelEffectUtils - Class in net.maizegenetics.stats.linearmodels
 
modelSelectionCriterion - Variable in class net.maizegenetics.analysis.modelfitter.StepwiseAdditiveModelFitter
 
modelSelectionCriterion(criterion) - Method in class net.maizegenetics.analysis.modelfitter.StepwiseAdditiveModelFitter
 
modelTrainingPlugin() - Method in class net.maizegenetics.analysis.gbs.pana.PanAUsageExample
 
modelType() - Method in class net.maizegenetics.analysis.modelfitter.StepwiseOLSModelFitterPlugin
The model selection criteria used to determine which terms enter the model and how many. Value must be one of pvalue, bic, mbic, or aic
modelType(value) - Method in class net.maizegenetics.analysis.modelfitter.StepwiseOLSModelFitterPlugin
Set Model type. The model selection criteria used to determine which terms enter the model and how many. Value must be one of pvalue, bic, mbic, or aic
ModifyTBTHDF5Plugin - Class in net.maizegenetics.analysis.gbs
This pipeline modifies TagsByTaxa HDF5 file with data organized by taxa. It can: 1. Create an empty TBT. 2. Merge two TBT 3. Combined similarly named taxa 4. Pivot a taxa TBT to a tag TBT
ModifyTBTHDF5Plugin() - Constructor for class net.maizegenetics.analysis.gbs.ModifyTBTHDF5Plugin
 
ModifyTBTHDF5Plugin(parentFrame, isInteractive) - Constructor for class net.maizegenetics.analysis.gbs.ModifyTBTHDF5Plugin
 
moment(n, k, m) - Static method in class net.maizegenetics.stats.statistics.ParetoDistribution
moments E(X^n) of the Pareto distribution
MonetDB_IFLFilePlugin - Class in net.maizegenetics.analysis.gobii
This class has methods to create GOBII intermediary files to be used when creating a GOBII monetdb dataset table. The GOBII IFL scripts require 3 files: a matrix of variants, a list of maker_ids, and a list of dnarun ids. The matrix of variants is created from the hmp.txt file at the same time the intermediary files for the postgres marker and dnarun related tables are created. (see MarkerDNARunFromHMP_IFLFilePlugin) Once the IFL scripts have been run to populate these postgres tables, the marker_id and dnarun_id values are created. This script pulls the id values from the postgres DB to create the final 2 intermediary files needed by the GOBII loadVariantMatrix.py script See this link for details: http://cbsugobii05.tc.cornell.edu:6084/display/TD/MonetDB+IFL The db config file should look like this: host=cbsudc01.tc.cornell.edu user= password= DB=gobii_maizeifltest (or other postgres db you want to query) The outputDir field should also contain the prefix for the file. Previously this was the dataset.name. But GOBII names their .h5 and monetdb table with DS_. We want to do the same to be consistent. THis will need to be queried from the db before running this plugin. If the dataset name is known, this is a simple query. AUgust2016 UPDATE: The list of markers in the marker_id, and dnarun_ids in dnarun_id file must be in proper order. They must be in the order the markers are stored in the monetdb table, ie in the order they are stored in the variant file. TO achieve this, the DB query orders the output by marker_idx (marker query) and dnarun_idx (dnarun query). These idx values were created sequentially when the marker and dnarun tables were created.
MonetDB_IFLFilePlugin(parentFrame, isInteractive) - Constructor for class net.maizegenetics.analysis.gobii.MonetDB_IFLFilePlugin
 
MonetDB_IFLFilePlugin() - Constructor for class net.maizegenetics.analysis.gobii.MonetDB_IFLFilePlugin
 
MONTHS - Variable in interface net.maizegenetics.taxa.tree.Units
 
mostFrequentDonorsAcrossFocusBlocks(allDH, maxHypotheses) - Static method in class net.maizegenetics.analysis.imputation.FILLINImputationUtils
Produces a sort list of most prevalent donors across the donorAlignment. It looks at all focus blocks and weights blocks by rank
MotherKey - Static variable in class net.maizegenetics.taxa.Taxon
Standard key for the mother of the taxon
mouseClicked(e) - Method in class net.maizegenetics.tassel.MyTableUI.MyMouseInputListener
 
mouseDragged(e) - Method in class net.maizegenetics.tassel.MyTableUI.MyMouseInputListener
 
mousePressed(e) - Method in class net.maizegenetics.tassel.MyTableUI.MyMouseInputListener
 
moveAllHaplotypesToBiggestCluster(maxdiff) - Method in class net.maizegenetics.analysis.clustering.HaplotypeClusterer
For each cluster, from largest to smallest, move all consistent haplotypes from other clusters to that cluster
moveAllPossibleHaplotypesToCluster(clusterIndex, fromClustersWithHigherIndexOnly, maxdiff) - Method in class net.maizegenetics.analysis.clustering.HaplotypeClusterer
For the indexed cluster, move all haplotypes consistent with the cluster haplotype to this cluster from any other cluster
MTMapping(outfileS) - Method in class net.maizegenetics.analysis.gbs.TagAgainstAnchor
MT genetic mapping
MTMapping() - Method in class net.maizegenetics.analysis.gbs.TagAgainstAnchorHypothesis
MT genetic mapping
mult(dm, transpose, transposedm) - Method in class net.maizegenetics.matrixalgebra.Matrix.BlasDoubleMatrix
 
mult(dm) - Method in class net.maizegenetics.matrixalgebra.Matrix.BlasDoubleMatrix
 
mult(dm, transpose, transposedm) - Method in class net.maizegenetics.matrixalgebra.Matrix.ColtDoubleMatrix
 
mult(dm) - Method in class net.maizegenetics.matrixalgebra.Matrix.ColtDoubleMatrix
 
mult(dm, transpose, transposedm) - Method in interface net.maizegenetics.matrixalgebra.Matrix.DoubleMatrix
Multiply this matrix times another.
mult(dm) - Method in interface net.maizegenetics.matrixalgebra.Matrix.DoubleMatrix
 
mult(dm, transpose, transposedm) - Method in class net.maizegenetics.matrixalgebra.Matrix.EJMLDoubleMatrix
 
mult(dm) - Method in class net.maizegenetics.matrixalgebra.Matrix.EJMLDoubleMatrix
 
multadd(A, B, alpha, beta, transpose, transposeA) - Method in class net.maizegenetics.matrixalgebra.Matrix.BlasDoubleMatrix
 
multadd(A, B, alpha, beta, transpose, transposeA) - Method in class net.maizegenetics.matrixalgebra.Matrix.ColtDoubleMatrix
 
multadd(A, B, alpha, beta, transpose, transposeA) - Method in interface net.maizegenetics.matrixalgebra.Matrix.DoubleMatrix
Using this function for combining multiplication and addition allows the implementing library to optimize the operations. Performs: alpha * XA + beta*B, where X is this matrix
multadd(A, B, alpha, beta, transpose, transposeA) - Method in class net.maizegenetics.matrixalgebra.Matrix.EJMLDoubleMatrix
 
multbc() - Method in class net.maizegenetics.analysis.imputation.FSFHapImputationPlugin
use the multiple backcross algorithm
multbc(value) - Method in class net.maizegenetics.analysis.imputation.FSFHapImputationPlugin
Set Multbc. use the multiple backcross algorithm
MultiDimensionalScalingPlugin - Class in net.maizegenetics.analysis.distance
 
MultiDimensionalScalingPlugin(parent, interactive) - Constructor for class net.maizegenetics.analysis.distance.MultiDimensionalScalingPlugin
 
multimaps - Variable in class net.maizegenetics.dna.map.AbstractTagsOnPhysicalMap
 
MULTIMAPS - Static variable in class net.maizegenetics.dna.tag.GBSHDF5Constants
 
MultiMemberGZIPInputStream - Class in net.maizegenetics.util
 
MultiMemberGZIPInputStream(in, size) - Constructor for class net.maizegenetics.util.MultiMemberGZIPInputStream
 
MultiMemberGZIPInputStream(in) - Constructor for class net.maizegenetics.util.MultiMemberGZIPInputStream
 
MultiParameterized - Class in net.maizegenetics.taxa.tree
Title: MultiParameterized
MultiParameterized(bases) - Constructor for class net.maizegenetics.taxa.tree.MultiParameterized
 
MultiParameterized(bases, watcher) - Constructor for class net.maizegenetics.taxa.tree.MultiParameterized
 
MultiParameterized.ParameterAccessWatcher - Interface in net.maizegenetics.taxa.tree
An interface for classes that wish to find out about particular parameter access
multiplePrint(out, c, num) - Method in class net.maizegenetics.util.FormattedOutput
repeatedly print a character
multMatrices(A, nrowsA, ncolsA, B, nrowsB, ncolsB, C, alpha, beta, transA, transB) - Static method in class net.maizegenetics.matrixalgebra.Matrix.BlasDoubleMatrix
 
myAlignmentTableModel - Variable in class net.maizegenetics.gui.AlignmentTableCellRenderer
 
myAttributeList - Variable in class net.maizegenetics.phenotype.CorePhenotype
 
myAttributeNameMap - Variable in class net.maizegenetics.phenotype.CorePhenotype
 
myAttributeTypeList - Variable in class net.maizegenetics.phenotype.CorePhenotype
 
myAttributeTypeMap - Variable in class net.maizegenetics.phenotype.CorePhenotype
 
myAvailableListModel - Variable in class net.maizegenetics.gui.SelectFromAvailableDialog
 
myBaseModel - Variable in class net.maizegenetics.analysis.association.AbstractFixedEffectLM
 
myBaseModel - Variable in class net.maizegenetics.analysis.modelfitter.AbstractForwardRegression
 
myBaseModel - Variable in class net.maizegenetics.analysis.modelfitter.CovariatePermutationTestSpliterator
 
myBlues - Variable in class net.maizegenetics.analysis.association.PhenotypeLM
 
myChromosomes - Variable in class net.maizegenetics.dna.map.AbstractTagsOnPhysicalMap
 
myCovariateAttributes - Variable in class net.maizegenetics.analysis.association.AbstractFixedEffectLM
 
myCovariateAttributes - Variable in class net.maizegenetics.analysis.association.PhenotypeLM
 
myCurrentSite - Variable in class net.maizegenetics.analysis.association.AbstractFixedEffectLM
 
myCurrentSiteMinimumClassSize - Variable in class net.maizegenetics.analysis.association.AbstractFixedEffectLM
 
myDataAttributes - Variable in class net.maizegenetics.analysis.association.AbstractFixedEffectLM
 
myDataAttributes - Variable in class net.maizegenetics.analysis.association.PhenotypeLM
 
myDatum - Variable in class net.maizegenetics.analysis.association.AbstractFixedEffectLM
 
myDatum - Variable in class net.maizegenetics.analysis.association.PhenotypeLM
 
myFactorAttributes - Variable in class net.maizegenetics.analysis.association.AbstractFixedEffectLM
 
myFactorAttributes - Variable in class net.maizegenetics.analysis.association.PhenotypeLM
 
myFittedVariants - Variable in class net.maizegenetics.analysis.modelfitter.AbstractForwardRegression
 
myGenoPheno - Variable in class net.maizegenetics.analysis.association.AbstractFixedEffectLM
 
myGenoPheno - Variable in class net.maizegenetics.analysis.modelfitter.StepwiseAdditiveModelFitter
 
myGenotype - Variable in class net.maizegenetics.analysis.modelfitter.AbstractForwardRegression
 
myGenotype - Variable in class net.maizegenetics.analysis.modelfitter.StepwiseAdditiveModelFitter
 
myGenotype - Variable in class net.maizegenetics.dna.snp.genotypecall.ListStats
 
myGenotypePhenotype - Variable in class net.maizegenetics.analysis.modelfitter.AbstractForwardRegression
 
myIndexRedirect - Variable in class net.maizegenetics.dna.snp.TranslateIndexRedirect
 
myIsCanceled - Variable in class net.maizegenetics.gui.SelectFromAvailableDialog
 
myIsCaptureSelected - Variable in class net.maizegenetics.gui.SelectFromAvailableDialog
 
myLogger - Static variable in class net.maizegenetics.analysis.association.AbstractFixedEffectLM
 
myLogger - Static variable in interface net.maizegenetics.plugindef.Plugin
 
myMatrix - Variable in class net.maizegenetics.matrixalgebra.Matrix.BlasDoubleMatrix
 
myMaxVariants - Variable in class net.maizegenetics.dna.map.AbstractTagsOnPhysicalMap
 
myModel - Variable in class net.maizegenetics.analysis.association.AbstractFixedEffectLM
 
myModel - Variable in class net.maizegenetics.analysis.modelfitter.AbstractForwardRegression
 
myModel - Variable in class net.maizegenetics.analysis.modelfitter.StepwiseAdditiveModelFitter
 
myNumBlocksRead - Static variable in class net.maizegenetics.dna.snp.genotypecall.GOBIIAvroGenotypeCallTable
 
myNumCacheMisses - Static variable in class net.maizegenetics.dna.snp.genotypecall.GOBIIAvroGenotypeCallTable
 
myNumProcesses - Static variable in class net.maizegenetics.dna.snp.genotypecall.GOBIIAvroGenotypeCallTable
 
myNumSites - Variable in class net.maizegenetics.dna.snp.AbstractMaskMatrix
 
myNumTags - Variable in class net.maizegenetics.dna.map.AbstractTagsOnPhysicalMap
 
myNumTaxa - Variable in class net.maizegenetics.dna.snp.AbstractMaskMatrix
 
myParentPlugin - Variable in class net.maizegenetics.analysis.association.AbstractFixedEffectLM
 
myPermutedData - Variable in class net.maizegenetics.analysis.modelfitter.CovariatePermutationTestSpliterator
 
myPhenotype - Variable in class net.maizegenetics.analysis.association.PhenotypeLM
 
myPhenotype - Variable in class net.maizegenetics.analysis.modelfitter.AbstractForwardRegression
 
myPhenotype - Variable in class net.maizegenetics.analysis.modelfitter.StepwiseAdditiveModelFitter
 
myPopulationData - Variable in class net.maizegenetics.analysis.imputation.BiparentalHaplotypeFinder
 
myPosition - Variable in class net.maizegenetics.stats.linearmodels.SolveByOrthogonalizing.Marker
 
myProgenyIDs - Variable in class net.maizegenetics.analysis.distance.AMatrixPlugin
 
mySelectedListModel - Variable in class net.maizegenetics.gui.SelectFromAvailableDialog
 
mySites - Variable in class net.maizegenetics.analysis.modelfitter.CovariatePermutationTestSpliterator
 
mySites - Variable in class net.maizegenetics.analysis.modelfitter.ForwardStepAdditiveSpliterator
 
mySites - Variable in class net.maizegenetics.analysis.modelfitter.StepwiseAdditiveModelFitter
 
mySweepFast - Variable in class net.maizegenetics.analysis.modelfitter.StepwiseAdditiveModelFitter
 
MyTableUI.MyMouseInputListener - Class in net.maizegenetics.tassel
 
myTaxa - Variable in class net.maizegenetics.analysis.association.PhenotypeLM
 
myTaxaAttribute - Variable in class net.maizegenetics.phenotype.CorePhenotype
 
myTaxaList - Variable in class net.maizegenetics.analysis.association.PhenotypeLM
 
myTimeReading - Static variable in class net.maizegenetics.dna.snp.genotypecall.GOBIIAvroGenotypeCallTable
 
myUniquePositions - Variable in class net.maizegenetics.dna.map.AbstractTagsOnPhysicalMap
 
myWasCancelled - Variable in class net.maizegenetics.plugindef.AbstractPlugin
 

N

N - Static variable in class net.maizegenetics.analysis.clustering.Haplotype
The byte value for missing
n(value) - Method in class net.maizegenetics.analysis.popgen.LDResult.Builder
 
n() - Method in class net.maizegenetics.analysis.popgen.LDResult
 
N - Variable in class net.maizegenetics.stats.EMMA.EMMAforDoubleMatrix
 
naiveComputeColumnMaxima(matrix, col_maxima) - Static method in class net.maizegenetics.analysis.gbs.neobio.Smawk
This is a simpler method for calculating column maxima. It does the same job as computeColumnMaxima, but without complexity of the SMAWK algorithm.
naiveComputeRowMaxima(matrix, row_maxima) - Static method in class net.maizegenetics.analysis.gbs.neobio.Smawk
This is a simpler method for calculating row maxima. It does not use the SMAWK algorithm.
name - Variable in class net.maizegenetics.analysis.gbs.v2.EnzymeList.Enzyme
 
name - Variable in class net.maizegenetics.analysis.imputation.PopulationData
 
name - Variable in class net.maizegenetics.analysis.modelfitter.AbstractAdditiveSite
 
name - Variable in class net.maizegenetics.analysis.modelfitter.SNP
 
name() - Method in class net.maizegenetics.dna.snp.io.ReadBedfile.BedFileRange
 
name() - Method in class net.maizegenetics.dna.tag.AbstractTag
 
name() - Method in interface net.maizegenetics.dna.tag.Tag
 
name(name) - Method in class net.maizegenetics.dna.tag.TagBuilder
 
name() - Method in class net.maizegenetics.phenotype.CategoricalAttribute
 
name - Variable in class net.maizegenetics.phenotype.CorePhenotype
 
name() - Method in class net.maizegenetics.phenotype.CorePhenotype
 
name() - Method in class net.maizegenetics.phenotype.FilterPhenotype
 
name(name) - Method in class net.maizegenetics.phenotype.GenotypePhenotypeBuilder
 
name() - Method in class net.maizegenetics.phenotype.NumericAttribute
 
name() - Method in interface net.maizegenetics.phenotype.Phenotype
 
name() - Method in interface net.maizegenetics.phenotype.PhenotypeAttribute
 
name() - Method in class net.maizegenetics.phenotype.TaxaAttribute
 
name(newName) - Method in class net.maizegenetics.taxa.Taxon.Builder
Set sex: 0=both, 1=female, 2=male (default=0 Both)
nameList() - Method in class net.maizegenetics.analysis.tree.SubsetTreePlugin
List of names to include. This can be a comma separated list of names (no spaces unless surrounded by quotes), file (.txt) with list of names to include, or a taxa list file (.json or .json.gz).
nameList(value) - Method in class net.maizegenetics.analysis.tree.SubsetTreePlugin
Set Name List. List of names to include. This can be a comma separated list of names (no spaces unless surrounded by quotes), file (.txt) with list of names to include, or a taxa list file (.json or .json.gz).
ncols - Variable in class net.maizegenetics.matrixalgebra.Matrix.BlasDoubleMatrix
 
nearest_neighbors() - Method in class net.maizegenetics.analysis.numericaltransform.ImputationPlugin
 
nearest_neighbors(value) - Method in class net.maizegenetics.analysis.numericaltransform.ImputationPlugin
 
NeedlemanWunsch - Class in net.maizegenetics.analysis.gbs.neobio
This class implements the classic global alignment algorithm (with linear gap penalty function) due to S.B.Needleman and C.D.Wunsch (1970).
negToZero() - Method in class net.maizegenetics.analysis.monetdb.ColumnsToBinaryFullGenomeTablePlugin
Will set negative float denoted column values to zero (otherwise they are set to Float.MIN
negToZero(value) - Method in class net.maizegenetics.analysis.monetdb.ColumnsToBinaryFullGenomeTablePlugin
Set Negative floats to zero?. Will set negative float denoted column values to zero (otherwise they are set to Float.MIN
negToZero() - Method in class net.maizegenetics.analysis.monetdb.ColumnsToBinarySNPOnlyTablePlugin
Will set negative float denoted column values to zero (otherwise they are set to Float.MIN
negToZero(value) - Method in class net.maizegenetics.analysis.monetdb.ColumnsToBinarySNPOnlyTablePlugin
Set Negative floats to zero?. Will set negative float denoted column values to zero (otherwise they are set to Float.MIN
NeighborJoiningTree - Class in net.maizegenetics.taxa.tree
constructs a neighbor-joining tree from pairwise distances

Saitou, N., and Nei, M., (1987) The neighbor-joining method: A new method for reconstructing phylogenetic trees. Mol. Biol. Evol, 4(4):406-425,
NeighborJoiningTree(m) - Constructor for class net.maizegenetics.taxa.tree.NeighborJoiningTree
construct NJ tree
neighborLD(a, snp, window, filterBits) - Static method in class net.maizegenetics.analysis.imputation.NucleotideImputationUtils
 
neighbors(n) - Method in class net.maizegenetics.util.DirectedGraph
Gets the successors of the node n
neighbors(n) - Method in interface net.maizegenetics.util.Graph
Gets a collection of the neighbors of a node
neighbors(n) - Method in class net.maizegenetics.util.UndirectedGraph
 
NestedCovariateModelEffect - Class in net.maizegenetics.stats.linearmodels
 
NestedCovariateModelEffect(cme, fme) - Constructor for class net.maizegenetics.stats.linearmodels.NestedCovariateModelEffect
 
NestedCovariateModelEffect(covariate, fme) - Constructor for class net.maizegenetics.stats.linearmodels.NestedCovariateModelEffect
 
NestedCovariateModelEffect(covariate, fme) - Constructor for class net.maizegenetics.stats.linearmodels.NestedCovariateModelEffect
 
NestedCovariatePermutationTestSpliterator - Class in net.maizegenetics.analysis.modelfitter
 
NestedCovariatePermutationTestSpliterator(permutedData, siteList, baseModel, outerEffect) - Constructor for class net.maizegenetics.analysis.modelfitter.NestedCovariatePermutationTestSpliterator
 
nestingEffectName(factorName) - Method in class net.maizegenetics.analysis.modelfitter.StepwiseAdditiveModelFitter
 
nestingFactor - Variable in class net.maizegenetics.analysis.modelfitter.ForwardStepNestedAdditiveSpliterator
 
nestingFactor - Variable in class net.maizegenetics.analysis.modelfitter.StepwiseAdditiveModelFitter
 
nestingFactor() - Method in class net.maizegenetics.analysis.modelfitter.StepwiseAdditiveModelFitterPlugin
Nest markers within this factor. This parameter cannot be set from the command line. Instead, the first factor in the data set will be used.
nestingFactor(value) - Method in class net.maizegenetics.analysis.modelfitter.StepwiseAdditiveModelFitterPlugin
Set Nesting factor. Nest markers within this factor. This parameter cannot be set from the command line. Instead, the first factor in the data set will be used.
nestingFactor() - Method in class net.maizegenetics.analysis.modelfitter.StepwiseOLSModelFitterPlugin
Nest markers within this factor.
nestingFactor(value) - Method in class net.maizegenetics.analysis.modelfitter.StepwiseOLSModelFitterPlugin
Set Nesting factor. Nest markers within this factor.
nestingFactorLevelNames - Variable in class net.maizegenetics.analysis.modelfitter.StepwiseAdditiveModelFitter
 
nestMarkers() - Method in class net.maizegenetics.analysis.modelfitter.StepwiseOLSModelFitterPlugin
Should markers be nested within a model factor
nestMarkers(value) - Method in class net.maizegenetics.analysis.modelfitter.StepwiseOLSModelFitterPlugin
Set Nest markers. Should markers be nested within a model factor
net.maizegenetics.analysis - package net.maizegenetics.analysis
 
net.maizegenetics.analysis.association - package net.maizegenetics.analysis.association
 
net.maizegenetics.analysis.avro - package net.maizegenetics.analysis.avro
 
net.maizegenetics.analysis.b4r - package net.maizegenetics.analysis.b4r
 
net.maizegenetics.analysis.chart - package net.maizegenetics.analysis.chart
 
net.maizegenetics.analysis.clustering - package net.maizegenetics.analysis.clustering
 
net.maizegenetics.analysis.data - package net.maizegenetics.analysis.data
 
net.maizegenetics.analysis.distance - package net.maizegenetics.analysis.distance
 
net.maizegenetics.analysis.filter - package net.maizegenetics.analysis.filter
 
net.maizegenetics.analysis.gbs - package net.maizegenetics.analysis.gbs
 
net.maizegenetics.analysis.gbs.neobio - package net.maizegenetics.analysis.gbs.neobio
 
net.maizegenetics.analysis.gbs.pana - package net.maizegenetics.analysis.gbs.pana
 
net.maizegenetics.analysis.gbs.repgen - package net.maizegenetics.analysis.gbs.repgen
 
net.maizegenetics.analysis.gbs.v2 - package net.maizegenetics.analysis.gbs.v2
 
net.maizegenetics.analysis.gobii - package net.maizegenetics.analysis.gobii
 
net.maizegenetics.analysis.imputation - package net.maizegenetics.analysis.imputation
 
net.maizegenetics.analysis.modelfitter - package net.maizegenetics.analysis.modelfitter
 
net.maizegenetics.analysis.monetdb - package net.maizegenetics.analysis.monetdb
 
net.maizegenetics.analysis.numericaltransform - package net.maizegenetics.analysis.numericaltransform
 
net.maizegenetics.analysis.phg - package net.maizegenetics.analysis.phg
 
net.maizegenetics.analysis.popgen - package net.maizegenetics.analysis.popgen
 
net.maizegenetics.analysis.rna - package net.maizegenetics.analysis.rna
 
net.maizegenetics.analysis.tree - package net.maizegenetics.analysis.tree
 
net.maizegenetics.analysis.workflow - package net.maizegenetics.analysis.workflow
 
net.maizegenetics.dna - package net.maizegenetics.dna
 
net.maizegenetics.dna.map - package net.maizegenetics.dna.map
 
net.maizegenetics.dna.pd - package net.maizegenetics.dna.pd
 
net.maizegenetics.dna.read - package net.maizegenetics.dna.read
 
net.maizegenetics.dna.snp - package net.maizegenetics.dna.snp
 
net.maizegenetics.dna.snp.bit - package net.maizegenetics.dna.snp.bit
 
net.maizegenetics.dna.snp.byte2d - package net.maizegenetics.dna.snp.byte2d
 
net.maizegenetics.dna.snp.genotypecall - package net.maizegenetics.dna.snp.genotypecall
 
net.maizegenetics.dna.snp.io - package net.maizegenetics.dna.snp.io
 
net.maizegenetics.dna.snp.score - package net.maizegenetics.dna.snp.score
 
net.maizegenetics.dna.tag - package net.maizegenetics.dna.tag
 
net.maizegenetics.gui - package net.maizegenetics.gui
 
net.maizegenetics.matrixalgebra.decomposition - package net.maizegenetics.matrixalgebra.decomposition
 
net.maizegenetics.matrixalgebra.Matrix - package net.maizegenetics.matrixalgebra.Matrix
 
net.maizegenetics.phenotype - package net.maizegenetics.phenotype
 
net.maizegenetics.pipeline - package net.maizegenetics.pipeline
 
net.maizegenetics.plugindef - package net.maizegenetics.plugindef
 
net.maizegenetics.prefs - package net.maizegenetics.prefs
 
net.maizegenetics.progress - package net.maizegenetics.progress
 
net.maizegenetics.stats.EMMA - package net.maizegenetics.stats.EMMA
 
net.maizegenetics.stats.linearmodels - package net.maizegenetics.stats.linearmodels
 
net.maizegenetics.stats.math - package net.maizegenetics.stats.math
 
net.maizegenetics.stats.PCA - package net.maizegenetics.stats.PCA
 
net.maizegenetics.stats.statistics - package net.maizegenetics.stats.statistics
 
net.maizegenetics.tassel - package net.maizegenetics.tassel
 
net.maizegenetics.taxa - package net.maizegenetics.taxa
 
net.maizegenetics.taxa.distance - package net.maizegenetics.taxa.distance
 
net.maizegenetics.taxa.tree - package net.maizegenetics.taxa.tree
 
net.maizegenetics.util - package net.maizegenetics.util
 
net.maizegenetics.util.db - package net.maizegenetics.util.db
 
networkFilter() - Method in class net.maizegenetics.analysis.gbs.Clusters
 
new_char - Variable in class net.maizegenetics.analysis.gbs.neobio.Factor
The new character of this factor.
NewickUtils - Class in net.maizegenetics.taxa.tree
 
newShuffledArray(in) - Static method in class net.maizegenetics.stats.linearmodels.BasicShuffler
 
next - Variable in class net.maizegenetics.analysis.gbs.neobio.Factor
A pointer to the next factor.
next() - Method in class net.maizegenetics.util.db.ResultSetIterator
 
next() - Method in class net.maizegenetics.util.UndirectedGraph.UndirectedIterator
 
nextBoolean() - Method in class net.maizegenetics.stats.math.MersenneTwisterFast
 
nextByte() - Method in class net.maizegenetics.stats.math.MersenneTwisterFast
 
nextBytes(bytes) - Method in class net.maizegenetics.stats.math.MersenneTwisterFast
 
nextChar() - Method in class net.maizegenetics.stats.math.MersenneTwisterFast
 
nextDouble() - Method in class net.maizegenetics.stats.math.MersenneTwisterFast
 
nextFloat() - Method in class net.maizegenetics.stats.math.MersenneTwisterFast
 
nextGaussian() - Method in class net.maizegenetics.stats.math.MersenneTwisterFast
 
nextHighestPowerOfTwo(v) - Static method in class net.maizegenetics.util.BitUtil
returns the next highest power of two, or the current value if it's already a power of two or zero
nextHighestPowerOfTwo(v) - Static method in class net.maizegenetics.util.BitUtil
returns the next highest power of two, or the current value if it's already a power of two or zero
nextInt() - Method in class net.maizegenetics.stats.math.MersenneTwisterFast
 
nextInt(n) - Method in class net.maizegenetics.stats.math.MersenneTwisterFast
Returns an integer drawn uniformly from 0 to n-1. Suffice it to say, n must be > 0, or an IllegalArgumentException is raised.
nextLine(in) - Method in class net.maizegenetics.util.FormattedInput
go to the beginning of the next line. Recognized line terminators: Unix: \n, DOS: \r\n, Macintosh: \r
nextLong() - Method in class net.maizegenetics.stats.math.MersenneTwisterFast
 
nextSetBit(index) - Method in interface net.maizegenetics.util.BitSet
Returns the index of the first set bit starting at the index specified. -1 is returned if there are no more set bits.
nextSetBit(index) - Method in interface net.maizegenetics.util.BitSet
Returns the index of the first set bit starting at the index specified. -1 is returned if there are no more set bits.
nextSetBit(index) - Method in class net.maizegenetics.util.OpenBitSet
Returns the index of the first set bit starting at the index specified. -1 is returned if there are no more set bits.
nextSetBit(index) - Method in class net.maizegenetics.util.OpenBitSet
Returns the index of the first set bit starting at the index specified. -1 is returned if there are no more set bits.
nextSetBit(index) - Method in class net.maizegenetics.util.UnmodifiableBitSet
 
nextSetBit(index) - Method in class net.maizegenetics.util.UnmodifiableBitSet
 
nextShort() - Method in class net.maizegenetics.stats.math.MersenneTwisterFast
 
nIterations() - Method in class net.maizegenetics.analysis.association.GenomicSelectionPlugin
Number of iterations when running k-fold cross-validation (default = 20)
nIterations(value) - Method in class net.maizegenetics.analysis.association.GenomicSelectionPlugin
Set Number of iterations. Number of iterations when running k-fold cross-validation (default = 20)
nobs - Variable in class net.maizegenetics.analysis.modelfitter.ForwardStepAdditiveSpliterator
 
Node - Interface in net.maizegenetics.taxa.tree
interface for a node (includes branch) in a binary/non-binary rooted/unrooted tree
NODE_HEIGHT_SE - Variable in interface net.maizegenetics.taxa.tree.AttributeNode
attribute name for the standard error on a node's height.
NODE_TYPE_ASSOCIATIONS - Static variable in class net.maizegenetics.tassel.DataTreePanel
 
NODE_TYPE_DATA - Static variable in class net.maizegenetics.tassel.DataTreePanel
 
NODE_TYPE_DEFAULT - Static variable in class net.maizegenetics.tassel.DataTreePanel
 
NODE_TYPE_DIVERSITY - Static variable in class net.maizegenetics.tassel.DataTreePanel
 
NODE_TYPE_FILTERS - Static variable in class net.maizegenetics.tassel.DataTreePanel
 
NODE_TYPE_FUSIONS - Static variable in class net.maizegenetics.tassel.DataTreePanel
 
NODE_TYPE_GENO_SUMMARY - Static variable in class net.maizegenetics.tassel.DataTreePanel
 
NODE_TYPE_HDF5_SCHEMA - Static variable in class net.maizegenetics.tassel.DataTreePanel
 
NODE_TYPE_LD - Static variable in class net.maizegenetics.tassel.DataTreePanel
 
NODE_TYPE_LISTS - Static variable in class net.maizegenetics.tassel.DataTreePanel
 
NODE_TYPE_MATRIX - Static variable in class net.maizegenetics.tassel.DataTreePanel
 
NODE_TYPE_NUMERICAL - Static variable in class net.maizegenetics.tassel.DataTreePanel
 
NODE_TYPE_POLYMORPHISMS - Static variable in class net.maizegenetics.tassel.DataTreePanel
 
NODE_TYPE_RESULT - Static variable in class net.maizegenetics.tassel.DataTreePanel
 
NODE_TYPE_SEQUENCE - Static variable in class net.maizegenetics.tassel.DataTreePanel
 
NODE_TYPE_SNP_ASSAYS - Static variable in class net.maizegenetics.tassel.DataTreePanel
 
NODE_TYPE_STEPWISE - Static variable in class net.maizegenetics.tassel.DataTreePanel
 
NODE_TYPE_SYNONYMIZER - Static variable in class net.maizegenetics.tassel.DataTreePanel
 
NODE_TYPE_SYNONYMS - Static variable in class net.maizegenetics.tassel.DataTreePanel
 
NODE_TYPE_TOPM - Static variable in class net.maizegenetics.tassel.DataTreePanel
 
NODE_TYPE_TREE - Static variable in class net.maizegenetics.tassel.DataTreePanel
 
NODE_TYPE_VARIANCES - Static variable in class net.maizegenetics.tassel.DataTreePanel
 
NodeFactory - Class in net.maizegenetics.taxa.tree
 
noDepthOutput() - Method in class net.maizegenetics.analysis.data.MergeRenameDeleteTaxaPlugin
No depth output: do not write depths to the output genotypes file (applies only to hdf5 or VCF)
noDepthOutput(value) - Method in class net.maizegenetics.analysis.data.MergeRenameDeleteTaxaPlugin
Set No Depth Output. No depth output: do not write depths to the output genotypes file (applies only to hdf5 or VCF)
noDepthToOutput() - Method in class net.maizegenetics.analysis.gbs.ProductionSNPCallerPlugin
No depth output: do not write depths to the output hdf5 genotypes file
noDepthToOutput(value) - Method in class net.maizegenetics.analysis.gbs.ProductionSNPCallerPlugin
Set No Depth to Output. No depth output: do not write depths to the output hdf5 genotypes file
nodes($receiver) - Static method in class net.maizegenetics.taxa.tree.NewickUtils
Extension function that returns all nodes of the tree
nodes() - Method in class net.maizegenetics.util.DirectedGraph
 
nodes() - Method in interface net.maizegenetics.util.Graph
Gets a list of nodes in the graph
nodes() - Method in class net.maizegenetics.util.UndirectedGraph
 
nodesIter() - Method in class net.maizegenetics.util.DirectedGraph
 
nodesIter() - Method in interface net.maizegenetics.util.Graph
Gets an iterator over the nodes
nodesIter() - Method in class net.maizegenetics.util.UndirectedGraph
 
NodeUtils - Class in net.maizegenetics.taxa.tree
Helper routines for dealing with nodes.
nohets() - Method in class net.maizegenetics.analysis.imputation.FSFHapImputationPlugin
delete heterozygous calls before imputing
nohets(value) - Method in class net.maizegenetics.analysis.imputation.FSFHapImputationPlugin
Set Nohets. delete heterozygous calls before imputing
noIndex() - Method in class net.maizegenetics.taxa.TaxaListBuilder
 
NormalDistribution - Class in net.maizegenetics.stats.statistics
normal distribution (pdf, cdf, quantile)
not() - Method in class net.maizegenetics.util.OpenBitSet
this = not(this)
notMissingCount - Variable in class net.maizegenetics.analysis.clustering.Haplotype
The number of non missing values in the sequence
noTranslation(numIndices) - Static method in class net.maizegenetics.dna.snp.TranslateIndexBuilder
Returns no translation instance.
notXor(other) - Method in class net.maizegenetics.util.OpenBitSet
this = not(this XOR other)
Nran - Variable in class net.maizegenetics.stats.EMMA.EMMAforDoubleMatrix
 
nregions - Variable in class net.maizegenetics.stats.EMMA.EMMAforDoubleMatrix
 
nrows - Variable in class net.maizegenetics.matrixalgebra.Matrix.BlasDoubleMatrix
 
nsites - Variable in class net.maizegenetics.analysis.modelfitter.ForwardStepAdditiveSpliterator
 
ntaxa - Variable in class net.maizegenetics.analysis.modelfitter.GenotypeAdditiveSite
 
ntz(val) - Static method in class net.maizegenetics.util.BitUtil
Returns number of trailing zeros in a 64 bit long value.
ntz(val) - Static method in class net.maizegenetics.util.BitUtil
Returns number of trailing zeros in a 32 bit int value.
ntz2(x) - Static method in class net.maizegenetics.util.BitUtil
returns 0 based index of first set bit (only works for x!=0)
This is an alternate implementation of ntz()
ntz3(x) - Static method in class net.maizegenetics.util.BitUtil
returns 0 based index of first set bit
This is an alternate implementation of ntz()
ntzTable - Static variable in class net.maizegenetics.util.BitUtil
table of number of trailing zeros in a byte
nucleotide(val) - Method in class net.maizegenetics.dna.map.GeneralPosition.Builder
Set whether position is nucleotide (default=true)
NUCLEOTIDE_ALLELES - Static variable in class net.maizegenetics.dna.snp.NucleotideAlignmentConstants
 
NUCLEOTIDE_IUPAC_HASH - Static variable in class net.maizegenetics.dna.snp.NucleotideAlignmentConstants
 
NucleotideAlignmentConstants - Class in net.maizegenetics.dna.snp
 
nucleotideBytetoString(b) - Static method in class net.maizegenetics.dna.snp.NucleotideAlignmentConstants
Convert a nucleotide byte array to a string
NucleotideImputationUtils - Class in net.maizegenetics.analysis.imputation
 
Null() - Constructor for class net.maizegenetics.taxa.tree.Parameterized.Null
 
nullable() - Method in class net.maizegenetics.plugindef.PluginParameter.Builder
 
NUM_ALLELE_DEPTH_TYPES - Static variable in class net.maizegenetics.dna.snp.score.AlleleDepth
 
num_chars - Variable in class net.maizegenetics.analysis.gbs.neobio.FactorSequence
The numbers of character represented by this sequence.
num_cols - Variable in class net.maizegenetics.analysis.gbs.neobio.CrochemoreLandauZivUkelson
Number of columns of the block table. It is determined by the number of factors of the second sequence.
num_factors - Variable in class net.maizegenetics.analysis.gbs.neobio.FactorSequence
The numbers of factors generated by the LZ78 parsing of the sequence.
NUM_HAPMAP_NON_TAXA_HEADERS - Static variable in class net.maizegenetics.dna.snp.ImportUtils
 
NUM_LD_BINS - Static variable in class net.maizegenetics.dna.snp.HapMapHDF5Constants
 
NUM_LINES_PER_INTERVAL - Static variable in class net.maizegenetics.dna.snp.io.LineIndex
 
num_rows - Variable in class net.maizegenetics.analysis.gbs.neobio.CrochemoreLandauZivUkelson
Number of rows of the block table. It is determined by the number of factors of the first sequence.
NUM_SBIT_WORDS - Static variable in class net.maizegenetics.dna.snp.HapMapHDF5Constants
 
NUM_SITES - Static variable in class net.maizegenetics.dna.snp.HapMapHDF5Constants
 
NUM_TAXA - Static variable in class net.maizegenetics.dna.snp.HapMapHDF5Constants
 
NUM_TBIT_WORDS - Static variable in class net.maizegenetics.dna.snp.HapMapHDF5Constants
 
numAllMinorAlleles() - Method in class net.maizegenetics.dna.snp.genotypecall.Stats
 
numAnnotations() - Method in interface net.maizegenetics.util.GeneralAnnotation
Returns number of annotations including when counts of multiple values for same key.
numAnnotations() - Method in class net.maizegenetics.util.GeneralAnnotationStorage
 
numAttributes() - Method in interface net.maizegenetics.dna.snp.Filter
 
numAttributes() - Method in class net.maizegenetics.dna.snp.FilterSite
 
numAttributes() - Method in class net.maizegenetics.dna.snp.FilterTaxa
 
NUMBER_NUCLEOTIDE_ALLELES - Static variable in class net.maizegenetics.dna.snp.NucleotideAlignmentConstants
Number of nucleotide states excluding rare and unknown.
numberBasesPlusOrMinus() - Method in class net.maizegenetics.analysis.data.FeatureListToPositionsPlugin
Number of bases plus or minus the range of each feature
numberBasesPlusOrMinus(value) - Method in class net.maizegenetics.analysis.data.FeatureListToPositionsPlugin
Set Number Bases Plus Or Minus. Number of bases plus or minus the range of each feature
numberOfAlleleReportColumns - Variable in class net.maizegenetics.analysis.association.AbstractFixedEffectLM
 
numberOfAttributes - Variable in class net.maizegenetics.phenotype.CorePhenotype
 
numberOfAttributes() - Method in class net.maizegenetics.phenotype.CorePhenotype
 
numberOfAttributes() - Method in class net.maizegenetics.phenotype.FilterPhenotype
 
numberOfAttributes() - Method in interface net.maizegenetics.phenotype.Phenotype
 
numberOfAttributesOfType(type) - Method in class net.maizegenetics.phenotype.CorePhenotype
 
numberOfAttributesOfType(type) - Method in class net.maizegenetics.phenotype.FilterPhenotype
 
numberOfAttributesOfType(type) - Method in interface net.maizegenetics.phenotype.Phenotype
 
numberOfAxes() - Method in class net.maizegenetics.analysis.distance.MultiDimensionalScalingPlugin
The number of axes or dimensions and associated eigenvalues to be returned by the analysis.
numberOfAxes(value) - Method in class net.maizegenetics.analysis.distance.MultiDimensionalScalingPlugin
Set Number of Axes. The number of axes or dimensions and associated eigenvalues to be returned by the analysis.
numberOfBaseEffects - Variable in class net.maizegenetics.analysis.association.AbstractFixedEffectLM
 
numberOfBaseEffects - Variable in class net.maizegenetics.analysis.modelfitter.StepwiseAdditiveModelFitter
 
numberOfChromosomes() - Method in interface net.maizegenetics.dna.map.GenomeSequence
Returns the number of chromosomes
numberOfColumns() - Method in class net.maizegenetics.matrixalgebra.Matrix.BlasDoubleMatrix
 
numberOfColumns() - Method in class net.maizegenetics.matrixalgebra.Matrix.ColtDoubleMatrix
 
numberOfColumns() - Method in interface net.maizegenetics.matrixalgebra.Matrix.DoubleMatrix
 
numberOfColumns() - Method in class net.maizegenetics.matrixalgebra.Matrix.EJMLDoubleMatrix
 
numberOfComponents() - Method in class net.maizegenetics.analysis.data.PrincipalComponentsPlugin
The analysis will return this many principal components up to the number of taxa.
numberOfComponents(value) - Method in class net.maizegenetics.analysis.data.PrincipalComponentsPlugin
Set number of components. The analysis will return this many principal components up to the number of taxa.
numberOfGroups - Variable in class net.maizegenetics.analysis.association.CompressedDoubleMatrix
 
numberOfHets() - Method in class net.maizegenetics.analysis.clustering.Haplotype
 
numberOfIterations() - Method in class net.maizegenetics.analysis.modelfitter.ResamplingGWASPlugin
The number of times the data should be resampled. (Default = 100)
numberOfIterations(value) - Method in class net.maizegenetics.analysis.modelfitter.ResamplingGWASPlugin
Set Number of Iterations. The number of times the data should be resampled. (Default = 100)
numberOfLevels() - Method in class net.maizegenetics.phenotype.CategoricalAttribute
 
numberOfNodes() - Method in class net.maizegenetics.util.DirectedGraph
 
numberOfNodes() - Method in interface net.maizegenetics.util.Graph
Gets the number of nodes in the graph
numberOfNodes() - Method in class net.maizegenetics.util.UndirectedGraph
 
numberOfObservations - Variable in class net.maizegenetics.analysis.association.AbstractFixedEffectLM
 
numberOfObservations - Variable in class net.maizegenetics.analysis.association.PhenotypeLM
 
numberOfObservations - Variable in class net.maizegenetics.analysis.modelfitter.AbstractForwardRegression
 
numberOfObservations - Variable in class net.maizegenetics.phenotype.CorePhenotype
 
numberOfObservations() - Method in class net.maizegenetics.phenotype.CorePhenotype
 
numberOfObservations() - Method in class net.maizegenetics.phenotype.FilterPhenotype
 
numberOfObservations() - Method in class net.maizegenetics.phenotype.GenotypePhenotype
 
numberOfObservations() - Method in interface net.maizegenetics.phenotype.Phenotype
 
numberOfPermutations - Variable in class net.maizegenetics.analysis.association.AbstractFixedEffectLM
 
numberOfPermutations() - Method in class net.maizegenetics.analysis.association.FixedEffectLMPlugin
The number of permutations to be run for the permutation analysis.
numberOfPermutations(value) - Method in class net.maizegenetics.analysis.association.FixedEffectLMPlugin
Set Number of Permutations. The number of permutations to be run for the permutation analysis.
numberOfPermutations - Variable in class net.maizegenetics.analysis.modelfitter.StepwiseAdditiveModelFitter
 
numberOfPermutations(nperm) - Method in class net.maizegenetics.analysis.modelfitter.StepwiseAdditiveModelFitter
 
numberOfPermutations() - Method in class net.maizegenetics.analysis.modelfitter.StepwiseAdditiveModelFitterPlugin
The number of permutations used to determine the enter limit.
numberOfPermutations(value) - Method in class net.maizegenetics.analysis.modelfitter.StepwiseAdditiveModelFitterPlugin
Set Number of permutations. The number of permutations used to determine the enter limit.
numberOfPermutations() - Method in class net.maizegenetics.analysis.modelfitter.StepwiseOLSModelFitterPlugin
Number of permutations for the model to determine an empirical alpha
numberOfPermutations(value) - Method in class net.maizegenetics.analysis.modelfitter.StepwiseOLSModelFitterPlugin
Set Number of permutations. Number of permutations for the model to determine an empirical alpha
numberOfRows() - Method in class net.maizegenetics.matrixalgebra.Matrix.BlasDoubleMatrix
 
numberOfRows() - Method in class net.maizegenetics.matrixalgebra.Matrix.ColtDoubleMatrix
 
numberOfRows() - Method in interface net.maizegenetics.matrixalgebra.Matrix.DoubleMatrix
 
numberOfRows() - Method in class net.maizegenetics.matrixalgebra.Matrix.EJMLDoubleMatrix
 
numberOfSiteReportColumns - Variable in class net.maizegenetics.analysis.association.AbstractFixedEffectLM
 
numberOfSites - Variable in class net.maizegenetics.analysis.association.AbstractFixedEffectLM
 
numberOfSites - Variable in class net.maizegenetics.analysis.modelfitter.AbstractForwardRegression
 
numberOfSites() - Method in interface net.maizegenetics.dna.map.PositionList
Returns total number of sites of this alignment.
numberOfSites() - Method in class net.maizegenetics.dna.snp.CombineGenotypeTable
 
numberOfSites() - Method in class net.maizegenetics.dna.snp.CoreGenotypeTable
 
numberOfSites() - Method in interface net.maizegenetics.dna.snp.genotypecall.GenotypeCallTable
Returns total number of sites in this genotype.
numberOfSites() - Method in interface net.maizegenetics.dna.snp.GenotypeTable
Returns total number of sites of this genotype table.
numberOfSites() - Method in class net.maizegenetics.dna.snp.MergedGenotypeTable
 
numberOfSites() - Method in class net.maizegenetics.dna.snp.TOPMGenotypeTable
 
numberOfTaxa() - Method in class net.maizegenetics.dna.snp.CombineGenotypeTable
 
numberOfTaxa() - Method in class net.maizegenetics.dna.snp.CoreGenotypeTable
 
numberOfTaxa() - Method in interface net.maizegenetics.dna.snp.genotypecall.GenotypeCallTable
Returns number of taxa (samples) in this genotype
numberOfTaxa() - Method in interface net.maizegenetics.dna.snp.GenotypeTable
Returns number of taxa
numberOfTaxa() - Method in class net.maizegenetics.dna.snp.MergedGenotypeTable
 
numberOfTaxa() - Method in class net.maizegenetics.dna.snp.TOPMGenotypeTable
 
numberOfTaxa() - Method in class net.maizegenetics.taxa.distance.DistanceMatrix
 
numberOfTaxa() - Method in interface net.maizegenetics.taxa.TaxaList
Returns number of taxa
numberOfTaxa() - Method in class net.maizegenetics.taxa.TaxaListBuilder
 
numberOfTaxaWithTag() - Method in interface net.maizegenetics.dna.tag.TaxaDistribution
Number of taxa with at least one read
numChars() - Method in class net.maizegenetics.analysis.gbs.neobio.FactorSequence
Returns the number of characters of the original sequence.
numChromosomes() - Method in interface net.maizegenetics.dna.map.PositionList
Return number of chromosomes.
numChromosomes() - Method in class net.maizegenetics.dna.snp.CombineGenotypeTable
 
numChromosomes() - Method in class net.maizegenetics.dna.snp.CoreGenotypeTable
 
numChromosomes() - Method in interface net.maizegenetics.dna.snp.GenotypeTable
Return number of chromosomes.
numChromosomes() - Method in class net.maizegenetics.dna.snp.MergedGenotypeTable
 
numChromosomes() - Method in class net.maizegenetics.dna.snp.TOPMGenotypeTable
 
numcols - Variable in class net.maizegenetics.analysis.gbs.neobio.Smawk
The matrix's current number of columns. This reflects any deletion of columns already performed.
numColumns() - Method in interface net.maizegenetics.analysis.gbs.neobio.Matrix
Returns the number of columns that this matrix has.
numColumns() - Method in class net.maizegenetics.analysis.gbs.neobio.OutMatrix
Returns the number of columns of this OUT matrix.
numColumnsPerRowToKeepInIndex(numColumns) - Method in class net.maizegenetics.dna.snp.io.LineIndexBuilder
 
NumericalGenotypePlugin - Class in net.maizegenetics.analysis.numericaltransform
Numerical Genotype Plugin.
NumericalGenotypePlugin(parentFrame, isInteractive) - Constructor for class net.maizegenetics.analysis.numericaltransform.NumericalGenotypePlugin
Creates a new instance of the NumericalGenotypePlugin
NumericalGenotypePlugin() - Constructor for class net.maizegenetics.analysis.numericaltransform.NumericalGenotypePlugin
 
NumericalGenotypePlugin.TRANSFORM_TYPE - Enum in net.maizegenetics.analysis.numericaltransform
 
NumericAttribute - Class in net.maizegenetics.phenotype
 
NumericAttribute(name, values, missing) - Constructor for class net.maizegenetics.phenotype.NumericAttribute
 
NumericAttribute(name, values) - Constructor for class net.maizegenetics.phenotype.NumericAttribute
 
NumericAttribute(name, doubleValues) - Constructor for class net.maizegenetics.phenotype.NumericAttribute
 
numFactors() - Method in class net.maizegenetics.analysis.gbs.neobio.FactorSequence
Returns the number of factors produced by the LZ78 parsing of the text.
numHeaderLinesToSkip() - Method in class net.maizegenetics.dna.snp.io.LineIndex
 
numHeaderLinesToSkip(numLines) - Method in class net.maizegenetics.dna.snp.io.LineIndexBuilder
 
numIndices() - Method in class net.maizegenetics.dna.snp.TranslateIndex
Number of indices represented by this translation. Number of base indices will be the same or larger.
numIndices() - Method in class net.maizegenetics.dna.snp.TranslateIndexBuilder
 
numLines() - Method in class net.maizegenetics.analysis.phg.ParseGVCF.ProcessLines
 
numLinesPerInterval() - Method in class net.maizegenetics.dna.snp.io.LineIndex
 
numPCAs() - Method in class net.maizegenetics.analysis.data.FindInversionsPlugin
Num PCAs
numPCAs(value) - Method in class net.maizegenetics.analysis.data.FindInversionsPlugin
Set Num PCAs. Num PCAs
numRows() - Method in interface net.maizegenetics.analysis.gbs.neobio.Matrix
Returns the number of rows that this matrix has.
numRows() - Method in class net.maizegenetics.analysis.gbs.neobio.OutMatrix
Returns the number of rows of this OUT matrix.
numrows - Variable in class net.maizegenetics.analysis.gbs.neobio.Smawk
The matrix's current number of rows. This reflects any deletion of rows already performed.
numSigChr - Variable in class net.maizegenetics.dna.map.TagGWASMapInfo
Total number of significant chromosome, unknown = Integer.MIN_VALUE
numSigSite - Variable in class net.maizegenetics.dna.map.TagGWASMapInfo
Total number of significant site, unknown = Integer.MIN_VALUE
numSiteOnBestChrThanSecondBest - Variable in class net.maizegenetics.dna.map.TagGWASMapInfo
Number of site on best chromosome having more significant p value than the most significant p value on the second best chromosome, unknown = Integer.MIN_VALUE
numSites() - Method in class net.maizegenetics.dna.snp.AbstractMaskMatrix
 
numSites() - Method in class net.maizegenetics.dna.snp.byte2d.AbstractByte2D
 
numSites() - Method in interface net.maizegenetics.dna.snp.byte2d.Byte2D
 
numSites() - Method in interface net.maizegenetics.dna.snp.MaskMatrix
 
numSites() - Method in class net.maizegenetics.dna.snp.MaskSiteMatrix
 
numSites() - Method in class net.maizegenetics.dna.snp.MaskTaxaMatrix
 
numSites() - Method in class net.maizegenetics.dna.snp.score.AlleleDepth
 
numSites() - Method in class net.maizegenetics.dna.snp.score.AlleleProbability
 
numSites() - Method in class net.maizegenetics.dna.snp.score.Dosage
 
numSites() - Method in class net.maizegenetics.dna.snp.score.ReferenceProbability
 
numSites() - Method in interface net.maizegenetics.dna.snp.score.SiteScore
 
numSites() - Method in class net.maizegenetics.dna.snp.Translate
 
numSitesPerBlock() - Method in class net.maizegenetics.analysis.distance.VCAPScanPlugin
Num Sites Per Block
numSitesPerBlock(value) - Method in class net.maizegenetics.analysis.distance.VCAPScanPlugin
Set Num Sites Per Block. Num Sites Per Block
numTaxa() - Method in class net.maizegenetics.dna.snp.AbstractMaskMatrix
 
numTaxa() - Method in class net.maizegenetics.dna.snp.byte2d.AbstractByte2D
 
numTaxa() - Method in interface net.maizegenetics.dna.snp.byte2d.Byte2D
 
numTaxa() - Method in interface net.maizegenetics.dna.snp.MaskMatrix
 
numTaxa() - Method in class net.maizegenetics.dna.snp.MaskSiteMatrix
 
numTaxa() - Method in class net.maizegenetics.dna.snp.MaskTaxaMatrix
 
numTaxa() - Method in class net.maizegenetics.dna.snp.score.AlleleDepth
 
numTaxa() - Method in class net.maizegenetics.dna.snp.score.AlleleProbability
 
numTaxa() - Method in class net.maizegenetics.dna.snp.score.Dosage
 
numTaxa() - Method in class net.maizegenetics.dna.snp.score.ReferenceProbability
 
numTaxa() - Method in interface net.maizegenetics.dna.snp.score.SiteScore
 
numTaxa() - Method in class net.maizegenetics.dna.snp.Translate
 
numVirtualOffsets() - Method in class net.maizegenetics.dna.snp.io.LineIndex
 

O

objectListSingleSelect() - Method in class net.maizegenetics.plugindef.PluginParameter.Builder
 
observations(observations) - Method in class net.maizegenetics.analysis.imputation.BackwardForwardAlgorithm
 
observations(observations) - Method in class net.maizegenetics.analysis.imputation.BackwardForwardVariableStateNumber
 
obsMajor - Variable in class net.maizegenetics.analysis.gbs.SimpleGenotypeSBit
 
obsMinor - Variable in class net.maizegenetics.analysis.gbs.SimpleGenotypeSBit
 
of(chromosomeNumber, positionWithinChromosome) - Static method in interface net.maizegenetics.dna.map.Position
Create Position given chromosome number and position.
of(chromosomeName, positionWithinChromosome) - Static method in interface net.maizegenetics.dna.map.Position
Create Position given chromosome name and position.
of(chromosome, positionWithinChromosome) - Static method in interface net.maizegenetics.dna.map.Position
Create Position given chromosome and position.
oneBased() - Method in class net.maizegenetics.analysis.monetdb.ColumnsToBinaryFullGenomeTablePlugin
Will assume positions and ranges are 1-based unless otherwise set.
oneBased(value) - Method in class net.maizegenetics.analysis.monetdb.ColumnsToBinaryFullGenomeTablePlugin
Set positions to 1-based unless this variable is "false".
oneBased() - Method in class net.maizegenetics.analysis.monetdb.ColumnsToBinarySNPOnlyTablePlugin
Will assume positions and ranges are 1-based unless otherwise set.
oneBased(value) - Method in class net.maizegenetics.analysis.monetdb.ColumnsToBinarySNPOnlyTablePlugin
Set positions to 1-based unless this variable is "false".
OpenBitSet - Class in net.maizegenetics.util
An "open" BitSet implementation that allows direct access to the array of words storing the bits.
OpenBitSet(numBits) - Constructor for class net.maizegenetics.util.OpenBitSet
Constructs an OpenBitSet large enough to hold numBits.
OpenBitSet() - Constructor for class net.maizegenetics.util.OpenBitSet
 
OpenBitSet(bits, numWords) - Constructor for class net.maizegenetics.util.OpenBitSet
Constructs an OpenBitSet from an existing long[].
The first 64 bits are in long[0], with bit index 0 at the least significant bit, and bit index 63 at the most significant. Given a bit index, the word containing it is long[index/64], and it is at bit number index%64 within that word.
OpenBitSet(bits) - Constructor for class net.maizegenetics.util.OpenBitSet
 
OpenBitSet(cloneOBS) - Constructor for class net.maizegenetics.util.OpenBitSet
 
openFile(name) - Static method in class net.maizegenetics.util.InputSource
open file for reading
openStdIn() - Static method in class net.maizegenetics.util.InputSource
open standard input
openString(input) - Static method in class net.maizegenetics.util.InputSource
"open" string for reading
optionalKeyToCalculateAccuracy() - Method in class net.maizegenetics.analysis.imputation.FILLINImputationPlugin
Key to calculate accuracy. Genotypes missing (masked) in target file should be present in key, with all other sites set to missing. Overrides otheraccuracy options if present and all sites and taxa present in target file present
optionalKeyToCalculateAccuracy(value) - Method in class net.maizegenetics.analysis.imputation.FILLINImputationPlugin
Set Optional key to calculate accuracy. Key to calculate accuracy. Genotypes missing (masked) in target file should be present in key, with all other sites set to missing. Overrides otheraccuracy options if present and all sites and taxa present in target file present
or(other) - Method in interface net.maizegenetics.util.BitSet
OR
or(other) - Method in class net.maizegenetics.util.OpenBitSet
see union
or(other) - Method in class net.maizegenetics.util.UnmodifiableBitSet
 
order(array) - Static method in class net.maizegenetics.analysis.imputation.ImputationUtils
 
orderedTranslation(indexRedirect, base, numBaseIndices) - Static method in class net.maizegenetics.dna.snp.TranslateIndexBuilder
 
OrderEnumerator - Interface in net.maizegenetics.stats.math
A means for describing odering information, and Utilities for creating such Orderings
OrderEnumerator.OEFactory - Interface in net.maizegenetics.stats.math
 
OrderEnumerator.Utils - Class in net.maizegenetics.stats.math
 
orderTagsFTagsB() - Method in class net.maizegenetics.dna.tag.AbstractPETags
Order forward and backward tags
origin - Variable in class net.maizegenetics.analysis.modelfitter.CovariatePermutationTestSpliterator
 
origin - Variable in class net.maizegenetics.analysis.modelfitter.ForwardStepAdditiveSpliterator
 
original - Variable in class net.maizegenetics.analysis.imputation.PopulationData
 
OrthogonalHints - Interface in net.maizegenetics.stats.math
Provides a means for giving an Orthogonal base optimiser (IE, OrthognalMinimum) hints about the function that may alow it to optimise better.
OrthogonalHints.Utils - Class in net.maizegenetics.stats.math
 
out_matrix - Variable in class net.maizegenetics.analysis.gbs.neobio.CrochemoreLandauZivUkelson
An instance of the OutMatrix class that encodes the OUT matrix of a block when supplied with the DIST matrix and the input border array of a block. Note that it does not compute the OUT matrix itselft, it just stores the necessary information to retrieve a value at any position of the matrix.
outBase() - Method in class net.maizegenetics.analysis.monetdb.ColumnsToBinaryFullGenomeTablePlugin
Output directory and base filename to hold the binary files. Will make directory if neccesary
outBase(value) - Method in class net.maizegenetics.analysis.monetdb.ColumnsToBinaryFullGenomeTablePlugin
Set outBase. Output directory and base filename to hold the binary files. Will make directory if neccesary
outBase() - Method in class net.maizegenetics.analysis.monetdb.ColumnsToBinarySNPOnlyTablePlugin
Output directory and base filename to hold the binary files. Will make directory if neccesary
outBase(value) - Method in class net.maizegenetics.analysis.monetdb.ColumnsToBinarySNPOnlyTablePlugin
Set outBase. Output directory and base filename to hold the binary files. Will make directory if neccesary
outDegree(n) - Method in class net.maizegenetics.util.DirectedGraph
Gets the number of nodes hit by an edge coming out of the query node
outDir() - Method in class net.maizegenetics.plugindef.PluginParameter.Builder
 
outfile() - Method in class net.maizegenetics.analysis.data.GenosToABHPlugin
Output genotype file with ABH encoding
outfile(value) - Method in class net.maizegenetics.analysis.data.GenosToABHPlugin
Set Output file. Output genotype file with ABH encoding
outFile() - Method in class net.maizegenetics.analysis.data.ThinSitesByPositionPlugin
Output genotype file
outfile(value) - Method in class net.maizegenetics.analysis.data.ThinSitesByPositionPlugin
Set Output file. Output genotype file
outFile() - Method in class net.maizegenetics.plugindef.PluginParameter.Builder
 
outIUPAC() - Method in class net.maizegenetics.analysis.imputation.FSFHapImputationPlugin
use IUPAC ambiguity codes for output
outIUPAC(value) - Method in class net.maizegenetics.analysis.imputation.FSFHapImputationPlugin
Set Out I U P A C. use IUPAC ambiguity codes for output
OutMatrix - Class in net.maizegenetics.analysis.gbs.neobio
Implements an interface to the OUT matrix of a block. This class is used by the class CrochemoreLandauZivUkelson and subclasses to enconde the OUT matrix from the input border and DIST matrix of an class AlignmentBlock.
outNuc() - Method in class net.maizegenetics.analysis.imputation.FSFHapImputationPlugin
replace missing values with flanking values if equal
outNuc(value) - Method in class net.maizegenetics.analysis.imputation.FSFHapImputationPlugin
Set Out Nuc. replace missing values with flanking values if equal
outParents() - Method in class net.maizegenetics.analysis.imputation.FSFHapImputationPlugin
replace missing values with flanking values if equal
outParents(value) - Method in class net.maizegenetics.analysis.imputation.FSFHapImputationPlugin
Set Out Parents. replace missing values with flanking values if equal
output() - Method in class net.maizegenetics.analysis.data.MeanR2FromLDPlugin
Output Mean R2 Summary.
output(value) - Method in class net.maizegenetics.analysis.data.MeanR2FromLDPlugin
Set Output. Output Mean R2 Summary.
output_border - Variable in class net.maizegenetics.analysis.gbs.neobio.AlignmentBlock
This block's output border.
outputDatabaseFile() - Method in class net.maizegenetics.analysis.gbs.repgen.RepGenLoadSeqToDBPlugin
Output Database File
outputDatabaseFile(value) - Method in class net.maizegenetics.analysis.gbs.repgen.RepGenLoadSeqToDBPlugin
Set Output Database File. Output Database File
outputDatabaseFile() - Method in class net.maizegenetics.analysis.gbs.v2.GBSSeqToTagDBPlugin
Output Database File
outputDatabaseFile(value) - Method in class net.maizegenetics.analysis.gbs.v2.GBSSeqToTagDBPlugin
Set Output Database File. Output Database File
outputDatabaseFile() - Method in class net.maizegenetics.analysis.rna.RNADeMultiPlexSeqToDBPlugin
Output Database File
outputDatabaseFile(value) - Method in class net.maizegenetics.analysis.rna.RNADeMultiPlexSeqToDBPlugin
Set Output Database File. Output Database File
outputDB() - Method in class net.maizegenetics.analysis.rna.LoadRNAContigsToGBSDBPlugin
Output Database File
outputDB(value) - Method in class net.maizegenetics.analysis.rna.LoadRNAContigsToGBSDBPlugin
Set Output Database File. Output Database File
outputDir() - Method in class net.maizegenetics.analysis.distance.VCAPScanPlugin
Output Dir
outputDir(value) - Method in class net.maizegenetics.analysis.distance.VCAPScanPlugin
Set Output Dir. Output Dir
outputDir(value) - Method in class net.maizegenetics.analysis.gbs.FastqToTagCountPlugin
 
outputDir() - Method in class net.maizegenetics.analysis.gbs.FastqToTagCountPlugin
 
outputDir() - Method in class net.maizegenetics.analysis.gobii.GWAS_IFLPlugin
Full path name of directory to which output files will be written, must end with a /
outputDir(value) - Method in class net.maizegenetics.analysis.gobii.GWAS_IFLPlugin
Set Path of output directory. Full path name of directory to which output files will be written, must end with a /
outputDir() - Method in class net.maizegenetics.analysis.gobii.HapBreakpoints_IFLFilePlugin
Full path name of directory to which output files will be written, must end with a /
outputDir(value) - Method in class net.maizegenetics.analysis.gobii.HapBreakpoints_IFLFilePlugin
Set Path of output directory. Full path name of directory to which output files will be written, must end with a /
outputDir() - Method in class net.maizegenetics.analysis.gobii.MonetDB_IFLFilePlugin
Full path name of output directory, must end with a /
outputDir(value) - Method in class net.maizegenetics.analysis.gobii.MonetDB_IFLFilePlugin
Set Path of output directory. Full path name of output directory, must end with a /
outputDir() - Method in class net.maizegenetics.analysis.gobii.PreProcessGOBIIMappingFilePlugin
Full path name of output directory, must end with a /
outputDir(value) - Method in class net.maizegenetics.analysis.gobii.PreProcessGOBIIMappingFilePlugin
Set Path of output directory. Full path name of output directory, must end with a /
outputDir() - Method in class net.maizegenetics.analysis.gobii.SplitFile_IFLFilePlugin
Full path name of output directory, must end with a /
outputDir(value) - Method in class net.maizegenetics.analysis.gobii.SplitFile_IFLFilePlugin
Set Path of output directory. Full path name of output directory, must end with a /
outputDir() - Method in class net.maizegenetics.util.ConvertOldFastqToModernFormatPlugin
Output directory where new fastQ files will be written
outputDir(value) - Method in class net.maizegenetics.util.ConvertOldFastqToModernFormatPlugin
Set Output Directory. Output directory where new fastQ files will be written
outputFile() - Method in class net.maizegenetics.analysis.association.EqtlAssociationPlugin
The name of the file to which these results will be saved.
outputFile(value) - Method in class net.maizegenetics.analysis.association.EqtlAssociationPlugin
Set Output File. The name of the file to which these results will be saved.
outputFile() - Method in class net.maizegenetics.analysis.data.BuildUnfinishedHDF5GenotypesPlugin
Output, finished HDF5 genotype (*.h5) file which can be opened with the TASSEL5 GUI
outputFile(value) - Method in class net.maizegenetics.analysis.data.BuildUnfinishedHDF5GenotypesPlugin
Set Output file. Output, finished HDF5 genotype (*.h5) file which can be opened with the TASSEL5 GUI
outputFile() - Method in class net.maizegenetics.analysis.data.CountAssociationsPlugin
Output Count File.
outputFile(value) - Method in class net.maizegenetics.analysis.data.CountAssociationsPlugin
Set Output Count File. Output Count File.
outputFile() - Method in class net.maizegenetics.analysis.data.FeatureListToPositionsPlugin
Output filename
outputFile(value) - Method in class net.maizegenetics.analysis.data.FeatureListToPositionsPlugin
Set Output File. Output filename
outputFile() - Method in class net.maizegenetics.analysis.data.FindInversionsPlugin
Output File
outputFile(value) - Method in class net.maizegenetics.analysis.data.FindInversionsPlugin
Set Output File. Output File
outputFile(filename) - Method in class net.maizegenetics.analysis.data.HDF5SummaryPlugin
 
outputFile() - Method in class net.maizegenetics.analysis.data.HDF5SummaryPlugin
 
outputFile() - Method in class net.maizegenetics.analysis.data.SortGenotypeFilePlugin
Output file
outputFile(value) - Method in class net.maizegenetics.analysis.data.SortGenotypeFilePlugin
Set Output file. Output file
outputFile() - Method in class net.maizegenetics.analysis.gbs.BinaryToTextPlugin
Output File
outputFile(value) - Method in class net.maizegenetics.analysis.gbs.BinaryToTextPlugin
Set Output File. Output File
outputFile() - Method in class net.maizegenetics.analysis.gbs.MergeMultipleTagCountPlugin
 
outputFile(value) - Method in class net.maizegenetics.analysis.gbs.MergeMultipleTagCountPlugin
 
outputFile() - Method in class net.maizegenetics.analysis.gbs.SAMConverterPlugin
 
outputFile(value) - Method in class net.maizegenetics.analysis.gbs.SAMConverterPlugin
 
outputFile() - Method in class net.maizegenetics.analysis.gbs.SeqToTBTHDF5Plugin
Output HDF5 file
outputFile(value) - Method in class net.maizegenetics.analysis.gbs.SeqToTBTHDF5Plugin
Set Output File. Output HDF5 file
outputFile() - Method in class net.maizegenetics.analysis.gbs.TagCountToFastqPlugin
 
outputFile(value) - Method in class net.maizegenetics.analysis.gbs.TagCountToFastqPlugin
 
outputFile() - Method in class net.maizegenetics.analysis.gbs.UTagCountToTagPairPlugin
Output file of matched tag pairs
outputFile(value) - Method in class net.maizegenetics.analysis.gbs.UTagCountToTagPairPlugin
Set Output file. Output file of matched tag pairs
outputFile() - Method in class net.maizegenetics.analysis.gbs.v2.GetTagSequenceFromDBPlugin
Output tab-delimited file showing tag sequences found in DB.
outputFile(value) - Method in class net.maizegenetics.analysis.gbs.v2.GetTagSequenceFromDBPlugin
Set Output File. This is tab delimited file with a list of tag sequences found in the database (either a single tag if the user is checking for a particular tag's presence, or a list of all tags found in the db (if no user tag specified).
outputFile() - Method in class net.maizegenetics.analysis.gbs.v2.GetTagTaxaDistFromDBPlugin
Output tab-delimited file showing tag sequences found in DB.
outputFile(value) - Method in class net.maizegenetics.analysis.gbs.v2.GetTagTaxaDistFromDBPlugin
Set Output File. This is tab delimited file with a list of tag sequences found in the database (either a single tag if the user is checking for a particular tag's presence, or a list of all tags found in the db (if no user tag specified).
outputFile() - Method in class net.maizegenetics.analysis.gbs.v2.SNPCutPosTagVerificationPlugin
output directory path
outputFile(value) - Method in class net.maizegenetics.analysis.gbs.v2.SNPCutPosTagVerificationPlugin
Set outputDir path. Directory file path where output files will be writen
outputFile() - Method in class net.maizegenetics.analysis.gbs.v2.TagExportToFastqPlugin
Output fastq file to use as input for BWA or bowtie2
outputFile(value) - Method in class net.maizegenetics.analysis.gbs.v2.TagExportToFastqPlugin
Set Output File. Output fastq file to use as input for BWA or bowtie2
outputFile() - Method in class net.maizegenetics.analysis.imputation.MergeBreakpointFilesPlugin
The output file. If the filename ends in gz it will be zipped. Required.
outputFile(value) - Method in class net.maizegenetics.analysis.imputation.MergeBreakpointFilesPlugin
Set Output File. The output file. If the filename ends in gz it will be zipped. Required.
outputFileDir() - Method in class net.maizegenetics.analysis.gobii.MarkerDNARun_IFLFilePlugin
Directory where created files will be written
outputFileDir(value) - Method in class net.maizegenetics.analysis.gobii.MarkerDNARun_IFLFilePlugin
Set outputFileDir. Directory where created files will be written
outputFilename() - Method in class net.maizegenetics.analysis.imputation.FILLINFindHaplotypesPlugin
Output file; Use .gX in the output filename to denote the substring .gc#s# found in donor files, ie 'out.gX.hmp.txt'.
outputFilename(value) - Method in class net.maizegenetics.analysis.imputation.FILLINFindHaplotypesPlugin
Set Output filename. Output file; Use .gX in the output filename to denote the substring .gc#s# found in donor files, ie 'out.gX.hmp.txt'.
outputFilename() - Method in class net.maizegenetics.analysis.imputation.FILLINImputationPlugin
Output file; hmp.txt.gz and .hmp.h5 accepted.
outputFilename(value) - Method in class net.maizegenetics.analysis.imputation.FILLINImputationPlugin
Set Output filename. Output file; hmp.txt.gz and .hmp.h5 accepted.
outputFormat() - Method in class net.maizegenetics.analysis.data.GenosToABHPlugin
The output format enum
outputFormat(value) - Method in class net.maizegenetics.analysis.data.GenosToABHPlugin
Set Output Format. The output format enum
outputGenotypeFile() - Method in class net.maizegenetics.analysis.gbs.ProductionPipeline
Output (target) HDF5 genotypes file to add new genotypes to (new file created if it doesn't exist)
outputGenotypeFile(value) - Method in class net.maizegenetics.analysis.gbs.ProductionPipeline
Set Output Genotype File. Output (target) HDF5 genotypes file to add new genotypes to (new file created if it doesn't exist)
outputGenotypesFile() - Method in class net.maizegenetics.analysis.gbs.repgen.RGBSProductionSNPCallerPlugin
Output (target) genotypes file to add new genotypes to (new file created if it doesn't exist)
outputGenotypesFile(value) - Method in class net.maizegenetics.analysis.gbs.repgen.RGBSProductionSNPCallerPlugin
Set Output Genotypes File. Output (target) genotypes file to add new genotypes to (new file created if it doesn't exist)
outputGenotypesFile() - Method in class net.maizegenetics.analysis.gbs.v2.ProductionSNPCallerPluginV2
Output (target) genotypes file to add new genotypes to (new file created if it doesn't exist)
outputGenotypesFile(value) - Method in class net.maizegenetics.analysis.gbs.v2.ProductionSNPCallerPluginV2
Set Output Genotypes File. Output (target) genotypes file to add new genotypes to (new file created if it doesn't exist)
outputHDF5GenotypeFile() - Method in class net.maizegenetics.analysis.data.AddReferenceAlleleToHDF5Plugin
Output HDF5 genotype file annotated with the reference allele (Default: write to same folder as input, with '*.h5' replaced '*_withRef.h5')
outputHDF5GenotypeFile(value) - Method in class net.maizegenetics.analysis.data.AddReferenceAlleleToHDF5Plugin
Set Output HDF5 Genotype File. Output HDF5 genotype file annotated with the reference allele (Default: write to same folder as input, with '*.h5' replaced '*_withRef.h5')
outputHDF5Genotypes() - Method in class net.maizegenetics.analysis.data.MergeRenameDeleteTaxaPlugin
Output genotypes file
outputHDF5Genotypes(value) - Method in class net.maizegenetics.analysis.data.MergeRenameDeleteTaxaPlugin
Set Output Genotypes. Output genotypes file
outputHDF5GenotypesFile() - Method in class net.maizegenetics.analysis.gbs.ProductionSNPCallerPlugin
Output (target) HDF5 genotypes file to add new genotypes to (new file created if it doesn't exist)
outputHDF5GenotypesFile(value) - Method in class net.maizegenetics.analysis.gbs.ProductionSNPCallerPlugin
Set Output HDF5 Genotypes File. Output (target) HDF5 genotypes file to add new genotypes to (new file created if it doesn't exist)
outputName() - Method in class net.maizegenetics.analysis.modelfitter.StepwiseAdditiveModelFitterPlugin
The base file path for the save files. Each file saved will add a descriptive name to the base name.
outputName(value) - Method in class net.maizegenetics.analysis.modelfitter.StepwiseAdditiveModelFitterPlugin
Set Base file path. The base file path for the save files. Each file saved will add a descriptive name to the base name.
outputProjectionAlignment() - Method in class net.maizegenetics.analysis.imputation.FILLINImputationPlugin
Create a projection alignment for high density markers
outputProjectionAlignment(value) - Method in class net.maizegenetics.analysis.imputation.FILLINImputationPlugin
Set Output projection alignment. Create a projection alignment for high density markers
outputResults(title, traitname) - Method in class net.maizegenetics.stats.linearmodels.LinearModelForStepwiseRegression
 
outputSiteStats - Variable in class net.maizegenetics.analysis.association.AbstractFixedEffectLM
 
outputTOPMFile() - Method in class net.maizegenetics.analysis.gbs.DiscoverySNPCallerPlugin
Output TagsOnPhysicalMap (TOPM) file with allele calls (variants) added (for use with ProductionSNPCallerPlugin
outputTOPMFile(value) - Method in class net.maizegenetics.analysis.gbs.DiscoverySNPCallerPlugin
Set Output TOPM File. Output TagsOnPhysicalMap (TOPM) file with allele calls (variants) added (for use with ProductionSNPCallerPlugin
outputVCFFile() - Method in class net.maizegenetics.analysis.data.AdjustPhasingPlugin
Output VCF file
outputVCFFile(value) - Method in class net.maizegenetics.analysis.data.AdjustPhasingPlugin
Set Output VCF File. Output VCF file
overlap - Variable in class net.maizegenetics.analysis.imputation.BiparentalHaplotypeFinder
The extent of overlap between adjacent windows. The overlap is used to assign individual haplotypes to the same parent groups as the previous window.
overlap() - Method in class net.maizegenetics.analysis.imputation.FSFHapImputationPlugin
overlap between adjacent windows
overlap(value) - Method in class net.maizegenetics.analysis.imputation.FSFHapImputationPlugin
Set Overlap. overlap between adjacent windows
overview() - Method in class net.maizegenetics.analysis.data.GenotypeSummaryPlugin
Get Overview Report
overview(value) - Method in class net.maizegenetics.analysis.data.GenotypeSummaryPlugin
Set Overview. Get Overview Report

P

p(value) - Method in class net.maizegenetics.analysis.popgen.LDResult.Builder
 
p() - Method in class net.maizegenetics.analysis.popgen.LDResult
 
p - Variable in class net.maizegenetics.dna.map.TagGeneticMappingInfo
P-value from binomial test
P_VALUE - Static variable in class net.maizegenetics.analysis.popgen.LinkageDisequilibriumComponent
 
paddedSequence - Variable in class net.maizegenetics.analysis.gbs.ReadBarcodeResult
Processed sequence padded with polyA
paddedSequence - Variable in class net.maizegenetics.analysis.gbs.ShortReadBarcodeResult
 
padDistance() - Method in class net.maizegenetics.analysis.gbs.UTagPairToTOPMPlugin
Distance to pad between each tag pair
padDistance(value) - Method in class net.maizegenetics.analysis.gbs.UTagPairToTOPMPlugin
Set Pad distance. Distance to pad between each tag pair
paint(g) - Method in class net.maizegenetics.analysis.popgen.LinkageDisequilibriumComponent
 
paint(g) - Method in class net.maizegenetics.analysis.popgen.LinkageDisequilibriumMinimapComponent
 
paint(g, c) - Method in class net.maizegenetics.gui.VerticalLabelUI
 
paintComponent(g) - Method in class net.maizegenetics.analysis.popgen.LinkageDisequilibriumComponent
 
paintComponent(g) - Method in class net.maizegenetics.analysis.popgen.LinkageDisequilibriumMinimapComponent
 
Pair<T,K> - Class in net.maizegenetics.util.db
Pair utility type User: julian3 Date: 2013/11/10 Time: 7:06 PM PROJECT: ${PROJECT} DESCRIPTION: Code Borrowed from http://java.dzone.com/articles/adding-java-8-lambda-goodness Original package can be downloaded from https://github.com/jexenberger/lambda-tuples
Pair(car, cdr) - Constructor for class net.maizegenetics.util.db.Pair
 
PairwiseAlignment - Class in net.maizegenetics.analysis.gbs.neobio
This class is the product of a pairwise alignment, generated by one subclasses of class PairwiseAlignmentAlgorithm. It contains the two sequences strings with gaps, a score tag line, and a score value. It is typically displayed in three rows as in the following example of an alignment between parts of two protein sequences: MDEIHQLEDMFTVDSETLRKVVKHFILPHD-----MRTTKHQEELWSFIAELDSLKDFMVEQE // sequence 1 M +I E +FTV +ETL+ V KHFILP D MRTT++ +ELW FIA DSLK F+ EQ // score tag line MQQIENFEKIFTVPTETLQAVTKHFILP-DATETLMRTTQNPDELWEFIA--DSLKAFIDEQF // sequence 2
PairwiseAlignment(gapped_seq1, score_tag_line, gapped_seq2, score) - Constructor for class net.maizegenetics.analysis.gbs.neobio.PairwiseAlignment
Creates a PairwiseAlignment instance with the specified gapped sequences, score tag line and score value.
PairwiseAlignment(gapped_seq1, score_tag_line, gapped_seq2, score, row, col) - Constructor for class net.maizegenetics.analysis.gbs.neobio.PairwiseAlignment
Creates a PairwiseAlignment instance with the specified gapped sequences, score tag line and score value.
PairwiseAlignmentAlgorithm - Class in net.maizegenetics.analysis.gbs.neobio
This abstract class is the superclass of all classes implementing pairwise sequence alignment algorithms. Subclasses are required to provide methods to build a high scoring alignment between two sequences and compute its score with a given scoring scheme.
PanAAddPosToTagMapPlugin - Class in net.maizegenetics.analysis.gbs.pana
Add alignment information from Bowtie2 to tagMap. Used to identify unique ref tags for model training
PanAAddPosToTagMapPlugin() - Constructor for class net.maizegenetics.analysis.gbs.pana.PanAAddPosToTagMapPlugin
 
PanAAddPosToTagMapPlugin(parentFrame) - Constructor for class net.maizegenetics.analysis.gbs.pana.PanAAddPosToTagMapPlugin
 
PanABuildPivotTBTPlugin - Class in net.maizegenetics.analysis.gbs.pana
Split large TagsByTaxaByteHDF5TagGroup file into small sub TBTs. Designed to submit genetic mapping jobs in cluster
PanABuildPivotTBTPlugin() - Constructor for class net.maizegenetics.analysis.gbs.pana.PanABuildPivotTBTPlugin
 
PanABuildPivotTBTPlugin(parentFrame) - Constructor for class net.maizegenetics.analysis.gbs.pana.PanABuildPivotTBTPlugin
 
PanABuildTagBlockPosPlugin - Class in net.maizegenetics.analysis.gbs.pana
Build blocked physical position of tags. The blocked physical position of tag is used to block the corresponding marker in genetic mapping if the tag is mapping to the marker coming from itself Positions come from TOPM alignment hypothesis or the best position from machine learning prediction
PanABuildTagBlockPosPlugin() - Constructor for class net.maizegenetics.analysis.gbs.pana.PanABuildTagBlockPosPlugin
 
PanABuildTagBlockPosPlugin(parentFrame) - Constructor for class net.maizegenetics.analysis.gbs.pana.PanABuildTagBlockPosPlugin
 
PanABuildTagGWASMapPlugin - Class in net.maizegenetics.analysis.gbs.pana
Convert mapping result to HDF5 class TagGWASMap format
PanABuildTagGWASMapPlugin() - Constructor for class net.maizegenetics.analysis.gbs.pana.PanABuildTagGWASMapPlugin
 
PanABuildTagGWASMapPlugin(parentFrame) - Constructor for class net.maizegenetics.analysis.gbs.pana.PanABuildTagGWASMapPlugin
 
PanABuildTrainingSetPlugin - Class in net.maizegenetics.analysis.gbs.pana
Build training data set from tagMap, including boxcox transformation and converting to ARFF format
PanABuildTrainingSetPlugin() - Constructor for class net.maizegenetics.analysis.gbs.pana.PanABuildTrainingSetPlugin
 
PanABuildTrainingSetPlugin(parentFrame) - Constructor for class net.maizegenetics.analysis.gbs.pana.PanABuildTrainingSetPlugin
 
PanAFilteringTagMapPlugin - Class in net.maizegenetics.analysis.gbs.pana
Filtering high quality mapped tag and write them into a file, based on the predicted distance
PanAFilteringTagMapPlugin() - Constructor for class net.maizegenetics.analysis.gbs.pana.PanAFilteringTagMapPlugin
 
PanAFilteringTagMapPlugin(parentFrame) - Constructor for class net.maizegenetics.analysis.gbs.pana.PanAFilteringTagMapPlugin
 
PanAH5ToAnchorPlugin - Class in net.maizegenetics.analysis.gbs.pana
Reformat HDF5 genotype to class SimpleGenotypeSBit anchor.
PanAH5ToAnchorPlugin() - Constructor for class net.maizegenetics.analysis.gbs.pana.PanAH5ToAnchorPlugin
 
PanAH5ToAnchorPlugin(parentFrame) - Constructor for class net.maizegenetics.analysis.gbs.pana.PanAH5ToAnchorPlugin
 
PanAMergeMappingResultPlugin - Class in net.maizegenetics.analysis.gbs.pana
Split large TagsByTaxaByteHDF5TagGroup file into small sub TBTs. Designed to submit genetic mapping jobs in cluster
PanAMergeMappingResultPlugin() - Constructor for class net.maizegenetics.analysis.gbs.pana.PanAMergeMappingResultPlugin
 
PanAMergeMappingResultPlugin(parentFrame) - Constructor for class net.maizegenetics.analysis.gbs.pana.PanAMergeMappingResultPlugin
 
PanAModelTrainingPlugin - Class in net.maizegenetics.analysis.gbs.pana
Training data with M5Rules model, generate model file and training report files
PanAModelTrainingPlugin() - Constructor for class net.maizegenetics.analysis.gbs.pana.PanAModelTrainingPlugin
 
PanAModelTrainingPlugin(parentFrame) - Constructor for class net.maizegenetics.analysis.gbs.pana.PanAModelTrainingPlugin
 
PanAPredictionPlugin - Class in net.maizegenetics.analysis.gbs.pana
Make predictions based on trained machine learning model. Write predicted values into tagMap file
PanAPredictionPlugin() - Constructor for class net.maizegenetics.analysis.gbs.pana.PanAPredictionPlugin
 
PanAPredictionPlugin(parentFrame) - Constructor for class net.maizegenetics.analysis.gbs.pana.PanAPredictionPlugin
 
PanAReadDigestPlugin - Class in net.maizegenetics.analysis.gbs.pana
Digest Fastq/Qseq data with recognition sequence Do not use underscore in taxa name in keyfile
PanAReadDigestPlugin() - Constructor for class net.maizegenetics.analysis.gbs.pana.PanAReadDigestPlugin
 
PanAReadDigestPlugin(parentFrame) - Constructor for class net.maizegenetics.analysis.gbs.pana.PanAReadDigestPlugin
 
PanAReadToKmerPlugin - Class in net.maizegenetics.analysis.gbs.pana
Generate Kmers from Fastq/Qseq data Do not use underscore in taxa name in keyfile
PanAReadToKmerPlugin() - Constructor for class net.maizegenetics.analysis.gbs.pana.PanAReadToKmerPlugin
 
PanAReadToKmerPlugin(parentFrame) - Constructor for class net.maizegenetics.analysis.gbs.pana.PanAReadToKmerPlugin
 
PanASamToMultiPositionTOPMPlugin - Class in net.maizegenetics.analysis.gbs.pana
Split large TagsByTaxaByteHDF5TagGroup file into small sub TBTs. Designed to submit genetic mapping jobs in cluster
PanASamToMultiPositionTOPMPlugin() - Constructor for class net.maizegenetics.analysis.gbs.pana.PanASamToMultiPositionTOPMPlugin
 
PanASamToMultiPositionTOPMPlugin(parentFrame) - Constructor for class net.maizegenetics.analysis.gbs.pana.PanASamToMultiPositionTOPMPlugin
 
PanASplitTagBlockPosPlugin - Class in net.maizegenetics.analysis.gbs.pana
Split TagBlockPos class TagBlockPosition file into subsets. Designed to submit genetic mapping jobs in cluster
PanASplitTagBlockPosPlugin() - Constructor for class net.maizegenetics.analysis.gbs.pana.PanASplitTagBlockPosPlugin
 
PanASplitTagBlockPosPlugin(parentFrame) - Constructor for class net.maizegenetics.analysis.gbs.pana.PanASplitTagBlockPosPlugin
 
PanASplitTBTPlugin - Class in net.maizegenetics.analysis.gbs.pana
Split large TagsByTaxaByteHDF5TagGroup file into small sub TBTs. Designed to submit genetic mapping jobs in cluster
PanASplitTBTPlugin() - Constructor for class net.maizegenetics.analysis.gbs.pana.PanASplitTBTPlugin
 
PanASplitTBTPlugin(parentFrame) - Constructor for class net.maizegenetics.analysis.gbs.pana.PanASplitTBTPlugin
 
PanATagGWASMappingPlugin - Class in net.maizegenetics.analysis.gbs.pana
Genetic mapping (GWAS) tags
PanATagGWASMappingPlugin() - Constructor for class net.maizegenetics.analysis.gbs.pana.PanATagGWASMappingPlugin
 
PanATagGWASMappingPlugin(parentFrame) - Constructor for class net.maizegenetics.analysis.gbs.pana.PanATagGWASMappingPlugin
 
PanATagMapToFastaPlugin - Class in net.maizegenetics.analysis.gbs.pana
Output sequence in tagMap (e.g. class TagGWASMap) file in Fasta format, which is used in Bowtie2 alignment
PanATagMapToFastaPlugin() - Constructor for class net.maizegenetics.analysis.gbs.pana.PanATagMapToFastaPlugin
 
PanATagMapToFastaPlugin(parentFrame) - Constructor for class net.maizegenetics.analysis.gbs.pana.PanATagMapToFastaPlugin
 
PanAUsageExample - Class in net.maizegenetics.analysis.gbs.pana
 
PanAUsageExample() - Constructor for class net.maizegenetics.analysis.gbs.pana.PanAUsageExample
 
ParameterCache - Class in net.maizegenetics.plugindef
This class is for storing a cache of parameters retrieved from a java.util.Properties file that is available to all plugins on the command line. This is used when run_pipeline.pl -configParameters config.txt... is used. config.txt example entries as follow... First five are using by GetDBConnectionPlugin -config config.txt but that should be refactored to individual PluginParameters. Then entry example would be GetDBConnectionPlugin.DBType=sqlite KinshipPlugin.method=TYPE is the standard. PLUGIN_NAME.COMMAND_LINE_NAME=VALUE host=localHost user=sqlite password=sqlite DB=/tempFileDir/outputDir/phgTestDB.db DBtype=sqlite KinshipPlugin.method=Normalized_IBS
Parameterized - Interface in net.maizegenetics.taxa.tree
interface for class with (optimizable) parameters
Parameterized.Null - Class in net.maizegenetics.taxa.tree
NullParameterized Object Can be used by subclasses to implement parameterized without actually having paramters
Parameterized.ParameterizedBase - Class in net.maizegenetics.taxa.tree
A Utility class for using as the superclass to subclasses which are based on double arrays
Parameterized.ParameterizedUser - Class in net.maizegenetics.taxa.tree
A Utility class for using as the superclass to subclasses which work by adding functionality to a general Parameterized object (the base Parameterized object)
Parameterized.Utils - Class in net.maizegenetics.taxa.tree
 
ParameterizedBase(parameters, lowerLimits, upperLimits, defaultValues) - Constructor for class net.maizegenetics.taxa.tree.Parameterized.ParameterizedBase
Builds a parameterized objects around a set of double arrays
ParameterizedBase(parameters, lowerLimits, upperLimits, defaultValues, parametersSE) - Constructor for class net.maizegenetics.taxa.tree.Parameterized.ParameterizedBase
Builds a parameterized objects around a set of double arrays
ParameterizedBase() - Constructor for class net.maizegenetics.taxa.tree.Parameterized.ParameterizedBase
Builds a parameterized objects around a set of double arrays. The user needs to call setSource() at some point to correctly set things up
ParameterizedUser(base) - Constructor for class net.maizegenetics.taxa.tree.Parameterized.ParameterizedUser
 
ParameterizedUser() - Constructor for class net.maizegenetics.taxa.tree.Parameterized.ParameterizedUser
Sub class should call setParameterizedBase() at some point if using this constructor... otherwise many explosions and the flashing of lights.
parameterSet(baseParameterized, param, localParameter) - Method in interface net.maizegenetics.taxa.tree.MultiParameterized.ParameterAccessWatcher
 
parameterType() - Method in class net.maizegenetics.plugindef.PluginParameter
 
parent1 - Variable in class net.maizegenetics.analysis.imputation.PopulationData
 
parent2 - Variable in class net.maizegenetics.analysis.imputation.PopulationData
 
parentA() - Method in class net.maizegenetics.analysis.data.GenosToABHPlugin
The full name of parent to be encoded as A
parentA(value) - Method in class net.maizegenetics.analysis.data.GenosToABHPlugin
Set Parent A. The full name of parent to be encoded as A
parentageFile() - Method in class net.maizegenetics.analysis.imputation.ImputeProgenyStatesPlugin
The input file containing the parentage which lists the parents of each progeny and whether they were derived by self or outcross.
parentageFile(value) - Method in class net.maizegenetics.analysis.imputation.ImputeProgenyStatesPlugin
Set Parentage Input File. The input file containing the parentage which lists the parents of each progeny and whether they were derived by self or outcross.
parentB() - Method in class net.maizegenetics.analysis.data.GenosToABHPlugin
The full name of parent to be encoded as B
parentB(value) - Method in class net.maizegenetics.analysis.data.GenosToABHPlugin
Set Parent B. The full name of parent to be encoded as B
parentHaplotypeFilename() - Method in class net.maizegenetics.analysis.imputation.ImputeProgenyStatesPlugin
The input file containing the parent haplotypes expressed as nucleotides.
parentHaplotypeFilename(value) - Method in class net.maizegenetics.analysis.imputation.ImputeProgenyStatesPlugin
Set Parent Haplotypes Input File. The input file containing the parent haplotypes expressed as nucleotides.
parentId() - Method in class net.maizegenetics.dna.map.GenomeFeature
 
parentId(parentId) - Method in class net.maizegenetics.dna.map.GenomeFeatureBuilder
 
ParentPhasingPlugin - Class in net.maizegenetics.analysis.imputation
 
ParentPhasingPlugin(parentFrame, isInteractive) - Constructor for class net.maizegenetics.analysis.imputation.ParentPhasingPlugin
 
parents(mom, dad) - Method in class net.maizegenetics.taxa.Taxon.Builder
Set text definition of parents (default=null)
ParetoDistribution - Class in net.maizegenetics.stats.statistics
Pareto distribution (scale-free distribution without characteristic length scale). Parameters: shape parameter k>0, scale parameter m>0 ("minimum income")
parse(source, parsePosition) - Method in class net.maizegenetics.analysis.chart.ManhattanNumberFormat
 
parse(filename) - Static method in class net.maizegenetics.analysis.phg.ParseGVCF
 
parse(args) - Method in class net.maizegenetics.util.ArgsEngine
Parses the input command line arguments. The result of parsing will be stored in the current instance of ArgsEngine.
parseArgs(input) - Method in class net.maizegenetics.pipeline.TasselPipeline
 
ParseBarcodeRead - Class in net.maizegenetics.analysis.gbs
Takes a key file and then sets up the methods to decode a read from the sequencer. The key file decribes how barcodes are related to their taxon. Generally, a keyfile with all flowcells is included, and then the flowcell and lane to be processed are indicated in the constructor.
ParseBarcodeRead(keyFile, enzyme, flowcell, lane) - Constructor for class net.maizegenetics.analysis.gbs.ParseBarcodeRead
Create the barcode parsing object
parseByteWMissing(s) - Static method in class net.maizegenetics.dna.map.TagsOnPhysicalMap
 
parseCharWMissing(s) - Static method in class net.maizegenetics.dna.map.TagsOnPhysicalMap
 
parseCIGAR(cigarString, tagSequence) - Static method in class net.maizegenetics.dna.tag.SAMUtils
Searches a CIGAR string for insertions in the reference sequence.
parseGffLine(line) - Method in class net.maizegenetics.dna.map.GenomeFeatureBuilder
Create a GenomeFeature from a line of GFF file. This method is modified from the BioJava source code for the same purpose, in biojava3-genome/src/main/java/org/biojava3/genome/GFF3Reader.java
ParseGVCF - Class in net.maizegenetics.analysis.phg
 
ParseGVCF.GVCFLine - Class in net.maizegenetics.analysis.phg
 
ParseGVCF.ProcessLines - Class in net.maizegenetics.analysis.phg
 
parseIntWMissing(s) - Static method in class net.maizegenetics.dna.map.TagsOnPhysicalMap
 
parseJsonObject(featureData) - Method in class net.maizegenetics.dna.map.GenomeFeatureBuilder
 
parseKeyfileIntoMap(fileName) - Static method in class net.maizegenetics.analysis.gbs.v2.GBSUtils
Parses a tab-delimited keyFile storing the flow cell and lane values into a multimap. The flow cell is the key, which may have multiple associated lanes.
parseMDField(mdField, tagSequence) - Static method in class net.maizegenetics.dna.tag.SAMUtils
Decodes the MD: field in a SAM file to determine the location of polymorphisms and whether they are mismatches or deletions from the reference sequence.
parseNucleotideDiploidByte(value) - Static method in class net.maizegenetics.dna.snp.NucleotideAlignmentConstants
Returns Optional diploid byte value for given nucleotide value. First four bits contain first allele value. And second four bits contain second allele value. Optional empty if not present in the Hash.
parseReadIntoTagAndTaxa(seqS, qualS, fastq, minQual) - Method in class net.maizegenetics.analysis.gbs.ParseBarcodeRead
Return a class ReadBarcodeResult that captures the processed read and taxa inferred by the barcode
parseReadIntoTagAndTaxa(seqSF, qualSF, seqSB, qualSB, fastq, minQual, tagLengthInLong) - Method in class net.maizegenetics.analysis.gbs.PEParseBarcodeRead
Parse sequence pair to a PE tag and taxon.
parseVCFHeadersIntoMap(s) - Static method in class net.maizegenetics.taxa.TaxaListIOUtils
Parses a VCF header with the taxa names and annotations into a multimap. The taxa name is return as the "ID" key, as used by the VCF format.
PartitionedLinearModel - Class in net.maizegenetics.stats.linearmodels
 
PartitionedLinearModel(baseModel, lm) - Constructor for class net.maizegenetics.stats.linearmodels.PartitionedLinearModel
 
PartitionedLinearModel(baseModel, lm) - Constructor for class net.maizegenetics.stats.linearmodels.PartitionedLinearModel
 
PassThroughPlugin - Class in net.maizegenetics.analysis.data
 
PassThroughPlugin() - Constructor for class net.maizegenetics.analysis.data.PassThroughPlugin
Creates a new instance of PassThroughPlugin
password(value) - Method in class net.maizegenetics.analysis.gobii.GOBIIPlugin
Set Password. Password
password() - Method in class net.maizegenetics.plugindef.PluginParameter.Builder
 
path_type - Variable in class net.maizegenetics.analysis.gbs.neobio.LocalAlignmentBlock
The type of the highest scoring path ending at a given position of the output border of a block.
pChr - Variable in class net.maizegenetics.dna.map.TagGWASMapInfo
Physical chromosome of tag, unknown = Integer.MIN_VALUE
PDAnnotation - Class in net.maizegenetics.dna.pd
 
PDAnnotation(hapMapPath, pathGwas, annoPath, outputFile, startChr, endChr) - Constructor for class net.maizegenetics.dna.pd.PDAnnotation
 
pdf(x, n) - Static method in class net.maizegenetics.stats.statistics.ApproxFastChiSquareDistribution
probability density function of the chi-square distribution
pdf(x, n) - Static method in class net.maizegenetics.stats.statistics.ChiSquareDistribution
probability density function of the chi-square distribution
pdf(x, lambda) - Static method in class net.maizegenetics.stats.statistics.ExponentialDistribution
probability density function of the exponential distribution (mean = 1/lambda)
pdf(x, shape, scale) - Static method in class net.maizegenetics.stats.statistics.GammaDistribution
probability density function of the Gamma distribution
pdf(x, m, sd) - Static method in class net.maizegenetics.stats.statistics.NormalDistribution
probability density function
pdf(x, k, m) - Static method in class net.maizegenetics.stats.statistics.ParetoDistribution
probability density function of the Pareto distribution
PDReport - Class in net.maizegenetics.dna.pd
User: dkroon Date: 6/25/13
PDReport(polymorphismDescriptorFile) - Constructor for class net.maizegenetics.dna.pd.PDReport
 
pedFile() - Method in class net.maizegenetics.analysis.data.PlinkLoadPlugin
Ped File
pedFile(value) - Method in class net.maizegenetics.analysis.data.PlinkLoadPlugin
Set Ped File. Ped File
pedFilename() - Method in class net.maizegenetics.analysis.distance.AMatrixPlugin
Create A Matrix
pedFilename(value) - Method in class net.maizegenetics.analysis.distance.AMatrixPlugin
Set Ped Filename. Create A Matrix
pedigree(val) - Method in class net.maizegenetics.taxa.Taxon.Builder
Set text definition of pedigree (default=null)
pedigreeFile() - Method in class net.maizegenetics.analysis.gbs.DiscoverySNPCallerPlugin
Pedigree file containing full sample names (or expected names after merging) & expected inbreeding coefficient (F) for each. Only taxa with expected F >= mnF used to calculate F = 1-Ho/He. (default: use ALL taxa to calculate F
pedigreeFile(value) - Method in class net.maizegenetics.analysis.gbs.DiscoverySNPCallerPlugin
Set Pedigree File. Pedigree file containing full sample names (or expected names after merging) & expected inbreeding coefficient (F) for each. Only taxa with expected F >= mnF used to calculate F = 1-Ho/He. (default: use ALL taxa to calculate F
PedigreeKey - Static variable in class net.maizegenetics.taxa.Taxon
Standard key for the pedigree of the taxon
pedigrees() - Method in class net.maizegenetics.analysis.imputation.FSFHapImputationPlugin
the pedigree file name
pedigrees(value) - Method in class net.maizegenetics.analysis.imputation.FSFHapImputationPlugin
Set Pedigrees. the pedigree file name
pedMatrix(pedigree) - Method in class net.maizegenetics.analysis.distance.AMatrixPlugin
peek() - Method in class net.maizegenetics.analysis.avro.GenericArrayPositions
 
peek() - Method in class net.maizegenetics.analysis.avro.GenericArrayTaxa
 
PEFastqChunk - Class in net.maizegenetics.dna.read
Hold PE Fastq file. Providing merging function
PEFastqChunk(fastqR1FileS, fastqR2FileS, format, startIndex, readNum) - Constructor for class net.maizegenetics.dna.read.PEFastqChunk
Constructor to sample PE Fastq files, ignore those bad sequence at the beginning
PEFastqChunk(fastqR1FileS, fastqR2FileS, format) - Constructor for class net.maizegenetics.dna.read.PEFastqChunk
Constructor to read in whole PE Fastq files, fastq file should be small for test
PenalizedLikelihood - Class in net.maizegenetics.stats.statistics
Penalized likelihood criteria
PEParseBarcodeRead - Class in net.maizegenetics.analysis.gbs
 
PEParseBarcodeRead(keyFile, enzyme, flowcell, lane) - Constructor for class net.maizegenetics.analysis.gbs.PEParseBarcodeRead
Construct empty object from key file, enzyme and Illumina data from a lane. Set up likely end and barcode for parsing data
percentageMasked() - Method in class net.maizegenetics.analysis.data.MaskGenotypePlugin
Percentage of genotypes to mask.
percentageMasked(value) - Method in class net.maizegenetics.analysis.data.MaskGenotypePlugin
Set Percentage Masked. Percentage of genotypes to mask.
percentNotMissing() - Method in class net.maizegenetics.dna.snp.genotypecall.Stats
 
PERead - Class in net.maizegenetics.dna.read
Holding paired end read. Providing merging function
PERead(rf, rb) - Constructor for class net.maizegenetics.dna.read.PERead
 
PEReadBarcodeResult - Class in net.maizegenetics.analysis.gbs
Container class for returning the results of parsed barcoded sequencing read.
PEReadBarcodeResult(rF, rB) - Constructor for class net.maizegenetics.analysis.gbs.PEReadBarcodeResult
Construct object from forward and backward sequence
perfectMatch - Variable in class net.maizegenetics.dna.map.TagMappingInfoV3
If the alignment is a perfect match to the reference, y = 1, n = 0, unknown = Byte.MIN_VALUE
performCrossValidation() - Method in class net.maizegenetics.analysis.association.GenomicSelectionPlugin
Perform cross-validation: True or False
performCrossValidation(value) - Method in class net.maizegenetics.analysis.association.GenomicSelectionPlugin
Set Perform cross-validation. Perform cross-validation: True or False
performFunction(input) - Method in class net.maizegenetics.analysis.association.RidgeRegressionEmmaPlugin
 
performFunction(input) - Method in class net.maizegenetics.analysis.chart.ChartDisplayPlugin
 
performFunction(input) - Method in class net.maizegenetics.analysis.chart.ManhattanDisplayPlugin
 
performFunction(input) - Method in class net.maizegenetics.analysis.chart.QQDisplayPlugin
 
performFunction(input) - Method in class net.maizegenetics.analysis.chart.TableDisplayPlugin
 
performFunction(dataSet) - Method in class net.maizegenetics.analysis.data.CombineDataSetsPlugin
Returns combined data set if all inputs have been received.
performFunction(input) - Method in class net.maizegenetics.analysis.data.ExportMultiplePlugin
 
performFunction(input) - Method in class net.maizegenetics.analysis.data.ExtractHapmapSubsetPlugin
 
performFunction(input) - Method in class net.maizegenetics.analysis.data.HetsToUnknownPlugin
Returns Homozygous version of input Genotype Table.
performFunction(input) - Method in class net.maizegenetics.analysis.data.IntersectionAlignmentPlugin
 
performFunction(input) - Method in class net.maizegenetics.analysis.data.MergeAlignmentsSameSitesPlugin
 
performFunction(input) - Method in class net.maizegenetics.analysis.data.MergeGenotypeTablesPlugin
 
performFunction(input) - Method in class net.maizegenetics.analysis.data.MergeHDF5GenotypesSameSitesPlugin
 
performFunction(dataSet) - Method in class net.maizegenetics.analysis.data.PassThroughPlugin
 
performFunction(input) - Method in class net.maizegenetics.analysis.data.SeparatePlugin
 
performFunction(input) - Method in class net.maizegenetics.analysis.data.SynonymizerPlugin
 
performFunction(input) - Method in class net.maizegenetics.analysis.data.UnionAlignmentPlugin
 
performFunction(input) - Method in class net.maizegenetics.analysis.distance.DistanceMatrixRangesPlugin
 
performFunction(input) - Method in class net.maizegenetics.analysis.filter.FilterAlignmentPlugin
 
performFunction(input) - Method in class net.maizegenetics.analysis.filter.FilterDataSetPlugin
 
performFunction(input) - Method in class net.maizegenetics.analysis.filter.FilterSiteNamePlugin
Deprecated.
 
performFunction(input) - Method in class net.maizegenetics.analysis.filter.FilterSubsetPlugin
 
performFunction(input) - Method in class net.maizegenetics.analysis.filter.FilterTraitsPlugin
 
performFunction(input) - Method in class net.maizegenetics.analysis.gbs.AnnotateTOPMwSAMPlugin
 
performFunction(input) - Method in class net.maizegenetics.analysis.gbs.CompareGenosBetweenHapMapFilesPlugin
 
performFunction(input) - Method in class net.maizegenetics.analysis.gbs.ContigPETagCountPlugin
 
performFunction(input) - Method in class net.maizegenetics.analysis.gbs.FastqToPETagCountPlugin
 
performFunction(input) - Method in class net.maizegenetics.analysis.gbs.FastqToTBTPlugin
 
performFunction(input) - Method in class net.maizegenetics.analysis.gbs.KeepSpecifiedReadsinFastqPlugin
 
performFunction(input) - Method in class net.maizegenetics.analysis.gbs.KeepSpecifiedSitesInTOPMPlugin
 
performFunction(input) - Method in class net.maizegenetics.analysis.gbs.KmerToTagCountPlugin
 
performFunction(input) - Method in class net.maizegenetics.analysis.gbs.KmerToTBTPlugin
 
performFunction(input) - Method in class net.maizegenetics.analysis.gbs.MergeDuplicateSNPsPlugin
 
performFunction(input) - Method in class net.maizegenetics.analysis.gbs.MergeMultipleTOPMPlugin
 
performFunction(input) - Method in class net.maizegenetics.analysis.gbs.MergePETagCountPlugin
 
performFunction(input) - Method in class net.maizegenetics.analysis.gbs.MergeTagsByTaxaFilesByRowPlugin
 
performFunction(input) - Method in class net.maizegenetics.analysis.gbs.MergeTagsByTaxaFilesPlugin
 
performFunction(input) - Method in class net.maizegenetics.analysis.gbs.pana.PanAAddPosToTagMapPlugin
 
performFunction(input) - Method in class net.maizegenetics.analysis.gbs.pana.PanABuildPivotTBTPlugin
 
performFunction(input) - Method in class net.maizegenetics.analysis.gbs.pana.PanABuildTagBlockPosPlugin
 
performFunction(input) - Method in class net.maizegenetics.analysis.gbs.pana.PanABuildTagGWASMapPlugin
 
performFunction(input) - Method in class net.maizegenetics.analysis.gbs.pana.PanABuildTrainingSetPlugin
 
performFunction(input) - Method in class net.maizegenetics.analysis.gbs.pana.PanAFilteringTagMapPlugin
 
performFunction(input) - Method in class net.maizegenetics.analysis.gbs.pana.PanAH5ToAnchorPlugin
 
performFunction(input) - Method in class net.maizegenetics.analysis.gbs.pana.PanAMergeMappingResultPlugin
 
performFunction(input) - Method in class net.maizegenetics.analysis.gbs.pana.PanAModelTrainingPlugin
 
performFunction(input) - Method in class net.maizegenetics.analysis.gbs.pana.PanAPredictionPlugin
 
performFunction(input) - Method in class net.maizegenetics.analysis.gbs.pana.PanAReadDigestPlugin
 
performFunction(input) - Method in class net.maizegenetics.analysis.gbs.pana.PanAReadToKmerPlugin
 
performFunction(input) - Method in class net.maizegenetics.analysis.gbs.pana.PanASamToMultiPositionTOPMPlugin
 
performFunction(input) - Method in class net.maizegenetics.analysis.gbs.pana.PanASplitTagBlockPosPlugin
 
performFunction(input) - Method in class net.maizegenetics.analysis.gbs.pana.PanASplitTBTPlugin
 
performFunction(input) - Method in class net.maizegenetics.analysis.gbs.pana.PanATagGWASMappingPlugin
 
performFunction(input) - Method in class net.maizegenetics.analysis.gbs.pana.PanATagMapToFastaPlugin
 
performFunction(input) - Method in class net.maizegenetics.analysis.gbs.QseqToPETagCountPlugin
 
performFunction(input) - Method in class net.maizegenetics.analysis.gbs.QseqToTagCountPlugin
 
performFunction(input) - Method in class net.maizegenetics.analysis.gbs.QseqToTBTPlugin
 
performFunction(input) - Method in class net.maizegenetics.analysis.gbs.SAMWGMapConverterPlugin
 
performFunction(input) - Method in class net.maizegenetics.analysis.gbs.TagAgainstAnchorPlugin
 
performFunction(input) - Method in class net.maizegenetics.analysis.gbs.TextToBinaryPlugin
 
performFunction(input) - Method in class net.maizegenetics.analysis.gbs.TOPMSummaryPlugin
 
performFunction(input) - Method in class net.maizegenetics.analysis.imputation.CallParentAllelesPlugin
 
performFunction(input) - Method in class net.maizegenetics.analysis.imputation.FindMergeHaplotypesPlugin
 
performFunction(input) - Method in class net.maizegenetics.analysis.imputation.ViterbiAlgorithmPlugin
 
performFunction(input) - Method in class net.maizegenetics.analysis.imputation.WritePopulationAlignmentPlugin
 
performFunction(input) - Method in class net.maizegenetics.analysis.popgen.LinkageDiseqDisplayPlugin
 
performFunction(input) - Method in class net.maizegenetics.analysis.popgen.LinkageDisequilibriumPlugin
Workhorse function to actually run LD on a dataset
performFunction(input) - Method in class net.maizegenetics.analysis.tree.ArchaeopteryxPlugin
 
performFunction(input) - Method in class net.maizegenetics.plugindef.AbstractPlugin
 
performFunction(input) - Method in interface net.maizegenetics.plugindef.Plugin
Performs function of this plugin.
performFunction(input) - Method in class net.maizegenetics.tassel.TasselLogging
 
performFunctionForAlignment(inputAlignment) - Method in class net.maizegenetics.analysis.data.ExportPlugin
 
performFunctionForDistanceMatrix(input) - Method in class net.maizegenetics.analysis.data.ExportPlugin
 
performFunctionForFilter(filter) - Method in class net.maizegenetics.analysis.data.ExportPlugin
 
performFunctionForPhenotype(input) - Method in class net.maizegenetics.analysis.data.ExportPlugin
 
performFunctionForPositionList(input) - Method in class net.maizegenetics.analysis.data.ExportPlugin
 
performFunctionForSimpleTree(input) - Method in class net.maizegenetics.analysis.data.ExportPlugin
 
performFunctionForTableReport(input) - Method in class net.maizegenetics.analysis.data.ExportPlugin
 
performFunctionForTaxaList(input) - Method in class net.maizegenetics.analysis.data.ExportPlugin
 
permpvalueColumn - Variable in class net.maizegenetics.analysis.association.AbstractFixedEffectLM
 
permutationAlpha - Variable in class net.maizegenetics.analysis.modelfitter.StepwiseAdditiveModelFitter
 
permutationAlpha(alpha) - Method in class net.maizegenetics.analysis.modelfitter.StepwiseAdditiveModelFitter
 
permutationAlpha() - Method in class net.maizegenetics.analysis.modelfitter.StepwiseAdditiveModelFitterPlugin
Type I errors will be controlled at this level.
permutationAlpha(value) - Method in class net.maizegenetics.analysis.modelfitter.StepwiseAdditiveModelFitterPlugin
Set Alpha for permutations. Type I errors will be controlled at this level.
permutationReportBuilder - Variable in class net.maizegenetics.analysis.modelfitter.StepwiseAdditiveModelFitter
 
permutationTest(permute, nperm) - Method in class net.maizegenetics.analysis.association.AbstractFixedEffectLM
 
permutationTest(permute, nperm) - Method in interface net.maizegenetics.analysis.association.FixedEffectLM
 
permute - Variable in class net.maizegenetics.analysis.association.AbstractFixedEffectLM
 
permute() - Method in class net.maizegenetics.analysis.association.FixedEffectLMPlugin
Should a permutation analysis be run? The permutation analysis controls the experiment-wise error rate for individual phenotypes.
permute(value) - Method in class net.maizegenetics.analysis.association.FixedEffectLMPlugin
Set Run Permutations. Should a permutation analysis be run? The permutation analysis controls the experiment-wise error rate for individual phenotypes.
permuteData(data) - Method in class net.maizegenetics.stats.linearmodels.WithinPopulationPermuter
 
permutedData - Variable in class net.maizegenetics.analysis.association.AbstractFixedEffectLM
 
pError - Variable in class net.maizegenetics.analysis.popgen.DonorHypoth
 
PETagCounts - Class in net.maizegenetics.dna.tag
Hold PE tags and their counts, also including contigs
PETagCounts(inFile, format) - Constructor for class net.maizegenetics.dna.tag.PETagCounts
Construct PETagCounts from a file
PETagCounts(tagLengthInLong, tagNum) - Constructor for class net.maizegenetics.dna.tag.PETagCounts
Initialize PETagCounts with empty matrix
PETags - Interface in net.maizegenetics.dna.tag
Basic interface for holding sets of sequence tag (these are compressed into 2-bit codings of tags). The length of tag in good sequence is also tracked.
PETagsOnPhysicalMap - Class in net.maizegenetics.dna.map
 
PETagsOnPhysicalMap(infileS, format) - Constructor for class net.maizegenetics.dna.map.PETagsOnPhysicalMap
 
PETagsOnPhysicalMap(ptc, fSamFileS, bSamFileS, contigSamFileS) - Constructor for class net.maizegenetics.dna.map.PETagsOnPhysicalMap
 
PETagsOnPhysicalMapV3 - Class in net.maizegenetics.dna.map
This class hold the multiple mapping positions of PE tags, including forward and backward PE tags. Data in this class are used to annotate HDF5TOPM When contig exist, the forward and backword tags are the contig and reverse complement of the contig, respectively. The PE tags were first aligned with bowtie2 (-k N), any number of mapping position can be imported PE tags of both end are stored in one long array with variable length, then they were truncated to 2 longs. This is easy for searching Using a pairIndex, each 64 bp tag has a index pointing to the other end of PE. It is worth noting that, the 64 bp tags are not unique. Rarely, there are multiple identical 64 bp tags, although the full length PE tags are unique. When multiple identical 64 bp tags exist, the one with longest full length PE is used to annotate HDF5TOPM.
PETagsOnPhysicalMapV3(PETOPMFileS) - Constructor for class net.maizegenetics.dna.map.PETagsOnPhysicalMapV3
Constructor from a file
PETagsOnPhysicalMapV3(fFastaFileS, bFastaFileS, fSamFileS, bSamFileS) - Constructor for class net.maizegenetics.dna.map.PETagsOnPhysicalMapV3
Constructor using fasta files and sam files
pev - Variable in class net.maizegenetics.stats.EMMA.EMMAforDoubleMatrix
 
phased() - Method in class net.maizegenetics.analysis.phg.ParseGVCF.GVCFLine
 
phasedResults - Variable in class net.maizegenetics.analysis.popgen.DonorHypoth
 
PhaseHighCoverage - Class in net.maizegenetics.analysis.imputation
 
PhaseHighCoverage(genotype) - Constructor for class net.maizegenetics.analysis.imputation.PhaseHighCoverage
 
phaseParentsUsingAllAvailableProgeny(minEigenRatio, savepath) - Method in class net.maizegenetics.analysis.imputation.PhaseHighCoverage
 
phaseParentsUsingAllAvailableProgeny(minEigenRatio) - Method in class net.maizegenetics.analysis.imputation.PhaseHighCoverage
 
phaseParentUsingOneProgeny(parent, otherParent, progeny, gt) - Method in class net.maizegenetics.analysis.imputation.PhaseHighCoverage
 
phaseParentUsingSelfAndCrossProgeny(parent, myGeno, minEigenRatio, plotInfo) - Method in class net.maizegenetics.analysis.imputation.PhaseHighCoverage
 
phaseSelfedParents(parentpath, savepath) - Method in class net.maizegenetics.analysis.imputation.SelfedHaplotypeFinder
 
phenotype() - Method in class net.maizegenetics.analysis.modelfitter.AbstractForwardRegression
 
phenotype() - Method in interface net.maizegenetics.analysis.modelfitter.ForwardRegression
 
phenotype() - Method in class net.maizegenetics.phenotype.GenotypePhenotype
 
phenotype(thePhenotype) - Method in class net.maizegenetics.phenotype.GenotypePhenotypeBuilder
 
Phenotype - Interface in net.maizegenetics.phenotype
Phenotype represents phenotype data as a two dimensional matrix. Rows are observations. Columns are attributes.
Phenotype.ATTRIBUTE_TYPE - Enum in net.maizegenetics.phenotype
 
PhenotypeAttribute - Interface in net.maizegenetics.phenotype
 
PhenotypeBuilder - Class in net.maizegenetics.phenotype
 
PhenotypeBuilder() - Constructor for class net.maizegenetics.phenotype.PhenotypeBuilder
 
phenotypeFile() - Method in class net.maizegenetics.analysis.distance.VCAPScanPlugin
Phenotype File
phenotypeFile(value) - Method in class net.maizegenetics.analysis.distance.VCAPScanPlugin
Set Phenotype File. Phenotype File
PhenotypeLM - Class in net.maizegenetics.analysis.association
 
PhenotypeLM(phenotypeOnly) - Constructor for class net.maizegenetics.analysis.association.PhenotypeLM
 
phenotypeOnly() - Method in class net.maizegenetics.analysis.association.FixedEffectLMPlugin
Should the phenotype be analyzed with no markers and BLUEs generated? (BLUE = best linear unbiased estimate)
phenotypeOnly(value) - Method in class net.maizegenetics.analysis.association.FixedEffectLMPlugin
Set Analyze Phenotype Only. Should the phenotype be analyzed with no markers and BLUEs generated? (BLUE = best linear unbiased estimate)
PhenotypeUtils - Class in net.maizegenetics.phenotype
 
phet() - Method in class net.maizegenetics.analysis.imputation.FSFHapImputationPlugin
proportion of sites that are heterozygous
phet(value) - Method in class net.maizegenetics.analysis.imputation.FSFHapImputationPlugin
Set Phet. proportion of sites that are heterozygous
pHeterozygous - Variable in class net.maizegenetics.analysis.popgen.DonorHypoth
 
pHomoD1 - Variable in class net.maizegenetics.analysis.popgen.DonorHypoth
 
pHomoD2 - Variable in class net.maizegenetics.analysis.popgen.DonorHypoth
 
physicalMapFile() - Method in class net.maizegenetics.analysis.gbs.SeqToTBTHDF5Plugin
Physical map file containing alignments. (Only -t or -m allowed)
physicalMapFile(value) - Method in class net.maizegenetics.analysis.gbs.SeqToTBTHDF5Plugin
Set Physical Map File. Physical map file containing alignments. (Only -t or -m allowed)
physicalPositions() - Method in interface net.maizegenetics.dna.map.PositionList
Returns all physical positions.
physicalPositions() - Method in class net.maizegenetics.dna.snp.CombineGenotypeTable
 
physicalPositions() - Method in class net.maizegenetics.dna.snp.CoreGenotypeTable
 
physicalPositions() - Method in interface net.maizegenetics.dna.snp.GenotypeTable
Returns all physical positions.
physicalPositions() - Method in class net.maizegenetics.dna.snp.MergedGenotypeTable
 
physicalPositions() - Method in class net.maizegenetics.dna.snp.TOPMGenotypeTable
 
PieChartPanel - Class in net.maizegenetics.analysis.chart
Title: PieChartPanel
PieChartPanel(theTable) - Constructor for class net.maizegenetics.analysis.chart.PieChartPanel
 
pivotOn(factors) - Method in class net.maizegenetics.phenotype.PhenotypeBuilder
 
pivotTBTHDF5File() - Method in class net.maizegenetics.analysis.gbs.ModifyTBTHDF5Plugin
 
pivotTBTHDF5File(value) - Method in class net.maizegenetics.analysis.gbs.ModifyTBTHDF5Plugin
 
platformName() - Method in class net.maizegenetics.analysis.gobii.MarkerDNARun_IFLFilePlugin
THe platform on which this data set was run, e.g. GBSv27. Must match a platform name from the platform db table
platformName(value) - Method in class net.maizegenetics.analysis.gobii.MarkerDNARun_IFLFilePlugin
Set Platform Name. THe platform on which this data set was run, e.g. GBSv27. Must match a platform name from the platform db table
PlinkLoadPlugin - Class in net.maizegenetics.analysis.data
 
PlinkLoadPlugin(parentFrame, isInteractive) - Constructor for class net.maizegenetics.analysis.data.PlinkLoadPlugin
Creates a new instance of PlinkLoadPlugin
plinkToPed(ped) - Static method in class net.maizegenetics.analysis.distance.AMatrixPlugin
Takes a filepath to a PLINK formatted file(see below). Converts to a String[][] format where each row contains 3 columns: Individual Identifier, Paternal Identifier, Maternal Identifier This format is convenient in calculating an pedigree-based kinship (A) matrix Expected PLINK pedigree file format (.ped) Family ID Individual ID Paternal ID Maternal ID and several more fields These fields are separated by one or more whitespace characters, and each row is on its own line. For our purposes, we expect every Individual ID in the file to be unique
plm - Variable in class net.maizegenetics.analysis.modelfitter.ForwardStepAdditiveSpliterator
 
ploidy() - Method in class net.maizegenetics.analysis.phg.ParseGVCF.GVCFLine
 
Plugin - Interface in net.maizegenetics.plugindef
 
Plugin.PARAMETER_PROPERTIES - Enum in net.maizegenetics.plugindef
 
PluginAction - Interface in net.maizegenetics.plugindef
 
pluginDescription() - Method in class net.maizegenetics.analysis.association.GenomicSelectionPlugin
 
pluginDescription() - Method in class net.maizegenetics.analysis.data.HDF5SummaryPlugin
 
pluginDescription() - Method in class net.maizegenetics.analysis.data.MergeGenotypeTablesPluginV2
 
pluginDescription() - Method in class net.maizegenetics.analysis.data.MergeRenameDeleteTaxaPlugin
 
pluginDescription() - Method in class net.maizegenetics.analysis.data.PrincipalComponentsPlugin
 
pluginDescription() - Method in class net.maizegenetics.analysis.data.SetLowDepthGenosToMissingPlugin
 
pluginDescription() - Method in class net.maizegenetics.analysis.data.SortGenotypeFilePlugin
 
pluginDescription() - Method in class net.maizegenetics.analysis.distance.AMatrixPlugin
 
pluginDescription() - Method in class net.maizegenetics.analysis.distance.MultiDimensionalScalingPlugin
 
pluginDescription() - Method in class net.maizegenetics.analysis.gbs.BinaryToTextPlugin
 
pluginDescription() - Method in class net.maizegenetics.analysis.gbs.UTagCountToTagPairPlugin
 
pluginDescription() - Method in class net.maizegenetics.analysis.gbs.UTagPairToTOPMPlugin
 
pluginDescription() - Method in class net.maizegenetics.analysis.imputation.FSFHapImputationPlugin
 
pluginDescription() - Method in class net.maizegenetics.analysis.imputation.ImputeProgenyStatesPlugin
 
pluginDescription() - Method in class net.maizegenetics.analysis.imputation.ParentPhasingPlugin
 
pluginDescription() - Method in class net.maizegenetics.analysis.imputation.ReImputeUpdatedTaxaByFILLINPlugin
 
pluginDescription() - Method in class net.maizegenetics.analysis.modelfitter.AdditiveSiteStorePlugin
 
pluginDescription() - Method in class net.maizegenetics.analysis.modelfitter.ResamplingGWASPlugin
 
pluginDescription() - Method in class net.maizegenetics.analysis.modelfitter.StepwiseAdditiveModelFitterPlugin
 
pluginDescription() - Method in class net.maizegenetics.analysis.numericaltransform.ImputationPlugin
 
pluginDescription() - Method in class net.maizegenetics.analysis.numericaltransform.NumericalGenotypePlugin
 
pluginDescription() - Method in class net.maizegenetics.plugindef.AbstractPlugin
 
pluginDescription() - Method in interface net.maizegenetics.plugindef.Plugin
Returns description of the plugin.
PluginEvent - Class in net.maizegenetics.plugindef
 
PluginEvent(source) - Constructor for class net.maizegenetics.plugindef.PluginEvent
Creates a new instance of PluginEvent
PluginEvent(source, metaData) - Constructor for class net.maizegenetics.plugindef.PluginEvent
Creates a new instance of PluginEvent
PluginListener - Interface in net.maizegenetics.plugindef
 
PluginParameter<T> - Class in net.maizegenetics.plugindef
Defines the attributes of parameters to be used in the plugins
PluginParameter(oldParameter, newValue) - Constructor for class net.maizegenetics.plugindef.PluginParameter
Use these to change the value of an existing parameter, e.g. after a user changes the value. Otherwise use the Builder to create the parameter
PluginParameter(oldParameter, possibleValues) - Constructor for class net.maizegenetics.plugindef.PluginParameter
Use this to change the possible values of a PluginParameter built as objectListSingleSelect().
PluginParameter.Builder<T> - Class in net.maizegenetics.plugindef
 
PluginParameter.PARAMETER_TYPE - Enum in net.maizegenetics.plugindef
 
pluginParameters() - Method in class net.maizegenetics.plugindef.AbstractPlugin
 
pluginParameters() - Method in interface net.maizegenetics.plugindef.Plugin
Get map of plugin parameters. Key is command line name and value is current value.
PluginProgressUnit - Class in net.maizegenetics.progress
 
PluginProgressUnit(plugin, level) - Constructor for class net.maizegenetics.progress.PluginProgressUnit
 
PluginProgressUnit(plugin, level, cancelButton) - Constructor for class net.maizegenetics.progress.PluginProgressUnit
 
PluginProgressUnit(plugin, level, cancelButton, cancelPlugin) - Constructor for class net.maizegenetics.progress.PluginProgressUnit
 
pluginUserManualURL() - Method in class net.maizegenetics.analysis.data.CreateHybridGenotypesPlugin
 
pluginUserManualURL() - Method in class net.maizegenetics.analysis.data.ExportPlugin
 
pluginUserManualURL() - Method in class net.maizegenetics.analysis.data.GenosToABHPlugin
 
pluginUserManualURL() - Method in class net.maizegenetics.analysis.data.GenotypeSummaryPlugin
 
pluginUserManualURL() - Method in class net.maizegenetics.analysis.distance.KinshipPlugin
 
pluginUserManualURL() - Method in class net.maizegenetics.analysis.distance.MultiDimensionalScalingPlugin
 
pluginUserManualURL() - Method in class net.maizegenetics.analysis.distance.RemoveNaNFromDistanceMatrixPlugin
 
pluginUserManualURL() - Method in class net.maizegenetics.analysis.distance.VCAPScanPlugin
 
pluginUserManualURL() - Method in class net.maizegenetics.analysis.filter.FilterSiteBuilderPlugin
 
pluginUserManualURL() - Method in class net.maizegenetics.analysis.filter.FilterTaxaBuilderPlugin
 
pluginUserManualURL() - Method in class net.maizegenetics.analysis.numericaltransform.AvgPhenotypeByTaxaPlugin
 
pluginUserManualURL() - Method in class net.maizegenetics.analysis.numericaltransform.BoxCoxTransformationPlugin
 
pluginUserManualURL() - Method in class net.maizegenetics.analysis.numericaltransform.SubtractPhenotypeByTaxaPlugin
 
pluginUserManualURL() - Method in class net.maizegenetics.analysis.tree.CreateTreePlugin
 
pluginUserManualURL() - Method in class net.maizegenetics.plugindef.AbstractPlugin
 
pluginUserManualURL() - Method in interface net.maizegenetics.plugindef.Plugin
Returns URL to User Manual.
plus(dm) - Method in class net.maizegenetics.matrixalgebra.Matrix.BlasDoubleMatrix
 
plus(dm) - Method in class net.maizegenetics.matrixalgebra.Matrix.ColtDoubleMatrix
 
plus(dm) - Method in interface net.maizegenetics.matrixalgebra.Matrix.DoubleMatrix
 
plus(dm) - Method in class net.maizegenetics.matrixalgebra.Matrix.EJMLDoubleMatrix
 
plusEquals(dm) - Method in class net.maizegenetics.matrixalgebra.Matrix.BlasDoubleMatrix
 
plusEquals(dm) - Method in class net.maizegenetics.matrixalgebra.Matrix.ColtDoubleMatrix
 
plusEquals(dm) - Method in interface net.maizegenetics.matrixalgebra.Matrix.DoubleMatrix
This function adds dm, modifying the original matrix
plusEquals(dm) - Method in class net.maizegenetics.matrixalgebra.Matrix.EJMLDoubleMatrix
 
PolymorphismDistribution - Class in net.maizegenetics.analysis.popgen
This class provides the distribution of polymorphisms
PolymorphismDistribution() - Constructor for class net.maizegenetics.analysis.popgen.PolymorphismDistribution
 
PolymorphismFinder - Class in net.maizegenetics.analysis.gbs
 
PolymorphismFinder(rbt) - Constructor for class net.maizegenetics.analysis.gbs.PolymorphismFinder
 
pop(x) - Static method in class net.maizegenetics.util.BitUtil
Returns the number of bits set in the long
pop_andnot(A, B, wordOffset, numWords) - Static method in class net.maizegenetics.util.BitUtil
Returns the popcount or cardinality of A & ~B Neither array is modified.
pop_array(A, wordOffset, numWords) - Static method in class net.maizegenetics.util.BitUtil
* Returns the number of set bits in an array of longs.
pop_array_to_index(A, index) - Static method in class net.maizegenetics.util.BitUtil
 
POP_GEN - Static variable in class net.maizegenetics.dna.snp.HapMapHDF5Constants
 
pop_intersect(A, B, wordOffset, numWords) - Static method in class net.maizegenetics.util.BitUtil
Returns the popcount or cardinality of the two sets after an intersection. Neither array is modified.
pop_union(A, B, wordOffset, numWords) - Static method in class net.maizegenetics.util.BitUtil
Returns the popcount or cardinality of the union of two sets. Neither array is modified.
pop_xor(A, B, wordOffset, numWords) - Static method in class net.maizegenetics.util.BitUtil
 
populateBlock(blockIndex) - Method in class net.maizegenetics.dna.map.TagGWASMap
 
populateBlock(blockIndex) - Method in class net.maizegenetics.dna.tag.AbstractTagsHDF5
Populate a block in memory with default values, update current block index at the same time
populateChrAndVarPositions() - Method in class net.maizegenetics.dna.map.AbstractTagsOnPhysicalMap
Creates the arrays for the all the positions for each chromosome as defined by the variants. Call this method after remapping or after loading the file, and it will be used for SNP calling.
populateTableFromFile(conn, table, sourceFile, header) - Static method in class net.maizegenetics.analysis.gobii.GOBIIDbUtils
 
PopulationData - Class in net.maizegenetics.analysis.imputation
 
posEndB - Variable in class net.maizegenetics.dna.map.AbstractPETagsOnPhysicalMap
 
posEndContig - Variable in class net.maizegenetics.dna.map.AbstractPETagsOnPhysicalMap
 
posEndF - Variable in class net.maizegenetics.dna.map.AbstractPETagsOnPhysicalMap
 
position() - Method in class net.maizegenetics.analysis.gbs.repgen.RefTagData
 
position - Variable in class net.maizegenetics.analysis.gbs.SimpleGenotypeSBit
 
position - Variable in class net.maizegenetics.analysis.modelfitter.AbstractAdditiveSite
 
position() - Method in class net.maizegenetics.analysis.modelfitter.AbstractAdditiveSite
 
position() - Method in interface net.maizegenetics.analysis.modelfitter.AdditiveSite
 
position - Variable in class net.maizegenetics.analysis.modelfitter.SNP
 
position(val) - Method in class net.maizegenetics.dna.map.GeneralPosition.Builder
Set Position in Chromosome
position(position) - Method in class net.maizegenetics.dna.map.GenomeFeatureBuilder
 
position(position) - Method in class net.maizegenetics.dna.map.GenomeFeatureBuilder
 
Position - Interface in net.maizegenetics.dna.map
Defines a genomic positions and its known variants. Includes attributes of chromosome, position, sub-position, strand, name (or SNP ID), whether this position is a nucleotide, or includes an indel.
position - Variable in class net.maizegenetics.dna.map.TagGeneticMappingInfo
Position of the most significant site
position() - Method in interface net.maizegenetics.dna.snp.Allele
 
position() - Method in class net.maizegenetics.dna.snp.SimpleAllele
 
position() - Method in class net.maizegenetics.stats.linearmodels.SolveByOrthogonalizing.Marker
 
POSITION_ALLELE_VALUE - Static variable in class net.maizegenetics.analysis.avro.AvroConstants
 
POSITION_ATTRIBUTES_PATH - Static variable in class net.maizegenetics.util.Tassel5HDF5Constants
 
POSITION_CM - Static variable in class net.maizegenetics.analysis.avro.AvroConstants
 
POSITION_GENOME_VERSION - Static variable in class net.maizegenetics.util.Tassel5HDF5Constants
 
POSITION_HAS_REFEFERENCE - Static variable in class net.maizegenetics.util.Tassel5HDF5Constants
 
POSITION_IS_INDEL - Static variable in class net.maizegenetics.analysis.avro.AvroConstants
 
POSITION_IS_NUCLEOTIDE - Static variable in class net.maizegenetics.analysis.avro.AvroConstants
 
POSITION_LIST_NONE - Static variable in class net.maizegenetics.plugindef.AbstractPlugin
 
POSITION_MAF - Static variable in class net.maizegenetics.analysis.avro.AvroConstants
 
POSITION_MODULE - Static variable in class net.maizegenetics.util.Tassel5HDF5Constants
 
POSITION_NUM_SITES - Static variable in class net.maizegenetics.util.Tassel5HDF5Constants
 
POSITION_SCHEMA - Static variable in class net.maizegenetics.analysis.avro.AvroConstants
 
POSITION_SITE_COVERAGE - Static variable in class net.maizegenetics.analysis.avro.AvroConstants
 
POSITION_STRAND - Static variable in class net.maizegenetics.analysis.avro.AvroConstants
 
positionList() - Method in class net.maizegenetics.analysis.filter.FilterSiteBuilderPlugin
Position List
positionList(value) - Method in class net.maizegenetics.analysis.filter.FilterSiteBuilderPlugin
Set Position List.
positionList(connection, datasetName) - Static method in class net.maizegenetics.analysis.gobii.GOBIIPostgresConnection
 
PositionList - Interface in net.maizegenetics.dna.map
List of positions in the genome. This type is used by every interface GenotypeTable, but it can also be used list of GWAS results and other genomic annotations.
positionList() - Method in class net.maizegenetics.dna.snp.FilterSite
 
PositionList.PositionListCollector - Class in net.maizegenetics.dna.map
 
PositionListBuilder - Class in net.maizegenetics.dna.map
A builder for creating immutable PositionList. Can be used for either an in memory or HDF5 list.
PositionListBuilder() - Constructor for class net.maizegenetics.dna.map.PositionListBuilder
Creates a new builder. The returned builder is equivalent to the builder generated by .
PositionListBuilder(numberOfPositions) - Constructor for class net.maizegenetics.dna.map.PositionListBuilder
Creates a new builder with a given number of Positions. This is most useful when the number of sites is known from the beginning and the set method will be used to set positions perhaps out of order. Useful in multithreaded builders.
PositionListBuilder(h5w, a) - Constructor for class net.maizegenetics.dna.map.PositionListBuilder
Creates a positionList in a new HDF5 file.
PositionListCollector(validateOrder) - Constructor for class net.maizegenetics.dna.map.PositionList.PositionListCollector
 
PositionListIOUtils - Class in net.maizegenetics.dna.map
Utilities for reading and writing Position Lists
PositionListTableReport - Class in net.maizegenetics.dna.map
 
PositionListTableReport(positionList) - Constructor for class net.maizegenetics.dna.map.PositionListTableReport
 
positionMergeSelection() - Method in class net.maizegenetics.analysis.data.MergeGenotypeTablesPluginV2
Selection for Position Merge Rule
positionMergeSelection(value) - Method in class net.maizegenetics.analysis.data.MergeGenotypeTablesPluginV2
Set Position Merge Rule. Selection for Position Merge Rule
positionQualityScore() - Method in class net.maizegenetics.analysis.gbs.repgen.RGBSProductionSNPCallerPlugin
Minimum Position Quality Score
positionQualityScore(value) - Method in class net.maizegenetics.analysis.gbs.repgen.RGBSProductionSNPCallerPlugin
Set Minimum quality score for position: This value is used to pull SNPs out of the snpposition table. Only snps with quality scores meeting or exceeding the specified value will be processed.
positionQualityScore() - Method in class net.maizegenetics.analysis.gbs.v2.ProductionSNPCallerPluginV2
Minimum Position Quality Score
positionQualityScore(value) - Method in class net.maizegenetics.analysis.gbs.v2.ProductionSNPCallerPluginV2
Set Minimum quality score for position: This value is used to pull SNPs out of the snpposition table. Only snps with quality scores meeting or exceeding the specified value will be processed.
positions(positions) - Method in class net.maizegenetics.analysis.imputation.BackwardForwardAlgorithm
 
positions(positions) - Method in class net.maizegenetics.analysis.imputation.BackwardForwardVariableStateNumber
 
positions - Variable in class net.maizegenetics.analysis.imputation.TransitionProbability
 
positions() - Method in class net.maizegenetics.dna.snp.CombineGenotypeTable
 
positions() - Method in class net.maizegenetics.dna.snp.CoreGenotypeTable
 
positions() - Method in interface net.maizegenetics.dna.snp.GenotypeTable
Return the position list for the genotype table.
POSITIONS - Static variable in class net.maizegenetics.dna.snp.HapMapHDF5Constants
 
positions() - Method in class net.maizegenetics.dna.snp.MergedGenotypeTable
 
positions() - Method in class net.maizegenetics.dna.snp.TOPMGenotypeTable
 
positions(inputFileName, format, topm, taxa) - Static method in class net.maizegenetics.dna.tag.TagsByTaxaUtils
Prints the physical coordinates of the supplied taxa, as stored in the supplied TOPM file.
POSITIONS - Static variable in class net.maizegenetics.util.Tassel5HDF5Constants
 
POSITIONS_SCHEMA - Static variable in class net.maizegenetics.analysis.avro.AvroConstants
 
positionSourceHDF5GenoFile() - Method in class net.maizegenetics.analysis.imputation.ReImputeUpdatedTaxaByFILLINPlugin
Finished (built) HDF5 (*.h5) file to be used as a PositionList source (containing a small number of [ignored] taxa)
positionSourceHDF5GenoFile(value) - Method in class net.maizegenetics.analysis.imputation.ReImputeUpdatedTaxaByFILLINPlugin
Set Position Source HDF5 Geno File. Finished (built) HDF5 (*.h5) file to be used as a PositionList source (containing a small number of [ignored] taxa)
positionType() - Method in class net.maizegenetics.analysis.gbs.v2.SNPCutPosTagVerificationPlugin
SNP Position
positionType(value) - Method in class net.maizegenetics.analysis.gbs.v2.SNPCutPosTagVerificationPlugin
Set SNP position.
PositionVectors(chromosomes, startPos, strand, refAllele, altAllele) - Constructor for class net.maizegenetics.plugindef.GenerateRCode.PositionVectors
 
possibleValues(possibleValues) - Method in class net.maizegenetics.plugindef.PluginParameter.Builder
 
possibleValues() - Method in class net.maizegenetics.plugindef.PluginParameter
 
possibleValuesString(friendly) - Method in class net.maizegenetics.plugindef.PluginParameter
 
posStartB - Variable in class net.maizegenetics.dna.map.AbstractPETagsOnPhysicalMap
 
posStartContig - Variable in class net.maizegenetics.dna.map.AbstractPETagsOnPhysicalMap
 
posStartF - Variable in class net.maizegenetics.dna.map.AbstractPETagsOnPhysicalMap
 
postgreSQLCopyFromReader(conn, table, reader) - Static method in class net.maizegenetics.analysis.gobii.GOBIIDbUtils
 
postorderSuccessor(node) - Static method in class net.maizegenetics.taxa.tree.NodeUtils
determine postorder successor of a node
postProcessParameters() - Method in class net.maizegenetics.analysis.data.AddReferenceAlleleToHDF5Plugin
 
postProcessParameters() - Method in class net.maizegenetics.analysis.data.SortGenotypeFilePlugin
 
postProcessParameters() - Method in class net.maizegenetics.analysis.distance.VCAPScanPlugin
 
postProcessParameters() - Method in class net.maizegenetics.analysis.filter.FilterSiteBuilderPlugin
 
postProcessParameters() - Method in class net.maizegenetics.analysis.gbs.DiscoverySNPCallerPlugin
 
postProcessParameters() - Method in class net.maizegenetics.analysis.gbs.ModifyTBTHDF5Plugin
 
postProcessParameters() - Method in class net.maizegenetics.analysis.gbs.ProductionPipeline
 
postProcessParameters() - Method in class net.maizegenetics.analysis.gbs.ProductionSNPCallerPlugin
 
postProcessParameters() - Method in class net.maizegenetics.analysis.gbs.repgen.RampSeqAlignFromBlastTags
 
postProcessParameters() - Method in class net.maizegenetics.analysis.gbs.repgen.RepGenAlignerPlugin
 
postProcessParameters() - Method in class net.maizegenetics.analysis.gbs.repgen.RepGenLDAnalysisPlugin
 
postProcessParameters() - Method in class net.maizegenetics.analysis.gbs.repgen.RepGenLoadSeqToDBPlugin
 
postProcessParameters() - Method in class net.maizegenetics.analysis.gbs.repgen.RepGenPhase2AlignerPlugin
 
postProcessParameters() - Method in class net.maizegenetics.analysis.gbs.repgen.RGBSProductionSNPCallerPlugin
 
postProcessParameters() - Method in class net.maizegenetics.analysis.gbs.SAMConverterPlugin
 
postProcessParameters() - Method in class net.maizegenetics.analysis.gbs.SeqToTBTHDF5Plugin
 
postProcessParameters() - Method in class net.maizegenetics.analysis.gbs.UTagPairToTOPMPlugin
 
postProcessParameters() - Method in class net.maizegenetics.analysis.gbs.v2.DiscoverySNPCallerPluginV2
 
postProcessParameters() - Method in class net.maizegenetics.analysis.gbs.v2.GBSSeqToTagDBPlugin
 
postProcessParameters() - Method in class net.maizegenetics.analysis.gbs.v2.GetTagSequenceFromDBPlugin
 
postProcessParameters() - Method in class net.maizegenetics.analysis.gbs.v2.ProductionSNPCallerPluginV2
 
postProcessParameters() - Method in class net.maizegenetics.analysis.gobii.GOBIIPlugin
 
postProcessParameters() - Method in class net.maizegenetics.analysis.gobii.HapBreakpoints_IFLFilePlugin
 
postProcessParameters() - Method in class net.maizegenetics.analysis.gobii.MarkerDNARun_IFLFilePlugin
 
postProcessParameters() - Method in class net.maizegenetics.analysis.imputation.FILLINFindHaplotypesPlugin
 
postProcessParameters() - Method in class net.maizegenetics.analysis.imputation.FILLINImputationPlugin
 
postProcessParameters() - Method in class net.maizegenetics.analysis.imputation.ReImputeUpdatedTaxaByFILLINPlugin
 
postProcessParameters() - Method in class net.maizegenetics.analysis.imputation.RemoveIndelsForBeaglePlugin
 
postProcessParameters() - Method in class net.maizegenetics.analysis.modelfitter.StepwiseAdditiveModelFitterPlugin
 
postProcessParameters() - Method in class net.maizegenetics.analysis.modelfitter.StepwiseOLSModelFitterPlugin
 
postProcessParameters() - Method in class net.maizegenetics.analysis.monetdb.ColumnsToBinaryFullGenomeTablePlugin
 
postProcessParameters() - Method in class net.maizegenetics.analysis.monetdb.ColumnsToBinarySNPOnlyTablePlugin
 
postProcessParameters() - Method in class net.maizegenetics.analysis.popgen.SequenceDiversityPlugin
 
postProcessParameters() - Method in class net.maizegenetics.analysis.rna.RNADeMultiplexProductionPlugin
 
postProcessParameters() - Method in class net.maizegenetics.plugindef.AbstractPlugin
 
postProcessParameters() - Method in class net.maizegenetics.util.ConvertOldFastqToModernFormatPlugin
 
powerTransform(original) - Method in class net.maizegenetics.analysis.numericaltransform.TransformDataPlugin
 
powerTransformation() - Method in class net.maizegenetics.analysis.numericaltransform.TransformDataDialog
 
pPos - Variable in class net.maizegenetics.dna.map.TagGWASMapInfo
Physical position of tag, unknown = Integer.MIN_VALUE
pred - Variable in class net.maizegenetics.stats.EMMA.EMMAforDoubleMatrix
 
predecessors(n) - Method in class net.maizegenetics.util.DirectedGraph
Gets the predecessors of the node n
predictedDistance - Variable in class net.maizegenetics.dna.map.TagGWASMapInfo
Predicted distance (log10 value) between mapping position and true position.
prediction - Variable in class net.maizegenetics.dna.map.TagsOnGeneticMap
 
predictionPlugin() - Method in class net.maizegenetics.analysis.gbs.pana.PanAUsageExample
 
PreferencesDialog - Class in net.maizegenetics.tassel
 
PreferencesDialog(parentFrame, isInteractive) - Constructor for class net.maizegenetics.tassel.PreferencesDialog
 
preferredHaplotypeSize() - Method in class net.maizegenetics.analysis.imputation.FILLINFindHaplotypesPlugin
Preferred haplotype block size in sites (minimum 64); will use the closest multiple of 64 at or below the supplied value
preferredHaplotypeSize(value) - Method in class net.maizegenetics.analysis.imputation.FILLINFindHaplotypesPlugin
Set Preferred haplotype size. Preferred haplotype block size in sites (minimum 64); will use the closest multiple of 64 at or below the supplied value
preferredHaplotypeSize() - Method in class net.maizegenetics.analysis.imputation.FILLINImputationPlugin
Preferred haplotype block size in sites (use same as in FILLINFindHaplotypesPlugin)
preferredHaplotypeSize(value) - Method in class net.maizegenetics.analysis.imputation.FILLINImputationPlugin
Set Preferred haplotype size. Preferred haplotype block size in sites (use same as in FILLINFindHaplotypesPlugin)
preferredHaplotypeSize() - Method in class net.maizegenetics.analysis.imputation.ReImputeUpdatedTaxaByFILLINPlugin
Preferred haplotype block size in sites (use same as in FILLINFindHaplotypesPlugin)
preferredHaplotypeSize(value) - Method in class net.maizegenetics.analysis.imputation.ReImputeUpdatedTaxaByFILLINPlugin
Set Preferred haplotype size. Preferred haplotype block size in sites (use same as in FILLINFindHaplotypesPlugin)
preFilterSites() - Method in class net.maizegenetics.analysis.imputation.BiparentalHaplotypeFinder
 
preorderSuccessor(node) - Static method in class net.maizegenetics.taxa.tree.NodeUtils
determine preorder successor of this node
PreProcessGOBIIMappingFilePlugin - Class in net.maizegenetics.analysis.gobii
This plugin should be run prior to creating the intermediate files for marker and dnarun. There are 3 purposes to this plugin's. Using the mapping file created for the dataset: 1. Identify duplicate/missing germplasm/dnasample entries, create intermediate file for germplasm and dnasmple tables, load any missing entries. Duplicates are skipped. 2. Identify duplicate libraryPrepIds. Write a list of duplicate libraryPrepIds, write to a file. 3. Provide mapping data to load new marker/dnarun related tables. Create intermediate files, load via GOBII IFL scripts For the first 2 purposes, the database must be queried. Missing entries entries are defined as below: germplasm table: From the db,Get list of distinct MGIDs (they should all be distinct). use this list to compare to MGIDs in the file. For any MGIDs that don't appear, create a line in the *.germplasm intermediate file used to add values. dnasample table: From the db, Get a list of dnasample names. These names are a string comprised of these components: GID:plate:well. From the input file, for each entry, create a concatenanted string of GID:plate:well. compare to list from db. For any names that don't appear, create a line in the *.dnasample intermediate file for loading. This file needs the "name" field to be a concatenation of GID:plate:well as this will be unique and GOBII dnasample.dupmap looks at only the name field. Code can be MGID if we need that stored (which I think we do). It takes "external code" column instead of germplasm_id as that maps to the external_code field in the germplasm table when GOBII IFL looks to find the germplasm_id from DB. This file also needs project_name, which comes from the mapping file. dnarun table: From the db, Get a list of all dnasample.name fields. These should be distinct library prep id. Compare to libraryPrepIds from the mapping file. IF there are duplicate, write to a file to show the biologist. NOTES: GOBII uses dnasample.name and dnasample.num to determine duplicates BL is not populating dnasample.num. "num" has been removed from the dnasample.dupmap file when running this. For some reason, with it present, but all values "null", the script believed the values were different and I ended up duplicating all dnasamples when sending the file through the GOBII scripts. When I removed this line, the scripts only checked the "name" field and project id and it worked. For step 3: The intermediate files are created by the MarkerDNARunMGID_fromHMPIFIFIlePLugin.java. Note the dnasample and germplasm entries must be loaded to the db before loading the marker/ dnarun intermediate files or the necssary db ids will not be found..
PreProcessGOBIIMappingFilePlugin(parentFrame, isInteractive) - Constructor for class net.maizegenetics.analysis.gobii.PreProcessGOBIIMappingFilePlugin
 
PreProcessGOBIIMappingFilePlugin() - Constructor for class net.maizegenetics.analysis.gobii.PreProcessGOBIIMappingFilePlugin
 
preProcessParameters(input) - Method in class net.maizegenetics.analysis.association.FastMultithreadedAssociationPlugin
 
preProcessParameters(data) - Method in class net.maizegenetics.analysis.association.FixedEffectLMPlugin
 
preProcessParameters(input) - Method in class net.maizegenetics.analysis.data.BuildUnfinishedHDF5GenotypesPlugin
 
preProcessParameters(input) - Method in class net.maizegenetics.analysis.data.CreateHybridGenotypesPlugin
 
preProcessParameters(input) - Method in class net.maizegenetics.analysis.data.ExportPlugin
 
preProcessParameters(input) - Method in class net.maizegenetics.analysis.data.FileLoadPlugin
 
preProcessParameters(input) - Method in class net.maizegenetics.analysis.data.FindInversionsPlugin
 
preProcessParameters(input) - Method in class net.maizegenetics.analysis.data.GenosToABHPlugin
 
preProcessParameters(input) - Method in class net.maizegenetics.analysis.data.GenotypeSummaryPlugin
 
preProcessParameters(input) - Method in class net.maizegenetics.analysis.data.MaskGenotypePlugin
 
preProcessParameters(input) - Method in class net.maizegenetics.analysis.data.MergeRenameDeleteTaxaPlugin
 
preProcessParameters(input) - Method in class net.maizegenetics.analysis.data.ProjectionLoadPlugin
 
preProcessParameters(input) - Method in class net.maizegenetics.analysis.data.ProjectPcsAndRunModelSelectionPlugin
 
preProcessParameters(input) - Method in class net.maizegenetics.analysis.data.SetLowDepthGenosToMissingPlugin
 
preProcessParameters(input) - Method in class net.maizegenetics.analysis.data.SubtractGenotypesPlugin
 
preProcessParameters(input) - Method in class net.maizegenetics.analysis.data.ThinSitesByPositionPlugin
 
preProcessParameters(input) - Method in class net.maizegenetics.analysis.distance.AddDistanceMatrixPlugin
 
preProcessParameters(input) - Method in class net.maizegenetics.analysis.distance.KinshipPlugin
 
preProcessParameters(input) - Method in class net.maizegenetics.analysis.distance.SubtractDistanceMatrixPlugin
 
preProcessParameters(input) - Method in class net.maizegenetics.analysis.distance.VCAPScanPlugin
 
preProcessParameters(input) - Method in class net.maizegenetics.analysis.filter.FilterSiteBuilderPlugin
 
preProcessParameters(input) - Method in class net.maizegenetics.analysis.filter.FilterTaxaBuilderPlugin
 
preProcessParameters(input) - Method in class net.maizegenetics.analysis.filter.FilterTaxaPropertiesPlugin
 
preProcessParameters(input) - Method in class net.maizegenetics.analysis.gobii.GOBIIPlugin
 
preProcessParameters(input) - Method in class net.maizegenetics.analysis.gobii.MarkerDNARun_IFLFilePlugin
 
preProcessParameters(input) - Method in class net.maizegenetics.analysis.imputation.ClusterGenotypesPlugin
 
preProcessParameters(input) - Method in class net.maizegenetics.analysis.imputation.ImputationAccuracyPlugin
 
preProcessParameters(input) - Method in class net.maizegenetics.analysis.imputation.LDKNNiImputationHetV2Plugin
 
preProcessParameters(input) - Method in class net.maizegenetics.analysis.imputation.LDKNNiImputationHetV3Plugin
 
preProcessParameters(input) - Method in class net.maizegenetics.analysis.imputation.LDKNNiImputationPlugin
 
preProcessParameters(input) - Method in class net.maizegenetics.analysis.imputation.ParentPhasingPlugin
 
preProcessParameters(input) - Method in class net.maizegenetics.analysis.modelfitter.AdditiveSiteStorePlugin
 
preProcessParameters(input) - Method in class net.maizegenetics.analysis.modelfitter.ResamplingGWASPlugin
 
preProcessParameters(input) - Method in class net.maizegenetics.analysis.modelfitter.StepwiseAdditiveModelFitterPlugin
 
preProcessParameters(input) - Method in class net.maizegenetics.analysis.modelfitter.StepwiseOLSModelFitterPlugin
 
preProcessParameters(input) - Method in class net.maizegenetics.analysis.monetdb.ColumnsToBinaryFullGenomeTablePlugin
 
preProcessParameters(input) - Method in class net.maizegenetics.analysis.monetdb.ColumnsToBinarySNPOnlyTablePlugin
 
preProcessParameters(input) - Method in class net.maizegenetics.analysis.numericaltransform.ImputationPlugin
 
preProcessParameters(input) - Method in class net.maizegenetics.analysis.popgen.SequenceDiversityPlugin
 
preProcessParameters(input) - Method in class net.maizegenetics.analysis.rna.LoadRNAContigsToGBSDBPlugin
 
preProcessParameters(input) - Method in class net.maizegenetics.analysis.tree.ConvertTreeNamesPlugin
 
preProcessParameters(input) - Method in class net.maizegenetics.analysis.tree.CreateTreePlugin
 
preProcessParameters(input) - Method in class net.maizegenetics.analysis.tree.SubsetTreePlugin
 
preProcessParameters(input) - Method in class net.maizegenetics.plugindef.AbstractPlugin
 
preProcessParameters(input) - Method in class net.maizegenetics.tassel.PreferencesDialog
 
pres_abs_pearson() - Method in class net.maizegenetics.analysis.gbs.repgen.TagCorrelationInfo
 
previousSetBit(index) - Method in interface net.maizegenetics.util.BitSet
Returns the index of the previous set bit starting at the index specified. If the bit at index is set, index is returned, otherwise the next lower numbered set bit is returned. -1 is returned if there are no more set bits.
previousSetBit(index) - Method in interface net.maizegenetics.util.BitSet
Returns the index of the previous set bit starting at the index specified. If the bit at index is set, index is returned, otherwise the next lower numbered set bit is returned. -1 is returned if there are no more set bits.
previousSetBit(index) - Method in class net.maizegenetics.util.OpenBitSet
 
previousSetBit(index) - Method in class net.maizegenetics.util.OpenBitSet
 
previousSetBit(index) - Method in class net.maizegenetics.util.UnmodifiableBitSet
 
previousSetBit(index) - Method in class net.maizegenetics.util.UnmodifiableBitSet
 
primers() - Method in class net.maizegenetics.analysis.gbs.repgen.RepGenPhase2AlignerPlugin
Tab delimited file that contains the column headers chrom,forward,reverse. The values in each column are the chromosone name, the forward primer sequence and the reverse primer sequence for the specified chromosome.
primers(value) - Method in class net.maizegenetics.analysis.gbs.repgen.RepGenPhase2AlignerPlugin
Set Primers. Tab delimited file that contains the column headers chrom,forward,reverse. The values in each column are the chromosone name, the forward primer sequence and the reverse primer sequence for the specified chromosome.
prin() - Method in class net.maizegenetics.analysis.gbs.Clusters
 
PrincipalComponentsPlugin - Class in net.maizegenetics.analysis.data
 
PrincipalComponentsPlugin(parentFrame, isInteractive) - Constructor for class net.maizegenetics.analysis.data.PrincipalComponentsPlugin
 
PrincipalComponentsPlugin.PCA_LIMIT - Enum in net.maizegenetics.analysis.data
 
PrinComp - Class in net.maizegenetics.stats.PCA
 
PrinComp(data, type) - Constructor for class net.maizegenetics.stats.PCA.PrinComp
The class uses singular value decomposition to find the eigenvalues, eigenvectors and principal components of either the covariance or correlation matrix of the data. If covariance, then the result is the equivalent of finding the eighvalue decomposition of XX'/(n-1) where X is the data matrix with the column means subtracted from the columns. If correlation, the column values are also scaled. That is, after the mean is subtracted, the values are divided by the standard deviation.
PrinComp.PC_TYPE - Enum in net.maizegenetics.stats.PCA
 
printAll(value) - Method in class net.maizegenetics.analysis.data.HDF5SummaryPlugin
 
printAll() - Method in class net.maizegenetics.analysis.data.HDF5SummaryPlugin
 
printAlleleStats(gt, name) - Static method in class net.maizegenetics.analysis.imputation.ImputationUtils
 
printAvailableDatasets(connection) - Static method in class net.maizegenetics.analysis.gobii.GOBIIPostgresConnection
 
printBitLong(A) - Static method in class net.maizegenetics.util.BitUtil
 
printBitMatrix(A) - Static method in class net.maizegenetics.util.BitUtil
 
printCLUSTALW(a, out) - Static method in class net.maizegenetics.dna.snp.ExportUtils
Print alignment (in CLUSTAL W format)
printCoverage(inputFileName, format, itemized) - Static method in class net.maizegenetics.dna.tag.TagsByTaxaUtils
Prints tag coverage of each taxon in the file, and taxon coverage of each tag in the file. If itemized=true, prints one record for each tag and for each taxon. Otherwise prints a summary of how many tags/taxa are in each coverage "bin" (0-10% coverage, 10-20% coverage, etc.)
printEnzymes(print) - Method in class net.maizegenetics.analysis.gbs.v2.EnzymeList
Prints the list of Enzymes loaded in this object
printFactors() - Method in class net.maizegenetics.analysis.gbs.neobio.FactorSequence
Returns a string representation of the actual list of factors produced by the LZ78 parsing of the text. Each factor is printed out in a separate line, in the order they appear in the text, with its serial number, its ancestor's serial number, its new character, length and a string representation of the factor itself.
PrintHeapAction - Class in net.maizegenetics.gui
 
printInterleaved(a, out) - Static method in class net.maizegenetics.dna.snp.ExportUtils
print alignment (in PHYLIP 3.4 INTERLEAVED format)
printMatrix() - Method in class net.maizegenetics.analysis.gbs.neobio.Smawk
Prints the current state of the matrix (reflecting deleted rows and columns) in the standard output. It can be used internally for debugging.
printMatrix(matrix) - Static method in class net.maizegenetics.analysis.gbs.neobio.Smawk
Prints the contents of an object implementing the matrix interface in the standard output. It can be used for debugging.
printMemoryUse() - Static method in class net.maizegenetics.util.Sizeof
 
printNH(out, node, printLengths, printInternalLabels) - Static method in class net.maizegenetics.taxa.tree.NodeUtils
prints node in New Hamshire format.
printNH(out, node, printLengths, printInternalLabels, column, breakLines) - Static method in class net.maizegenetics.taxa.tree.NodeUtils
 
printNH(tree, out) - Static method in class net.maizegenetics.taxa.tree.TreeUtils
print a this tree in New Hampshire format (including distances and internal labels)
printNH(tree, out, printLengths, printInternalLabels) - Static method in class net.maizegenetics.taxa.tree.TreeUtils
print this tree in New Hampshire format
printParameterValues() - Method in class net.maizegenetics.plugindef.AbstractPlugin
 
printPHYLIP(out) - Method in class net.maizegenetics.taxa.distance.DistanceMatrix
print alignment (PHYLIP format)
printPostgreSQLResultSet(rs) - Static method in class net.maizegenetics.analysis.gobii.GOBIIDbUtils
 
printPostgreSQLResultSet(rs, stride) - Static method in class net.maizegenetics.analysis.gobii.GOBIIDbUtils
 
printPostgreSQLResultSetToFile(rs, outFile) - Static method in class net.maizegenetics.analysis.gobii.GOBIIDbUtils
 
printRow(row) - Method in class net.maizegenetics.dna.map.AbstractTagsOnPhysicalMap
 
printRow(row, byPosition) - Method in class net.maizegenetics.dna.map.AbstractTagsOnPhysicalMap
 
printRows(numRows) - Method in class net.maizegenetics.dna.map.AbstractTagsOnPhysicalMap
 
printRows(numRows, requirePhysPosition, byPosition) - Method in class net.maizegenetics.dna.map.AbstractTagsOnPhysicalMap
 
printRows(numRows, requirePhysPosition, printChr) - Method in class net.maizegenetics.dna.map.AbstractTagsOnPhysicalMap
 
printRows(numRows) - Method in class net.maizegenetics.dna.tag.TagCounts
 
printSequential(a, out) - Static method in class net.maizegenetics.dna.snp.ExportUtils
print alignment (in PHYLIP SEQUENTIAL format)
printSimpleSummary(input) - Static method in class net.maizegenetics.analysis.data.GenotypeSummaryPlugin
 
printSimpleSummary(current) - Static method in class net.maizegenetics.analysis.data.GenotypeSummaryPlugin
 
printSimpleSummary(alignment, name) - Static method in class net.maizegenetics.analysis.data.GenotypeSummaryPlugin
 
printSumCounts(inputFileName, format, progressIndication) - Static method in class net.maizegenetics.dna.tag.TagsByTaxaUtils
Prints a list of taxa in the specified TagsByTaxa file, along with the total count of all tags found in that taxon.
printSumCountsOfAll(directoryName, format) - Static method in class net.maizegenetics.dna.tag.TagsByTaxaUtils
Calls printSumCounts once for every file in the specified directory.
PrintTextArea - Class in net.maizegenetics.gui
 
PrintTextArea(frame) - Constructor for class net.maizegenetics.gui.PrintTextArea
 
printThis(s) - Method in class net.maizegenetics.gui.PrintTextArea
 
printTotalTagsAndTaxa(directoryName, format) - Static method in class net.maizegenetics.dna.tag.TagsByTaxaUtils
Prints a count of the total number of tags and taxa in the files contained in the specified directory.
printWithMissing(b) - Static method in class net.maizegenetics.dna.map.AbstractTagsOnPhysicalMap
 
printWithMissing(i) - Static method in class net.maizegenetics.dna.map.AbstractTagsOnPhysicalMap
 
probabilityOfATransition - Variable in class net.maizegenetics.analysis.imputation.TransitionProbability
 
process(resultSet, currentRow) - Method in interface net.maizegenetics.util.db.ResultSetProcessor
 
processData(input) - Method in class net.maizegenetics.analysis.association.EqtlAssociationPlugin
 
processData(input) - Method in class net.maizegenetics.analysis.association.FastMultithreadedAssociationPlugin
 
processData(data) - Method in class net.maizegenetics.analysis.association.FixedEffectLMPlugin
 
processData(input) - Method in class net.maizegenetics.analysis.association.GenomicSelectionPlugin
 
processData(input) - Method in class net.maizegenetics.analysis.association.MLMPlugin
 
processData(dataset) - Method in class net.maizegenetics.analysis.association.RidgeRegressionEmmaPlugin
 
processData(input) - Method in class net.maizegenetics.analysis.association.WeightedMLMPlugin
 
processData(input) - Method in class net.maizegenetics.analysis.b4r.GetPhenotypeFromB4RPlugin
 
processData(input) - Method in class net.maizegenetics.analysis.data.AddReferenceAlleleToHDF5Plugin
 
processData(input) - Method in class net.maizegenetics.analysis.data.AddReferenceToGenotypePlugin
 
processData(input) - Method in class net.maizegenetics.analysis.data.AdjustPhasingPlugin
 
processData(input) - Method in class net.maizegenetics.analysis.data.BuildUnfinishedHDF5GenotypesPlugin
 
processData(input) - Method in class net.maizegenetics.analysis.data.ConvertAlignmentCoordinatesPlugin
 
processData(input) - Method in class net.maizegenetics.analysis.data.CountAssociationsPlugin
 
processData(input) - Method in class net.maizegenetics.analysis.data.CreateHybridGenotypesPlugin
 
processData(input) - Method in class net.maizegenetics.analysis.data.ExportPlugin
 
processData(input) - Method in class net.maizegenetics.analysis.data.FeatureListToPositionsPlugin
 
processData(input) - Method in class net.maizegenetics.analysis.data.FileLoadPlugin
 
processData(input) - Method in class net.maizegenetics.analysis.data.FindInversionsPlugin
 
processData(input) - Method in class net.maizegenetics.analysis.data.GenomeAnnosDBQueryToPositionListPlugin
Reads a PostgreSQL query file and a genomeAnnosDB connection config file, checks that the query is a SELECT query for chr, position, etc.., executes the query and turns the results into a PositionList with any result fields other that chr & position added as annotations.
processData(input) - Method in class net.maizegenetics.analysis.data.GenosToABHPlugin
The main method. Plugin to convert genotypes to parental comparisons and store them in an output file. The user can get outputs as A/H/B, 0/1/2, or 0/0.5/1 for a genotype matching parent A's genotype, heterozygous, or parent B's genotype respectively. If the genotype is neither A or B or a het combination of A/B (B/A) then it is coded as "NA".
processData(input) - Method in class net.maizegenetics.analysis.data.GenotypeSummaryPlugin
 
processData(input) - Method in class net.maizegenetics.analysis.data.GenotypeToAdditiveValuesPlugin
 
processData(input) - Method in class net.maizegenetics.analysis.data.GetPositionListPlugin
 
processData(input) - Method in class net.maizegenetics.analysis.data.GetTaxaListPlugin
 
processData(input) - Method in class net.maizegenetics.analysis.data.HDF5SummaryPlugin
 
processData(input) - Method in class net.maizegenetics.analysis.data.IdentityRecognitionPlugin
 
processData(input) - Method in class net.maizegenetics.analysis.data.IndelsToUnknownPlugin
 
processData(input) - Method in class net.maizegenetics.analysis.data.KmerCountingPlugin
 
processData(input) - Method in class net.maizegenetics.analysis.data.LIXPlugin
 
processData(input) - Method in class net.maizegenetics.analysis.data.MaskGenotypePlugin
 
processData(input) - Method in class net.maizegenetics.analysis.data.MeanR2FromLDPlugin
 
processData(input) - Method in class net.maizegenetics.analysis.data.MemoryUsagePlugin
 
processData(input) - Method in class net.maizegenetics.analysis.data.MergeGenotypeTablesPluginV2
 
processData(input) - Method in class net.maizegenetics.analysis.data.MergeRenameDeleteTaxaPlugin
 
processData(input) - Method in class net.maizegenetics.analysis.data.PlinkLoadPlugin
 
processData(input) - Method in class net.maizegenetics.analysis.data.PrincipalComponentsPlugin
 
processData(input) - Method in class net.maizegenetics.analysis.data.ProjectionLoadPlugin
 
processData(input) - Method in class net.maizegenetics.analysis.data.ProjectPcsAndRunModelSelectionPlugin
 
processData(input) - Method in class net.maizegenetics.analysis.data.SetLowDepthGenosToMissingPlugin
Main method for this plugin.
processData(input) - Method in class net.maizegenetics.analysis.data.SortGenotypeFilePlugin
 
processData(input) - Method in class net.maizegenetics.analysis.data.SortTaxaAlphabeticallyPlugin
 
processData(input) - Method in class net.maizegenetics.analysis.data.SplitHDF5ByChromosomePlugin
 
processData(input) - Method in class net.maizegenetics.analysis.data.SubtractGenotypesPlugin
 
processData(input) - Method in class net.maizegenetics.analysis.data.ThinSitesByPositionPlugin
 
processData(input, isUnion) - Method in class net.maizegenetics.analysis.data.UnionAlignmentPlugin
 
processData(input) - Method in class net.maizegenetics.analysis.distance.AddDistanceMatrixPlugin
 
processData(input) - Method in class net.maizegenetics.analysis.distance.AMatrixPlugin
 
processData(input) - Method in class net.maizegenetics.analysis.distance.DistanceMatrixPlugin
 
processData(input) - Method in class net.maizegenetics.analysis.distance.HMatrixPlugin
 
processData(input) - Method in class net.maizegenetics.analysis.distance.KinshipPlugin
 
processData(input) - Method in class net.maizegenetics.analysis.distance.MultiDimensionalScalingPlugin
 
processData(input) - Method in class net.maizegenetics.analysis.distance.RemoveNaNFromDistanceMatrixPlugin
 
processData(input) - Method in class net.maizegenetics.analysis.distance.SubtractDistanceMatrixPlugin
 
processData(input) - Method in class net.maizegenetics.analysis.distance.VCAPScanPlugin
 
processData(input) - Method in class net.maizegenetics.analysis.filter.FilterSiteBuilderPlugin
 
processData(input) - Method in class net.maizegenetics.analysis.filter.FilterTaxaBuilderPlugin
 
processData(input) - Method in class net.maizegenetics.analysis.filter.FilterTaxaPropertiesPlugin
 
processData(input) - Method in class net.maizegenetics.analysis.gbs.BinaryToTextPlugin
 
processData(input) - Method in class net.maizegenetics.analysis.gbs.DiscoverySNPCallerPlugin
 
processData(input) - Method in class net.maizegenetics.analysis.gbs.FastqToTagCountPlugin
 
processData(input) - Method in class net.maizegenetics.analysis.gbs.MergeMultipleTagCountPlugin
 
processData(input) - Method in class net.maizegenetics.analysis.gbs.ModifyTBTHDF5Plugin
 
processData(input) - Method in class net.maizegenetics.analysis.gbs.ProductionPipeline
 
processData(input) - Method in class net.maizegenetics.analysis.gbs.ProductionSNPCallerPlugin
 
processData(input) - Method in class net.maizegenetics.analysis.gbs.repgen.RampSeqAlignFromBlastTags
 
processData(input) - Method in class net.maizegenetics.analysis.gbs.repgen.RepGenAlignerPlugin
 
processData(input) - Method in class net.maizegenetics.analysis.gbs.repgen.RepGenLDAnalysisPlugin
 
processData(input) - Method in class net.maizegenetics.analysis.gbs.repgen.RepGenLoadSeqToDBPlugin
 
processData(input) - Method in class net.maizegenetics.analysis.gbs.repgen.RepGenPhase2AlignerPlugin
 
processData(input) - Method in class net.maizegenetics.analysis.gbs.repgen.RGBSProductionSNPCallerPlugin
 
processData(input) - Method in class net.maizegenetics.analysis.gbs.SAMConverterPlugin
 
processData(input) - Method in class net.maizegenetics.analysis.gbs.SeqToTBTHDF5Plugin
 
processData(input) - Method in class net.maizegenetics.analysis.gbs.TagCountToFastqPlugin
 
processData(input) - Method in class net.maizegenetics.analysis.gbs.UTagCountToTagPairPlugin
 
processData(input) - Method in class net.maizegenetics.analysis.gbs.UTagPairToTOPMPlugin
 
processData(input) - Method in class net.maizegenetics.analysis.gbs.v2.DiscoverySNPCallerPluginV2
 
processData(input) - Method in class net.maizegenetics.analysis.gbs.v2.GBSSeqToTagDBPlugin
 
processData(input) - Method in class net.maizegenetics.analysis.gbs.v2.GetTagSequenceFromDBPlugin
 
processData(input) - Method in class net.maizegenetics.analysis.gbs.v2.GetTagTaxaDistFromDBPlugin
 
processData(input) - Method in class net.maizegenetics.analysis.gbs.v2.ProductionSNPCallerPluginV2
 
processData(input) - Method in class net.maizegenetics.analysis.gbs.v2.SAMToGBSdbPlugin
 
processData(input) - Method in class net.maizegenetics.analysis.gbs.v2.SNPCutPosTagVerificationPlugin
 
processData(input) - Method in class net.maizegenetics.analysis.gbs.v2.SNPQualityProfilerPlugin
 
processData(input) - Method in class net.maizegenetics.analysis.gbs.v2.TagExportToFastqPlugin
 
processData(input) - Method in class net.maizegenetics.analysis.gbs.v2.UpdateSNPPositionQualityPlugin
 
processData(input) - Method in class net.maizegenetics.analysis.gobii.GOBIIPlugin
 
processData(input) - Method in class net.maizegenetics.analysis.gobii.GWAS_IFLPlugin
 
processData(input) - Method in class net.maizegenetics.analysis.gobii.HapBreakpoints_IFLFilePlugin
 
processData(input) - Method in class net.maizegenetics.analysis.gobii.MarkerDNARun_IFLFilePlugin
 
processData(input) - Method in class net.maizegenetics.analysis.gobii.MonetDB_IFLFilePlugin
 
processData(input) - Method in class net.maizegenetics.analysis.gobii.PreProcessGOBIIMappingFilePlugin
 
processData(input) - Method in class net.maizegenetics.analysis.gobii.SplitFile_IFLFilePlugin
 
processData(input) - Method in class net.maizegenetics.analysis.imputation.ClusterGenotypesPlugin
 
processData(input) - Method in class net.maizegenetics.analysis.imputation.FILLINFindHaplotypesPlugin
 
processData(input) - Method in class net.maizegenetics.analysis.imputation.FILLINImputationPlugin
 
processData(input) - Method in class net.maizegenetics.analysis.imputation.FSFHapImputationPlugin
 
processData(input) - Method in class net.maizegenetics.analysis.imputation.ImputationAccuracyPlugin
 
processData(input) - Method in class net.maizegenetics.analysis.imputation.ImputeProgenyStatesPlugin
 
processData(input) - Method in class net.maizegenetics.analysis.imputation.LDKNNiImputationHetV2Plugin
 
processData(input) - Method in class net.maizegenetics.analysis.imputation.LDKNNiImputationHetV3Plugin
 
processData(input) - Method in class net.maizegenetics.analysis.imputation.LDKNNiImputationPlugin
 
processData(input) - Method in class net.maizegenetics.analysis.imputation.MergeBreakpointFilesPlugin
 
processData(input) - Method in class net.maizegenetics.analysis.imputation.ParentPhasingPlugin
 
processData(input) - Method in class net.maizegenetics.analysis.imputation.RandomGenotypeImputationPlugin
 
processData(input) - Method in class net.maizegenetics.analysis.imputation.ReImputeUpdatedTaxaByFILLINPlugin
 
processData(input) - Method in class net.maizegenetics.analysis.imputation.RemoveIndelsForBeaglePlugin
 
processData(input) - Method in class net.maizegenetics.analysis.ListPluginParameters
 
processData(input) - Method in class net.maizegenetics.analysis.ListPlugins
 
processData(input) - Method in class net.maizegenetics.analysis.modelfitter.AdditiveSiteStorePlugin
 
processData(input) - Method in class net.maizegenetics.analysis.modelfitter.ResamplingGWASPlugin
 
processData(input) - Method in class net.maizegenetics.analysis.modelfitter.StepwiseAdditiveModelFitterPlugin
 
processData(input) - Method in class net.maizegenetics.analysis.modelfitter.StepwiseOLSModelFitterPlugin
 
processData(input) - Method in class net.maizegenetics.analysis.monetdb.ColumnsToBinaryFullGenomeTablePlugin
 
processData(input) - Method in class net.maizegenetics.analysis.monetdb.ColumnsToBinarySNPOnlyTablePlugin
 
processData(input) - Method in class net.maizegenetics.analysis.numericaltransform.AvgPhenotypeByTaxaPlugin
 
processData(input) - Method in class net.maizegenetics.analysis.numericaltransform.BoxCoxTransformationPlugin
 
processData(input) - Method in class net.maizegenetics.analysis.numericaltransform.ImputationPlugin
 
processData(input) - Method in class net.maizegenetics.analysis.numericaltransform.NumericalGenotypePlugin
 
processData(input) - Method in class net.maizegenetics.analysis.numericaltransform.SubtractPhenotypeByTaxaPlugin
 
processData(input) - Method in class net.maizegenetics.analysis.numericaltransform.TransformDataPlugin
 
processData(input) - Method in class net.maizegenetics.analysis.popgen.SequenceDiversityPlugin
 
processData(input) - Method in class net.maizegenetics.analysis.rna.LoadRNAContigsToGBSDBPlugin
 
processData(input) - Method in class net.maizegenetics.analysis.rna.RNADeMultiplexProductionPlugin
 
processData(input) - Method in class net.maizegenetics.analysis.rna.RNADeMultiPlexSeqToDBPlugin
 
processData(input) - Method in class net.maizegenetics.analysis.tree.ConvertTreeNamesPlugin
 
processData(input) - Method in class net.maizegenetics.analysis.tree.CreateTreePlugin
 
processData(input) - Method in class net.maizegenetics.analysis.tree.MergeTreesPlugin
 
processData(input) - Method in class net.maizegenetics.analysis.tree.RemoveBranchLengthsPlugin
 
processData(input) - Method in class net.maizegenetics.analysis.tree.SubsetTreePlugin
 
processData(input) - Method in class net.maizegenetics.analysis.workflow.WorkflowPlugin
 
processData(input) - Method in class net.maizegenetics.plugindef.AbstractPlugin
 
processData(input) - Method in interface net.maizegenetics.plugindef.Plugin
For the new Generic Plugin Parameter design, performFunction() will automatically call this. Therefore, coders of Plugins should override this instead of performFunction().
processData(input) - Method in class net.maizegenetics.tassel.PreferencesDialog
 
processData(input) - Method in class net.maizegenetics.tassel.ShowParameterCachePlugin
 
processData(input) - Method in class net.maizegenetics.util.ConvertOldFastqToModernFormatPlugin
 
processDataforCrossValidation(reducedPheno, kinshipOriginal, inputPhenotypeName) - Method in class net.maizegenetics.analysis.association.GenomicSelectionPlugin
 
processDataforPrediction(myPhenotype, kinshipMatrix, inputPhenotypeName) - Method in class net.maizegenetics.analysis.association.GenomicSelectionPlugin
 
processDatum(input) - Method in class net.maizegenetics.analysis.distance.DistanceMatrixRangesPlugin
 
processedLines() - Method in class net.maizegenetics.analysis.phg.ParseGVCF.ProcessLines
 
processedSequence - Variable in class net.maizegenetics.analysis.gbs.ReadBarcodeResult
Processed sequence with barcode removed
processedSequence - Variable in class net.maizegenetics.analysis.gbs.ShortReadBarcodeResult
 
processFastQFile(keyPath, fastQPath, enzymeName, masterTaxaList, taxaFileMap, outputDir, projectName, keyFormatIsNew) - Static method in class net.maizegenetics.util.ConvertOldFastqToModernFormatPlugin
 
ProcessLines(headerLines) - Constructor for class net.maizegenetics.analysis.phg.ParseGVCF.ProcessLines
 
ProcessLines(lineNum, lines) - Constructor for class net.maizegenetics.analysis.phg.ParseGVCF.ProcessLines
 
ProcessLines() - Constructor for class net.maizegenetics.analysis.phg.ParseGVCF.ProcessLines
 
processWindowEvent(e) - Method in class net.maizegenetics.tassel.AboutBox
 
ProductionPipeline - Class in net.maizegenetics.analysis.gbs
 
ProductionPipeline(parentFrame, isInteractive) - Constructor for class net.maizegenetics.analysis.gbs.ProductionPipeline
 
ProductionPipelineMain - Class in net.maizegenetics.analysis.gbs
This class is for running the GBS Production Pipeline. It is to be run from within the sTASSEL.jar. The cron job should be set up to run the run_pipeline.pl which has been modified to make this class the main() to be run. The JVM memory settings within run_pipeline.pl should also be adjusted upwards. cron example 20 3 * * * cd /workdir/tassel/tassel4-src && /usr/local/bin/perl /workdir/tassel/tassel4-src/run_prod_cron.pl >> /workdir/tassel/tassel4-src/20130808_cron.log 2>&1 20130718 Note from Jeff Glaubitz: A minor detail: ProductionSNPCallerPlugin needs the key file name to end with "_key.txt". All the output files are named after the key file but replacing "_key.txt" with the appropriate extension. User: dkroon Date: 4/8/13
ProductionPipelineMain(appPropertiesFile, runCheckSum, runImputation, testingCheckSum) - Constructor for class net.maizegenetics.analysis.gbs.ProductionPipelineMain
 
ProductionSNPCallerPlugin - Class in net.maizegenetics.analysis.gbs
This plugin converts all of the fastq (and/or qseq) files in the input folder and keyfile to genotypes and adds these to a genotype file in HDF5 format. We refer to this step as the "Production Pipeline". The output format is HDF5 genotypes with allelic depth stored. SNP calling is quantitative with the option of using either the Glaubitz/Buckler binomial method (pHet/pErr > 1 = het) (=default), or the Stacks method. Merging of samples with the same LibraryPrepID is handled by GenotypeTableBuilder.addTaxon(), with the genotypes re-called based upon the new depths. Therefore, if you want to keep adding genotypes to the same target HDF5 file in subsequent runs, use the -ko (keep open) option so that the output GenotypeTableBuilder will be mutable, using closeUnfinished() rather than build(). If the target output HDF5 GenotypeTable file doesn't exist, it will be created. Each taxon in the HDF5 file is named "ShortName:LibraryPrepID" and is annotated with "Flowcell_Lanes" (=source seq data for current genotype). Requires a TOPM with variants added from a previous "Discovery Pipeline" run. In binary topm or HDF5 format (TOPMInterface). TODO add the Stacks likelihood method to BasicGenotypeMergeRule
ProductionSNPCallerPlugin() - Constructor for class net.maizegenetics.analysis.gbs.ProductionSNPCallerPlugin
 
ProductionSNPCallerPlugin(parentFrame, isInteractive) - Constructor for class net.maizegenetics.analysis.gbs.ProductionSNPCallerPlugin
 
ProductionSNPCallerPluginV2 - Class in net.maizegenetics.analysis.gbs.v2
This plugin converts all of the fastq (and/or qseq) files in the input folder and keyfile to genotypes and adds these to a genotype file in HDF5 format. We refer to this step as the "Production Pipeline". The output format is either HDF5 or VCF genotypes with allelic depth stored. Output file type is determined by presence of the ".h5" suffix. SNP calling is quantitative with the option of using either the Glaubitz/Buckler binomial method (pHet/pErr > 1 = het) (=default), or the Stacks method. Merging of samples with the same LibraryPrepID is handled by GenotypeTableBuilder.addTaxon(), with the genotypes re-called based upon the new depths. Therefore, if you want to keep adding genotypes to the same target HDF5 file in subsequent runs, use the -ko (keep open) option so that the output GenotypeTableBuilder will be mutable, using closeUnfinished() rather than build(). If the target output is HDF5, and that GenotypeTable file doesn't exist, it will be created. Each taxon in the output file is named "ShortName:LibraryPrepID" and is annotated with "Flowcell_Lanes" (=source seq data for current genotype). Requires a database with variants added from a previous "Discovery Pipeline" run. References to "tag" are being replaced by references to "kmer" as the pipeline is really a kmer alignment process. TODO add the Stacks likelihood method to BasicGenotypeMergeRule
ProductionSNPCallerPluginV2() - Constructor for class net.maizegenetics.analysis.gbs.v2.ProductionSNPCallerPluginV2
 
ProductionSNPCallerPluginV2(parentFrame, isInteractive) - Constructor for class net.maizegenetics.analysis.gbs.v2.ProductionSNPCallerPluginV2
 
productionTOPM() - Method in class net.maizegenetics.analysis.gbs.ProductionPipeline
Physical map file containing tags and corresponding variants (production TOPM)
productionTOPM(value) - Method in class net.maizegenetics.analysis.gbs.ProductionPipeline
Set Production T O P M. Physical map file containing tags and corresponding variants (production TOPM)
progenyFile() - Method in class net.maizegenetics.analysis.imputation.ImputeProgenyStatesPlugin
The input file containing the progeny states (parentcalls). Needed for rephasing using haplotype probabilities or for writing breakpoints.
progenyFile(value) - Method in class net.maizegenetics.analysis.imputation.ImputeProgenyStatesPlugin
Set Progeny States Input File. The input file containing the progeny states (parentcalls). Needed for rephasing using haplotype probabilities or for writing breakpoints.
progenyStates(gt) - Static method in class net.maizegenetics.analysis.imputation.RephaseParents
 
progress(event) - Method in class net.maizegenetics.pipeline.TasselPipeline
Returns progress of execution.
progress(event) - Method in class net.maizegenetics.pipeline.TasselPipelineStepsDialog
 
progress(event) - Method in class net.maizegenetics.plugindef.AbstractPlugin
No operation for this abstract class.
progress(percent, meta) - Method in class net.maizegenetics.plugindef.AbstractPlugin
 
progress(event) - Method in class net.maizegenetics.plugindef.DefaultPluginListener
 
progress(event) - Method in interface net.maizegenetics.plugindef.PluginListener
Returns progress of execution.
progress(event) - Method in class net.maizegenetics.progress.PluginProgressUnit
 
progress(event) - Method in class net.maizegenetics.tassel.DataTreePanel
Returns progress of execution.
progress(percent, meta) - Method in interface net.maizegenetics.util.ProgressListener
Returns progress of execution.
progressListener(listener) - Method in class net.maizegenetics.dna.snp.io.BuilderFromVCFUsingHTSJDK
 
ProgressListener - Interface in net.maizegenetics.util
 
ProgressPanel - Class in net.maizegenetics.progress
 
ProjectionBuilder - Class in net.maizegenetics.dna.snp
Builder for a projection alignment. Projection alignments use defined haplotypes and breakpoints that point to high density genotypes (base GenotypeTable). These are used to efficiently store and connect low density maps with imputed high density genotypes.
ProjectionBuilder(myBaseAlignment) - Constructor for class net.maizegenetics.dna.snp.ProjectionBuilder
 
ProjectionGenotypeCallTable - Class in net.maizegenetics.dna.snp.genotypecall
Projection genotype use defined haplotypes and breakpoints that point to a high density genotypes (base GenotypeTable). These are used to efficiently store and connect low density maps with imputed high density genotypes.
ProjectionGenotypeCallTable(hdAlign, allBreakPoints) - Constructor for class net.maizegenetics.dna.snp.genotypecall.ProjectionGenotypeCallTable
 
ProjectionGenotypeIO - Class in net.maizegenetics.dna.snp.io
Methods for reading and writing ProjectionGenotypes to files. ProjectionGenotypes have two parts - one is the Projection file that has the names of high density genotyped taxa and the recombination breakpoints for each of the low density taxa that point to the high density taxa.
ProjectionLoadPlugin - Class in net.maizegenetics.analysis.data
 
ProjectionLoadPlugin(parentFrame, isInteractive) - Constructor for class net.maizegenetics.analysis.data.ProjectionLoadPlugin
Creates a new instance of ProjectionLoadPlugin
projectName() - Method in class net.maizegenetics.util.ConvertOldFastqToModernFormatPlugin
Name for this project. Project name becomes part of the newly created fastq file name
projectName(value) - Method in class net.maizegenetics.util.ConvertOldFastqToModernFormatPlugin
Set Project File. Name for this project. Project name becomes part of the newly created fastq file name
ProjectPcsAndRunModelSelectionPlugin - Class in net.maizegenetics.analysis.data
 
ProjectPcsAndRunModelSelectionPlugin(parentFrame, isInteractive) - Constructor for class net.maizegenetics.analysis.data.ProjectPcsAndRunModelSelectionPlugin
Creates a new instance of ProjectPcsAndRunModelSelectionLPlugin
projectPCsOntoNAMFounders(theAlignmentForGenotype, PCResults, chrVector, posVector, theGenotypesForCalculatingPCs, chr) - Method in class net.maizegenetics.analysis.data.ProjectPcsAndRunModelSelectionPlugin
 
proportionHeterozygous(counts, totalCount) - Static method in class net.maizegenetics.dna.snp.genotypecall.AlleleFreqCache
 
proportionHeterozygous(data) - Static method in class net.maizegenetics.dna.snp.genotypecall.AlleleFreqCache
 
proportionHeterozygous() - Method in class net.maizegenetics.dna.snp.genotypecall.Stats
 
proportionOfDepthGenotypesToMask() - Method in class net.maizegenetics.analysis.imputation.FILLINImputationPlugin
Proportion of genotypes of given depth to mask for accuracy calculation if depth available
proportionOfDepthGenotypesToMask(value) - Method in class net.maizegenetics.analysis.imputation.FILLINImputationPlugin
Set Proportion of depth genotypes to mask. Proportion of genotypes of given depth to mask for accuracy calculation if depth available
proportionOfGenotypesToMaskIfNoDepth() - Method in class net.maizegenetics.analysis.imputation.FILLINImputationPlugin
Proportion of genotypes to mask for accuracy calculation if depth not available
proportionOfGenotypesToMaskIfNoDepth(value) - Method in class net.maizegenetics.analysis.imputation.FILLINImputationPlugin
Set Proportion of genotypes to mask if no depth. Proportion of genotypes to mask for accuracy calculation if depth not available
put(key, value) - Method in class net.maizegenetics.analysis.avro.GenericMapAnnotations
 
put(arg0, arg1) - Method in class net.maizegenetics.analysis.avro.GenericRecordChromosome
 
put(arg0, arg1) - Method in class net.maizegenetics.analysis.avro.GenericRecordChromosome
 
put(arg0, arg1) - Method in class net.maizegenetics.analysis.avro.GenericRecordGenotype
 
put(arg0, arg1) - Method in class net.maizegenetics.analysis.avro.GenericRecordGenotype
 
put(arg0, arg1) - Method in class net.maizegenetics.analysis.avro.GenericRecordGenotypeTable
 
put(arg0, arg1) - Method in class net.maizegenetics.analysis.avro.GenericRecordGenotypeTable
 
put(arg0, arg1) - Method in class net.maizegenetics.analysis.avro.GenericRecordPosition
 
put(arg0, arg1) - Method in class net.maizegenetics.analysis.avro.GenericRecordPosition
 
put(arg0, arg1) - Method in class net.maizegenetics.analysis.avro.GenericRecordTaxon
 
put(arg0, arg1) - Method in class net.maizegenetics.analysis.avro.GenericRecordTaxon
 
putAlignmentRetainRareAlleles(value) - Static method in class net.maizegenetics.prefs.TasselPrefs
 
putAll(m) - Method in class net.maizegenetics.analysis.avro.GenericMapAnnotations
 
putAllelePairs(tagTagAlignMap) - Method in interface net.maizegenetics.dna.tag.RepGenDataWriter
Adds entries to the allelepair table
putAllelePairs(tagTagAlignMap) - Method in class net.maizegenetics.dna.tag.RepGenSQLite
 
putAllNamesTag(tagNameMap) - Method in interface net.maizegenetics.dna.tag.RepGenDataWriter
Add a tag to list of known tags with their associated names (good for named contigs)
putAllNamesTag(tagNameMap) - Method in class net.maizegenetics.dna.tag.RepGenSQLite
 
putAllNamesTag(tagNameMap) - Method in class net.maizegenetics.dna.tag.TagDataSQLite
 
putAllNamesTag(tagNameMap) - Method in interface net.maizegenetics.dna.tag.TagDataWriter
Add a tag to list of known tags with their associated names (good for named contigs)
putAllRefTag(refTagPositionMap, refGenome) - Method in interface net.maizegenetics.dna.tag.RepGenDataWriter
Add a reference tag to list of known reference tags
putAllRefTag(refTagPositionMap, refGenome) - Method in class net.maizegenetics.dna.tag.RepGenSQLite
 
putAllTag(tags, tagInstanceAverageQS) - Method in interface net.maizegenetics.dna.tag.RepGenDataWriter
Add a tag to list of known tags
putAllTag(tags, tagInstanceAverageQS) - Method in class net.maizegenetics.dna.tag.RepGenSQLite
 
putAllTag(tags) - Method in class net.maizegenetics.dna.tag.TagDataSQLite
 
putAllTag(tags) - Method in interface net.maizegenetics.dna.tag.TagDataWriter
Add a tag to list of known tags
putAllTissue(tissues) - Method in class net.maizegenetics.dna.tag.TagDataSQLite
 
putAllTissue(masterTissueList) - Method in interface net.maizegenetics.dna.tag.TagDataWriter
Adds list of tissues to the tissue table
putBMSDB(value) - Static method in class net.maizegenetics.prefs.TasselPrefs
 
putBMSHost(value) - Static method in class net.maizegenetics.prefs.TasselPrefs
 
putBMSUser(value) - Static method in class net.maizegenetics.prefs.TasselPrefs
 
putBooleanPref(path, key, value) - Static method in class net.maizegenetics.prefs.TasselPrefs
 
putConfigFile(value) - Static method in class net.maizegenetics.prefs.TasselPrefs
 
putDoublePref(path, key, value) - Static method in class net.maizegenetics.prefs.TasselPrefs
 
putExportPluginExportDiploids(value) - Static method in class net.maizegenetics.prefs.TasselPrefs
 
putExportPluginIncludeTaxaAnnotations(value) - Static method in class net.maizegenetics.prefs.TasselPrefs
 
putFilterAlignPluginMaxFreq(value) - Static method in class net.maizegenetics.prefs.TasselPrefs
 
putFilterAlignPluginMinCount(value) - Static method in class net.maizegenetics.prefs.TasselPrefs
 
putFilterAlignPluginMinFreq(value) - Static method in class net.maizegenetics.prefs.TasselPrefs
 
putFilterTaxaPropsMaxHetFreq(value) - Static method in class net.maizegenetics.prefs.TasselPrefs
 
putFilterTaxaPropsMinHetFreq(value) - Static method in class net.maizegenetics.prefs.TasselPrefs
 
putFilterTaxaPropsMinNotMissingFreq(value) - Static method in class net.maizegenetics.prefs.TasselPrefs
 
putGOBIIDB(value) - Static method in class net.maizegenetics.prefs.TasselPrefs
 
putGOBIIUser(value) - Static method in class net.maizegenetics.prefs.TasselPrefs
 
putIntPref(path, key, value) - Static method in class net.maizegenetics.prefs.TasselPrefs
 
putLocale(value) - Static method in class net.maizegenetics.prefs.TasselPrefs
 
putLogDebug(value) - Static method in class net.maizegenetics.prefs.TasselPrefs
 
putLogSendToConsole(value) - Static method in class net.maizegenetics.prefs.TasselPrefs
 
putLogXDim(value) - Static method in class net.maizegenetics.prefs.TasselPrefs
 
putLogYDim(value) - Static method in class net.maizegenetics.prefs.TasselPrefs
 
putMaxThreads(value) - Static method in class net.maizegenetics.prefs.TasselPrefs
 
putOpenDir(value) - Static method in class net.maizegenetics.prefs.TasselPrefs
 
putPref(path, key, value) - Static method in class net.maizegenetics.prefs.TasselPrefs
 
putRefRefAlignments(tagAlignInfoMap, refGenome) - Method in interface net.maizegenetics.dna.tag.RepGenDataWriter
Adds entries to the tagAlignments table for ref-ref alignments
putRefRefAlignments(tagAlignInfoMap, refGenome) - Method in class net.maizegenetics.dna.tag.RepGenSQLite
 
putRefTagMapping(tagAnnotatedPositionMap, refGenome) - Method in interface net.maizegenetics.dna.tag.RepGenDataWriter
Associates the specified Reference Tag with the specified site Position (value).
putRefTagMapping(refTagPositionMap, refGenome) - Method in class net.maizegenetics.dna.tag.RepGenSQLite
 
putSaveDir(value) - Static method in class net.maizegenetics.prefs.TasselPrefs
 
putSNPPositionQS(qsPosL) - Method in interface net.maizegenetics.dna.tag.RepGenDataWriter
Stores a quality position in the snpposition table for each chromosome/position
putSNPPositionQS(qsPL) - Method in class net.maizegenetics.dna.tag.RepGenSQLite
 
putSNPPositionQS(qsPL) - Method in class net.maizegenetics.dna.tag.TagDataSQLite
 
putSNPPositionQS(qsPosL) - Method in interface net.maizegenetics.dna.tag.TagDataWriter
Stores a quality position in the snpposition table for each chromosome/position
putSNPQualityProfile(tagAnnotatedPositionMap, taxaSubset) - Method in class net.maizegenetics.dna.tag.RepGenSQLite
 
putSNPQualityProfile(tagAnnotatedPositionMap, taxaSubset, counter) - Method in class net.maizegenetics.dna.tag.RepGenSQLite
 
putSNPQualityProfile(tagAnnotatedPositionMap, taxaSubset) - Method in class net.maizegenetics.dna.tag.TagDataSQLite
 
putSNPQualityProfile(tagAnnotatedPositionMap, taxaSubset, counter) - Method in class net.maizegenetics.dna.tag.TagDataSQLite
 
putTagAlignmentApproach(tagAlignmentName, protocol) - Method in interface net.maizegenetics.dna.tag.RepGenDataWriter
 
putTagAlignmentApproach(tagAlignmentName, protocol) - Method in class net.maizegenetics.dna.tag.RepGenSQLite
 
putTagAlignmentApproach(tagAlignmentName, protocol) - Method in class net.maizegenetics.dna.tag.TagDataSQLite
 
putTagAlignmentApproach(tagAlignmentName, protocol) - Method in interface net.maizegenetics.dna.tag.TagDataWriter
 
putTagAlignments(tagAnnotatedPositionMap) - Method in class net.maizegenetics.dna.tag.TagDataSQLite
 
putTagAlignments(tagAnnotatedPositionMap) - Method in interface net.maizegenetics.dna.tag.TagDataWriter
Associates the specified Tag (key) with the specified cut site Position (value). Multiple associations are allowed, as Tags can map to multiple locations. Each tag should only have one best annotation.
putTagAlleles(tagAlleleMap) - Method in interface net.maizegenetics.dna.tag.RepGenDataWriter
 
putTagAlleles(tagAlleleMap) - Method in class net.maizegenetics.dna.tag.RepGenSQLite
 
putTagAlleles(tagAlleleMap) - Method in class net.maizegenetics.dna.tag.TagDataSQLite
 
putTagAlleles(tagAlleleMap) - Method in interface net.maizegenetics.dna.tag.TagDataWriter
 
putTagRefTagAlignments(tagAlignInfoMap, refGenome) - Method in interface net.maizegenetics.dna.tag.RepGenDataWriter
Stores the Smith Waterman score from2 tag alignments. tag2 chrom/pos comes from the AlignmentInfo object. tag1 chrom/pos are separate parameters
putTagRefTagAlignments(tagAlignInfoMap, refGenome) - Method in class net.maizegenetics.dna.tag.RepGenSQLite
 
putTagTagAlignments(tagAlignInfoMap) - Method in interface net.maizegenetics.dna.tag.RepGenDataWriter
Stores the Smith Waterman score from2 tag alignments. tag2 chrom/pos comes from the AlignmentInfo object. tag1 chrom/pos are separate parameters
putTagTagAlignments(tagAlignInfoMap) - Method in class net.maizegenetics.dna.tag.RepGenSQLite
 
putTagTagCorrelationMatrix(tagCorrelationMap) - Method in interface net.maizegenetics.dna.tag.RepGenDataWriter
Adds entries to the tagCorrelations table for tag-tag correlation data
putTagTagCorrelationMatrix(tagCorrelationMap) - Method in class net.maizegenetics.dna.tag.RepGenSQLite
 
putTaxaDistribution(tagTaxaDistributionMap) - Method in interface net.maizegenetics.dna.tag.RepGenDataWriter
Associates a map full of the specified Tag (key) with the specified TaxaDistribution (value). If there was a prior association is it replaced, as all pairs are unique.
putTaxaDistribution(tagTaxaDistributionMap) - Method in class net.maizegenetics.dna.tag.RepGenSQLite
 
putTaxaDistribution(tagTaxaDistributionMap) - Method in class net.maizegenetics.dna.tag.TagDataSQLite
 
putTaxaDistribution(tagTaxaDistributionMap) - Method in interface net.maizegenetics.dna.tag.TagDataWriter
Associates a map full of the specified Tag (key) with the specified TaxaDistribution (value). If there was a prior association is it replaced, as all pairs are unique.
putTaxaList(taxaList) - Method in interface net.maizegenetics.dna.tag.RepGenDataWriter
 
putTaxaList(taxaList) - Method in class net.maizegenetics.dna.tag.RepGenSQLite
 
putTaxaList(taxaList) - Method in class net.maizegenetics.dna.tag.TagDataSQLite
 
putTaxaList(taxaList) - Method in interface net.maizegenetics.dna.tag.TagDataWriter
 
putTaxaTissueDistribution(taxon, tissue, tags, counts) - Method in class net.maizegenetics.dna.tag.TagDataSQLite
 
putTaxaTissueDistribution(taxon, tissue, tags, counts) - Method in interface net.maizegenetics.dna.tag.TagDataWriter
Set distribution of taxa/tissue for each tag
putXDim(value) - Static method in class net.maizegenetics.prefs.TasselPrefs
 
putYDim(value) - Static method in class net.maizegenetics.prefs.TasselPrefs
 

Q

q - Variable in class net.maizegenetics.stats.EMMA.EMMAforDoubleMatrix
 
QQDisplayPlugin - Class in net.maizegenetics.analysis.chart
 
QQDisplayPlugin(parentFrame, isInteractive) - Constructor for class net.maizegenetics.analysis.chart.QQDisplayPlugin
Creates a new instance of QQDisplayPlugin
QRDecomposition - Interface in net.maizegenetics.matrixalgebra.decomposition
 
QseqToPETagCountPlugin - Class in net.maizegenetics.analysis.gbs
Derives a PETagCount list for a pair of Qseq files. The forward and backward tags are ordered during processing Keeps only good reads having a barcode and a cut site and no N's in the useful part of the sequence. For the barcoded end, trims off the barcodes and truncates sequences that (1) have a second cut site, or (2) read into the common adapter. For the unbarcoded end, trims off the barcodes and truncates sequences that (1) have a second cut site, or (2) read into the barcode adapter.
QseqToPETagCountPlugin() - Constructor for class net.maizegenetics.analysis.gbs.QseqToPETagCountPlugin
 
QseqToPETagCountPlugin(parentFrame) - Constructor for class net.maizegenetics.analysis.gbs.QseqToPETagCountPlugin
 
QseqToTagCountPlugin - Class in net.maizegenetics.analysis.gbs
Derives a tagCount list for each qseq file in the qseqDirectory. Keeps only good reads having a barcode and a cut site and no N's in the useful part of the sequence. Trims off the barcodes and truncates sequences that (1) have a second cut site, or (2) read into the common adapter.
QseqToTagCountPlugin() - Constructor for class net.maizegenetics.analysis.gbs.QseqToTagCountPlugin
 
QseqToTagCountPlugin(parentFrame) - Constructor for class net.maizegenetics.analysis.gbs.QseqToTagCountPlugin
 
QseqToTBTPlugin - Class in net.maizegenetics.analysis.gbs
This pipeline converts a series of qseq files to TagsByTaxa files (one per qseq file). It requires a list of existing tags (Tags object), which may come from a TagCounts file or TOPM file.
QseqToTBTPlugin() - Constructor for class net.maizegenetics.analysis.gbs.QseqToTBTPlugin
 
QseqToTBTPlugin(parentFrame) - Constructor for class net.maizegenetics.analysis.gbs.QseqToTBTPlugin
 
qsFile() - Method in class net.maizegenetics.analysis.gbs.v2.UpdateSNPPositionQualityPlugin
Input quality score file to use for setting the qualityScore in the database's snpposition table.
qsFile(value) - Method in class net.maizegenetics.analysis.gbs.v2.UpdateSNPPositionQualityPlugin
Set qsFile. Input quality score file used for setting the qualityScore field in the snpposition table.
quality() - Method in class net.maizegenetics.analysis.rna.FindMatchByWordHash.Match
 
qualityScoreBase - Static variable in class net.maizegenetics.analysis.gbs.repgen.RepGenLoadSeqToDBPlugin
 
quantile(y, n) - Static method in class net.maizegenetics.stats.statistics.ApproxFastChiSquareDistribution
quantile (inverse cumulative density function) of the chi-square distribution
quantile(y, n) - Static method in class net.maizegenetics.stats.statistics.ChiSquareDistribution
quantile (inverse cumulative density function) of the chi-square distribution
quantile(y, lambda) - Static method in class net.maizegenetics.stats.statistics.ExponentialDistribution
quantile (inverse cumulative density function) of the exponential distribution
quantile(y, shape, scale) - Static method in class net.maizegenetics.stats.statistics.GammaDistribution
quantile (inverse cumulative density function) of the Gamma distribution
quantile(z, m, sd) - Static method in class net.maizegenetics.stats.statistics.NormalDistribution
quantiles (=inverse cumulative density function)
quantile(p, k, m) - Static method in class net.maizegenetics.stats.statistics.ParetoDistribution
quantile (inverse cumulative density function) of the Pareto distribution
queryFile() - Method in class net.maizegenetics.analysis.data.GenomeAnnosDBQueryToPositionListPlugin
Query file
queryFile(value) - Method in class net.maizegenetics.analysis.data.GenomeAnnosDBQueryToPositionListPlugin
Set Query file. Query file

R

r2() - Method in class net.maizegenetics.analysis.gbs.repgen.TagCorrelationInfo
 
r2(value) - Method in class net.maizegenetics.analysis.popgen.LDResult.Builder
 
r2() - Method in class net.maizegenetics.analysis.popgen.LDResult
 
RampSeqAlignFromBlastTags - Class in net.maizegenetics.analysis.gbs.repgen
This class takes a rAmpSeq database populated with tags,a reference Genome, a filtered BLAST file output and primers, then: (1) creates reference tags using the blast alignment output (2) runs tag/tag alignment for each tag in the DB, (3) runs tag/refTag alignment for each tag against each ref tag (4) runs refTag/refTag alignment for each refTag in the DB> (5) all alignments are stored in the db tagAlignments table. Alignments are performed and stored in groups to prevent overwhelming the DB with massive load commands. Blast was run on CBSU using these parameters: Make the reference files: makeblastdb -dbtype nucl -in -parse_seqids -out maizeAGPV4.db Run blast using maizeAGPV4.db from command above: blastn -num_threads 24 -db maizeAGPV4.db -query anp68R1Tags.fasta -evalue 1e-60 -max_target_seqs 5 -max_hsps 1 -outfmt 6 -out anp68TagsR1Result/blastANP68_R1.txt The blast output file was filtered using the 3 commands below. The first filters identity down to 98 %, the second gets alignment lengths that were at least 148, the 3rd filters it down to just the chrom, start, end positions: awk '$3 >= 98.000 {print $0}' blastANP68_R1.txt > blastANP68_R1_98per.txt awk '$4 >= 148 {print $0}' blastANP68_R1_98per.txt > blastANP68_R1_98per_148align.txt awk {'printf ("%s\t%s\t%s\n", $2, $9, $10)'} blastANP68_R1_98per_148align.txt > blastANP68_R1_98per_148align_3cols.txt It is the last file from awk, blastANP68_R1_98per_148align_3cols.txt, that is given as a parameter here.
RampSeqAlignFromBlastTags() - Constructor for class net.maizegenetics.analysis.gbs.repgen.RampSeqAlignFromBlastTags
 
RampSeqAlignFromBlastTags(parentFrame) - Constructor for class net.maizegenetics.analysis.gbs.repgen.RampSeqAlignFromBlastTags
 
RampSeqAlignFromBlastTags(parentFrame, isInteractive) - Constructor for class net.maizegenetics.analysis.gbs.repgen.RampSeqAlignFromBlastTags
 
rand - Variable in class net.maizegenetics.analysis.association.AbstractFixedEffectLM
 
randomComparator() - Static method in class net.maizegenetics.stats.linearmodels.BasicLevel
 
RandomGenotypeImputationPlugin - Class in net.maizegenetics.analysis.imputation
 
RandomGenotypeImputationPlugin(parentFrame, isInteractive) - Constructor for class net.maizegenetics.analysis.imputation.RandomGenotypeImputationPlugin
 
randomiseParameters() - Method in class net.maizegenetics.taxa.tree.Parameterized.ParameterizedUser
 
randomSeed - Variable in class net.maizegenetics.analysis.association.AbstractFixedEffectLM
 
randomSeed() - Method in class net.maizegenetics.analysis.numericaltransform.AvgPhenotypeByTaxaPlugin
Random Seed
randomSeed(value) - Method in class net.maizegenetics.analysis.numericaltransform.AvgPhenotypeByTaxaPlugin
Set Random Seed. Random Seed
randomSeed() - Method in class net.maizegenetics.analysis.numericaltransform.BoxCoxTransformationPlugin
Random Seed
randomSeed(value) - Method in class net.maizegenetics.analysis.numericaltransform.BoxCoxTransformationPlugin
Set Random Seed. Random Seed
range() - Method in class net.maizegenetics.analysis.monetdb.ColumnsToBinaryFullGenomeTablePlugin
Columns for range data. If true, will look for 'start' and 'end' (inclusive exclusive) or 'first' 'last' (inclusive inclusive) instead of 'Pos'
range(value) - Method in class net.maizegenetics.analysis.monetdb.ColumnsToBinaryFullGenomeTablePlugin
Set Range information?. Columns for range data. If true, will look for 'start' and 'end' (inclusive exclusive) or 'first' 'last' (inclusive inclusive) instead of 'Pos'
range() - Method in class net.maizegenetics.analysis.monetdb.ColumnsToBinarySNPOnlyTablePlugin
Columns for range data. If true, will look for 'start' and 'end' (inclusive exclusive) or 'first' 'last' (inclusive inclusive) instead of 'Pos'
range(value) - Method in class net.maizegenetics.analysis.monetdb.ColumnsToBinarySNPOnlyTablePlugin
Set Range information?. Columns for range data. If true, will look for 'start' and 'end' (inclusive exclusive) or 'first' 'last' (inclusive inclusive) instead of 'Pos'
range(start, end, base, numBaseIndices) - Static method in class net.maizegenetics.dna.snp.TranslateIndexBuilder
Keeps a range of indices from start (inclusive) to end (inclusive)
range(range) - Method in class net.maizegenetics.plugindef.PluginParameter.Builder
 
range(values) - Method in class net.maizegenetics.plugindef.PluginParameter.Builder
 
rangeToString() - Method in class net.maizegenetics.plugindef.PluginParameter
 
rangeToString(friendly) - Method in class net.maizegenetics.plugindef.PluginParameter
 
RARE_ALLELE - Static variable in interface net.maizegenetics.dna.snp.GenotypeTable
This encoding is used to lump together allele values with frequencies too low to be retained as one of the maximum number of alleles.
RARE_ALLELE_STR - Static variable in interface net.maizegenetics.dna.snp.GenotypeTable
 
RARE_DIPLOID_ALLELE - Static variable in interface net.maizegenetics.dna.snp.GenotypeTable
 
rawData(value) - Method in class net.maizegenetics.analysis.data.HDF5SummaryPlugin
 
rawData() - Method in class net.maizegenetics.analysis.data.HDF5SummaryPlugin
 
rawHDF5GenotypeFile() - Method in class net.maizegenetics.analysis.imputation.ReImputeUpdatedTaxaByFILLINPlugin
Input, unfinished HDF5 (*.h5) file containing raw (unimputed) genotypes
rawHDF5GenotypeFile(value) - Method in class net.maizegenetics.analysis.imputation.ReImputeUpdatedTaxaByFILLINPlugin
Set Raw HDF5 Genotype File. Input, unfinished HDF5 (*.h5) file containing raw (unimputed) genotypes
rawSeqFileNameRegex - Static variable in class net.maizegenetics.analysis.gbs.ProductionSNPCallerPlugin
 
Read - Class in net.maizegenetics.dna.read
Class holding reads of Fastq format.
Read(ID, seq, des, qual) - Constructor for class net.maizegenetics.dna.read.Read
 
read(filename) - Static method in class net.maizegenetics.dna.snp.ImportUtils
This utility attempts to identify the file format(i.e. Hapmap, VCF, HDF5, Fasta, PLINK, Phylip, Numerical Genotype) of the given file and loads it as a Genotype Table.
read(filename, keepDepth, sortPositions) - Static method in class net.maizegenetics.dna.snp.ImportUtils
This utility attempts to identify the file format(i.e. Hapmap, VCF, HDF5, Fasta, PLINK, Phylip, Numerical Genotype) of the given file and loads it as a Genotype Table.
read(vcf) - Static method in class net.maizegenetics.dna.snp.io.BuilderFromVCFUsingHTSJDK
 
read(header, variants) - Static method in class net.maizegenetics.dna.snp.io.BuilderFromVCFUsingHTSJDK
 
read(filename, keepDepth, sortPositions) - Static method in class net.maizegenetics.plugindef.GenerateRCode
 
read(filename) - Static method in class net.maizegenetics.taxa.tree.NewickUtils
Creates a Tree from the given newick formatted file
read(inputBuffer, inputBufferOffset, inputBufferLen) - Method in class net.maizegenetics.util.MultiMemberGZIPInputStream
 
readAllFastQBlock(bw, currentRead) - Static method in class net.maizegenetics.util.ConvertOldFastqToModernFormatPlugin
 
ReadBarcodeResult - Class in net.maizegenetics.analysis.gbs
Container class for returning the results of parsed barcoded sequencing read.
ReadBarcodeResult(read, length, taxon, taxonIndex) - Constructor for class net.maizegenetics.analysis.gbs.ReadBarcodeResult
 
ReadBarcodeResult(sequence) - Constructor for class net.maizegenetics.analysis.gbs.ReadBarcodeResult
 
readBasicAlignments(input, maxLabelLength) - Static method in class net.maizegenetics.dna.snp.ReadSequenceAlignmentUtils
read from stream, while letting the user set the maximum label (taxa) label length as non-standard phylip formats now exist
readBasicAlignments(file, maxLabelLength) - Static method in class net.maizegenetics.dna.snp.ReadSequenceAlignmentUtils
read from file, while letting the user set the maximum label (taxa) label length as non-standard phylip formats now exist
ReadBedfile - Class in net.maizegenetics.dna.snp.io
 
ReadBedfile.BedFileRange - Class in net.maizegenetics.dna.snp.io
 
readBinaryFile(inputFileS) - Method in class net.maizegenetics.analysis.gbs.SimpleGenotypeSBit
 
readBinaryFile(infileS) - Method in class net.maizegenetics.dna.map.PETagsOnPhysicalMapV3
read from a file
readBinaryFile(currentFile) - Method in class net.maizegenetics.dna.map.TagsOnPhysicalMap
 
readBinaryTagCountFile(inFile) - Method in class net.maizegenetics.dna.tag.TagCounts
 
readBinMultiBlupCounts(filename, builder) - Static method in class net.maizegenetics.taxa.distance.ReadDistanceMatrix
 
readBinMultiBlupID(filename) - Static method in class net.maizegenetics.taxa.distance.ReadDistanceMatrix
 
readBinMultiBlupMatrix(filename) - Static method in class net.maizegenetics.taxa.distance.ReadDistanceMatrix
 
readBlock(blockIndex) - Method in class net.maizegenetics.dna.map.TagGWASMap
 
readBlock(blockIndex) - Method in class net.maizegenetics.dna.tag.AbstractTagsHDF5
Read in a block from HDF5 file
readChannel(inFile) - Method in class net.maizegenetics.dna.tag.AbstractTagsByTaxa
 
readCluster(infileS, binary) - Method in class net.maizegenetics.analysis.gbs.Clusters
 
readCount - Variable in class net.maizegenetics.dna.map.TagGWASMapInfo
Tag count in master tagCount file, unknown = Integer.MIN_VALUE
readDataSet(filename) - Static method in class net.maizegenetics.dna.snp.ImportUtils
This utility attempts to identify the file format(i.e. Hapmap, VCF, HDF5, Fasta, PLINK, Phylip, Numerical Genotype) of the given file and loads it as a DataSet.
readDelimitedTableReport(saveFile, delimit) - Static method in class net.maizegenetics.util.TableReportUtils
 
readDeMultiPlexFastQBlock(bw, currentRead) - Static method in class net.maizegenetics.analysis.gbs.v2.GBSUtils
Method for reading FastQ four line structure, and returning a string array with [sequence, qualityScore]
readDigestPlugin() - Method in class net.maizegenetics.analysis.gbs.pana.PanAUsageExample
 
readDirectory(path) - Static method in class net.maizegenetics.util.Utils
 
ReadDistanceMatrix - Class in net.maizegenetics.taxa.distance
 
readDistanceMatrix(filename) - Static method in class net.maizegenetics.taxa.distance.ReadDistanceMatrix
 
readDistFile(infileS, format) - Method in class net.maizegenetics.dna.map.PETagsOnPhysicalMap
 
readDistFile(infileS, format) - Method in class net.maizegenetics.dna.map.TagsOnGeneticMap
Read tagsOnGeneticMap file
readDistFile(inFile, numberType) - Method in class net.maizegenetics.dna.tag.AbstractTagsByTaxa
 
readDistFile(infileS, format) - Method in class net.maizegenetics.dna.tag.PETagCounts
Read PETagCounts file
readDistFile(infile, binary) - Method in class net.maizegenetics.dna.tag.TagCounts
 
readDistFile(inFile, binary) - Method in class net.maizegenetics.dna.tag.TagsByTaxaByteFileMap
 
readDistFile(inFile, binary) - Method in class net.maizegenetics.dna.tag.TagsByTaxaByteFileMapSeq
 
readDouble(in) - Method in class net.maizegenetics.util.FormattedInput
read next number from stream and convert it to a double (newline/cr are treated as separators)
readDouble(in, ignoreNewlineCR) - Method in class net.maizegenetics.util.FormattedInput
read next number from stream and convert it to a double
readEndCutSiteRemnantLength - Static variable in class net.maizegenetics.analysis.gbs.ParseBarcodeRead
 
readEndCutSiteRemnantLength - Static variable in class net.maizegenetics.analysis.gbs.repgen.RepGenLoadSeqToDBPlugin
 
readEndCutSiteRemnantLength - Static variable in class net.maizegenetics.analysis.gbs.repgen.RGBSProductionSNPCallerPlugin
 
readEndCutSiteRemnantLength - Variable in class net.maizegenetics.analysis.gbs.v2.EnzymeList.Enzyme
 
readEndCutSiteRemnantLength() - Method in class net.maizegenetics.analysis.gbs.v2.EnzymeList.Enzyme
Deprecated. 
readEndCutSiteRemnantLength() - Method in class net.maizegenetics.analysis.gbs.v2.GBSEnzyme
Deprecated.
 
readEndCutSiteRemnantLength - Static variable in class net.maizegenetics.analysis.gbs.v2.GBSSeqToTagDBPlugin
 
readEndCutSiteRemnantLength - Static variable in class net.maizegenetics.analysis.gbs.v2.ProductionSNPCallerPluginV2
 
readEndCutSiteRemnantLength - Static variable in class net.maizegenetics.analysis.rna.RNADeMultiplexProductionPlugin
 
readEndCutSiteRemnantLength - Static variable in class net.maizegenetics.util.ConvertOldFastqToModernFormatPlugin
 
readFasta(filename) - Static method in class net.maizegenetics.dna.snp.ImportUtils
 
readFastQBlock(bw, currentRead) - Static method in class net.maizegenetics.analysis.gbs.v2.GBSUtils
Method for reading FastQ four line structure, and returning a string array with [sequence, qualityScore]
readFromHapmap(filename) - Static method in class net.maizegenetics.dna.snp.ImportUtils
Read GenotypeTable from HapMap file
readFromHapmap(filename, listener) - Static method in class net.maizegenetics.dna.snp.ImportUtils
Read GenotypeTable from HapMap file
readFromHapmap(filename, listener, sortPositions) - Static method in class net.maizegenetics.dna.snp.ImportUtils
Read GenotypeTable from HapMap file
readFromPLink(pedFilename, mapFilename, listener) - Static method in class net.maizegenetics.dna.snp.ImportUtils
 
readFromPLink(pedFilename, mapFilename, listener, sortPositions) - Static method in class net.maizegenetics.dna.snp.ImportUtils
 
readFromVCF(filename, listener, keepDepth, sortPositions) - Static method in class net.maizegenetics.dna.snp.ImportUtils
 
readFromVCF(filename, listener, keepDepth) - Static method in class net.maizegenetics.dna.snp.ImportUtils
 
readFromVCF(filename, listener) - Static method in class net.maizegenetics.dna.snp.ImportUtils
 
readFromVCF(filename) - Static method in class net.maizegenetics.dna.snp.ImportUtils
 
readGuessFormat(fileName) - Static method in class net.maizegenetics.dna.snp.ImportUtils
Deprecated. 
readH5File(inputFileS) - Method in class net.maizegenetics.analysis.gbs.SimpleGenotypeSBit
 
readHDF5(hdf5FileS) - Method in class net.maizegenetics.dna.map.TagGWASMap
 
readHDF5(hdf5FileS) - Method in class net.maizegenetics.dna.tag.AbstractTagsHDF5
Read in HDF5 file
readHDF5Annotation(reader, path) - Static method in class net.maizegenetics.util.HDF5Utils
 
readHDF5Annotation(reader, path, annotationKeys) - Static method in class net.maizegenetics.util.HDF5Utils
 
readIndex(idxFilename) - Static method in class net.maizegenetics.dna.snp.io.LineIndexBuilder
 
readInt(in) - Method in class net.maizegenetics.util.FormattedInput
read next number from stream and convert it to a int (newline/cr are treated as separators)
readInt(in, ignoreNewlineCR) - Method in class net.maizegenetics.util.FormattedInput
read next number from stream and convert it to a int
readLabel(in, maxLength) - Method in class net.maizegenetics.util.FormattedInput
read sequence label from stream A sequence label is not allowed to contain whitespace and either of :,;()[]{}. Note that newline/cr is NOT counted as white space!!
readLine(in, keepWhiteSpace) - Method in class net.maizegenetics.util.FormattedInput
read a whole line
readLineSkipComments(br) - Static method in class net.maizegenetics.util.Utils
 
readNextChar(input) - Method in class net.maizegenetics.util.FormattedInput
read next character from stream (EOF does not count as character but will throw exception)
readNextLine(reader, inFile) - Static method in class net.maizegenetics.analysis.gobii.GOBIIDbUtils
 
readNumber(in, ignoreNewlineCR) - Method in class net.maizegenetics.util.FormattedInput
 
readNumericMarkerFile(inputFile) - Static method in class net.maizegenetics.dna.snp.io.ReadNumericMarkerUtils
 
ReadNumericMarkerUtils - Class in net.maizegenetics.dna.snp.io
 
readOldFormatKeyFile(fileName, filters, mergeSameNames) - Static method in class net.maizegenetics.util.ConvertOldFastqToModernFormatPlugin
 
readOldTaxaAnnotationFile(fileName, filters, mergeSameNames) - Static method in class net.maizegenetics.util.ConvertOldFastqToModernFormatPlugin
 
readPedigreeFile(popFilename) - Static method in class net.maizegenetics.analysis.imputation.PopulationData
 
readPedigreeFile(popFilename, chrname, includeParents) - Static method in class net.maizegenetics.analysis.imputation.PopulationData
 
readQualityScoreFile(fileName) - Static method in class net.maizegenetics.dna.map.PositionListIOUtils
Returns a PositionList from a tab-delimited text SNP Quality Score file. The input file has 3 tab-delimited fields indicating Chromosome Number and Quality Score Position A header row is the first line and looks like this: CHROM POS QUALITYSCORE The remaining rows contains integer values as below: 9 18234 15.5 NOTE: the CHROM field is a string.
readReferenceGenomeChr(fastaFileName, charConversion) - Static method in class net.maizegenetics.dna.map.GenomeSequenceBuilder
 
Reads - Interface in net.maizegenetics.dna.tag
Basic methods for working with nextgen reads
readSAMFile(topm, inputFileName, tagLengthInLong) - Method in class net.maizegenetics.analysis.gbs.AnnotateTOPMwSAMPlugin
Reads SAM files output from bowtie2
readSAMFile(inputFileName, tagLengthInLong) - Method in class net.maizegenetics.dna.map.TagsOnPhysicalMap
Reads SAM files output from BWA or bowtie2
ReadsByTaxa - Class in net.maizegenetics.dna.tag
 
ReadsByTaxa() - Constructor for class net.maizegenetics.dna.tag.ReadsByTaxa
 
ReadsByTaxa(infile, binary) - Constructor for class net.maizegenetics.dna.tag.ReadsByTaxa
 
ReadsByTaxa(taxaNames, theDistinctReads) - Constructor for class net.maizegenetics.dna.tag.ReadsByTaxa
 
ReadsByTaxa(reads, readDist, namesForTaxa) - Constructor for class net.maizegenetics.dna.tag.ReadsByTaxa
 
ReadSequenceAlignmentUtils - Class in net.maizegenetics.dna.snp
reads aligned sequence data from plain text files.
readSiteStore(filename) - Static method in class net.maizegenetics.analysis.modelfitter.AdditiveSiteStorePlugin
 
readSNPConserveFile(fileName) - Static method in class net.maizegenetics.dna.map.PositionListIOUtils
Returns a PositionList from a tab-delimited text SNP Conserve file. The input file has 2 tab-delimited fields indicating Chromosome Number and Position A header row is the first line and looks like this: #CHROM POS The remaining rows contains integer values as below: 9 18234
readTableReport(saveFile) - Static method in class net.maizegenetics.util.TableReportBuilder
 
readTagBlockPostition(blockFileS) - Method in class net.maizegenetics.analysis.gbs.TagBlockPosition
 
readTagPair(infileS) - Method in class net.maizegenetics.dna.tag.UTagPairs
 
readTaxaAnnotationFile(fileName, taxaNameField, filters, mergeSameNames) - Static method in class net.maizegenetics.taxa.TaxaListIOUtils
Returns an annotated TaxaList from a text annotation file in matrix format. This is a tab delimited file. First row in the file with the field taxaNameField is the header row. taxaNameField indicated the taxon name, all other fields are user defined. The fields become the keys for the taxa annotation. Quantitative fields should be tagged with "#" sign, e.g. <#INBREEDF>. Multiple values are supported per key, and additional values can be either described with an additional column or ";" to delimit values with the same key.
readTaxaAnnotationFile(fileName, taxaNameField) - Static method in class net.maizegenetics.taxa.TaxaListIOUtils
Returns an annotated TaxaList from a text annotation file in matrix format. This is a tab delimited file. First row in the file with the field taxaNameField is the header row. taxaNameField indicated the taxon name, all other fields are user defined. The fields become the keys for the taxa annotation. Quantitative fields should be tagged with "#" sign, e.g. <#INBREEDF>. Multiple values are supported per key, and additional values can be either described with an additional column or ";" to delimit values with the same key.
readTaxaAnnotationFileAL(fileName, taxaNameField, filters) - Static method in class net.maizegenetics.taxa.TaxaListIOUtils
 
readTaxaFsFromFile(pedigreeFile) - Static method in class net.maizegenetics.analysis.gbs.DiscoverySNPCallerPlugin
 
readTBTFile(inFile) - Method in class net.maizegenetics.dna.tag.ReadsByTaxa
Converts a TBT Bit file to a ReadsByTaxa object (for compatibility only).
readTextFile(inFile) - Method in class net.maizegenetics.dna.map.TagsOnPhysicalMap
 
readTissueAnnotationFile(fileName, tissueNameField) - Static method in class net.maizegenetics.taxa.TaxaListIOUtils
This method takes a key file and creates a SortedSet that contains a set of the tissue values. The set will be null if no tissues are present
readTOPM(filename) - Static method in class net.maizegenetics.dna.map.TOPMUtils
This reads in a TOPM file. It can be .topm.txt, .topm.bin, or .topm.h5.
ReadUtils - Class in net.maizegenetics.dna.read
 
ReadUtils.ReadFormat - Enum in net.maizegenetics.dna.read
 
readWord(in) - Method in class net.maizegenetics.util.FormattedInput
read word from stream
readXMLAsArgs(filename) - Static method in class net.maizegenetics.pipeline.TasselPipelineXMLUtil
 
readXMLAsArgsFromResource(filename) - Static method in class net.maizegenetics.pipeline.TasselPipelineXMLUtil
 
readZipFile(path) - Static method in class net.maizegenetics.util.Utils
 
recalculateScores() - Method in class net.maizegenetics.analysis.clustering.HaplotypeClusterer
Recalculates the scores of the clusters in the cluster list. Removes any clusters with a score of 0.
receiveDataSetFrom(plugin) - Method in class net.maizegenetics.analysis.data.CombineDataSetsPlugin
Add given plugin as source to receive data sets iteratively.
receiveDataSetOnceFrom(plugin) - Method in class net.maizegenetics.analysis.data.CombineDataSetsPlugin
Add given plugin as source to receive data sets only once and use that data set in every resulting output.
receiveInput(input) - Method in class net.maizegenetics.analysis.data.CombineDataSetsPlugin
Sets up this plugin to receive input from another plugin.
receiveInput(input) - Method in class net.maizegenetics.plugindef.AbstractPlugin
Sets up this plugin to receive input from another plugin.
receiveInput(input) - Method in interface net.maizegenetics.plugindef.Plugin
Sets up this plugin to receive input from another plugin.
reciprocate() - Method in class net.maizegenetics.analysis.gbs.UNetworkFilter
 
recombinationBreakpoints() - Method in class net.maizegenetics.analysis.data.ProjectionLoadPlugin
Recombination Breakpoints
recombinationBreakpoints(value) - Method in class net.maizegenetics.analysis.data.ProjectionLoadPlugin
Set Recombination Breakpoints. Recombination Breakpoints
recombinationBreakpoints() - Method in class net.maizegenetics.analysis.data.ProjectPcsAndRunModelSelectionPlugin
Recombination Breakpoints
recombinationBreakpoints(value) - Method in class net.maizegenetics.analysis.data.ProjectPcsAndRunModelSelectionPlugin
Set Recombination Breakpoints. Recombination Breakpoints
recursiveRead(file, startIndex, packages) - Static method in class net.maizegenetics.util.Utils
 
reduce() - Method in class net.maizegenetics.analysis.gbs.neobio.Smawk
This method is the key component of the SMAWK algorithm. It reduces an n x m matrix (n rows and m columns), where n >= m, to an n x n matrix by deleting m - n rows that are guaranteed to have no maximum value for any column. The result is an squared submatrix matrix that contains, for each column c, the row that has the maximum value of c in the original matrix. The rows are deleted with the deleteRowmethod.
reduce(suffix) - Method in interface net.maizegenetics.util.db.DBTuple
 
reduceMaskTo(percent) - Method in class net.maizegenetics.dna.snp.MaskMatrixBuilder
 
REF_ALLELE - Static variable in class net.maizegenetics.dna.snp.HapMapHDF5Constants
 
REF_ALLELES - Static variable in class net.maizegenetics.util.Tassel5HDF5Constants
 
ref_genome() - Method in class net.maizegenetics.analysis.gbs.repgen.AlignmentInfo
 
ref_strand() - Method in class net.maizegenetics.analysis.gbs.repgen.AlignmentInfo
 
refAllele - Variable in class net.maizegenetics.plugindef.GenerateRCode.PositionVectors
 
refAlleleFromChromPos(refChromBytes, allelePos) - Static method in class net.maizegenetics.analysis.monetdb.ColumnsToBinaryUtils
 
refDir() - Method in class net.maizegenetics.analysis.monetdb.ColumnsToBinarySNPOnlyTablePlugin
Directory holding files that contain all the SNP physical positions, separated by chr
refDir(value) - Method in class net.maizegenetics.analysis.monetdb.ColumnsToBinarySNPOnlyTablePlugin
Set refDir. Directory holding files that contain all the SNP physical positions, separated by chr
reference() - Method in class net.maizegenetics.analysis.data.AddReferenceToGenotypePlugin
Input Reference Fasta
reference(value) - Method in class net.maizegenetics.analysis.data.AddReferenceToGenotypePlugin
Set Reference. Input Reference Fasta
reference() - Method in class net.maizegenetics.analysis.phg.ParseGVCF.GVCFLine
 
reference() - Method in class net.maizegenetics.dna.tag.TagBuilder
 
referenceAllele(site) - Method in class net.maizegenetics.dna.snp.CombineGenotypeTable
 
referenceAllele(site) - Method in class net.maizegenetics.dna.snp.CoreGenotypeTable
 
referenceAllele(site) - Method in interface net.maizegenetics.dna.snp.GenotypeTable
Return (haploid) reference allele value at given site.
referenceAllele(site) - Method in class net.maizegenetics.dna.snp.MergedGenotypeTable
 
referenceAllele(site) - Method in class net.maizegenetics.dna.snp.TOPMGenotypeTable
 
referenceAlleleForAllSites() - Method in class net.maizegenetics.dna.snp.CombineGenotypeTable
 
referenceAlleleForAllSites() - Method in class net.maizegenetics.dna.snp.CoreGenotypeTable
 
referenceAlleleForAllSites() - Method in interface net.maizegenetics.dna.snp.GenotypeTable
Returns (haploid) reference alleles for all sites.
referenceAlleleForAllSites() - Method in class net.maizegenetics.dna.snp.MergedGenotypeTable
 
referenceAlleleForAllSites() - Method in class net.maizegenetics.dna.snp.TOPMGenotypeTable
 
referenceAlleles(startSite, endSite) - Method in class net.maizegenetics.dna.snp.CombineGenotypeTable
 
referenceAlleles(startSite, endSite) - Method in class net.maizegenetics.dna.snp.CoreGenotypeTable
 
referenceAlleles(startSite, endSite) - Method in interface net.maizegenetics.dna.snp.GenotypeTable
Returns (haploid) reference alleles in specified range. End site not included.
referenceAlleles(startSite, endSite) - Method in class net.maizegenetics.dna.snp.MergedGenotypeTable
 
referenceAlleles(startSite, endSite) - Method in class net.maizegenetics.dna.snp.TOPMGenotypeTable
 
referenceGenomeFile() - Method in class net.maizegenetics.analysis.data.AddReferenceAlleleToHDF5Plugin
Reference genome file in fasta format
referenceGenomeFile(value) - Method in class net.maizegenetics.analysis.data.AddReferenceAlleleToHDF5Plugin
Set Reference Genome File. Reference genome file in fasta format
referenceGenomeFile() - Method in class net.maizegenetics.analysis.gbs.DiscoverySNPCallerPlugin
Path to reference genome in fasta format. Ensures that a tag from the reference genome is always included when the tags at a locus are aligned against each other to call SNPs. The reference allele for each site is then provided in the output HapMap files, under the taxon name "REFERENCE_GENOME" (first taxon). DEFAULT: Don't use reference genome.
referenceGenomeFile(value) - Method in class net.maizegenetics.analysis.gbs.DiscoverySNPCallerPlugin
Set Reference Genome File. Path to reference genome in fasta format. Ensures that a tag from the reference genome is always included when the tags at a locus are aligned against each other to call SNPs. The reference allele for each site is then provided in the output HapMap files, under the taxon name "REFERENCE_GENOME" (first taxon). DEFAULT: Don't use reference genome.
referenceGenomeFile() - Method in class net.maizegenetics.analysis.gbs.v2.DiscoverySNPCallerPluginV2
Path to reference genome in fasta format. Ensures that a tag from the reference genome is always included when the tags at a locus are aligned against each other to call SNPs. The reference allele for each site is then provided in the output HapMap files, under the taxon name "REFERENCE_GENOME" (first taxon). DEFAULT: Don't use reference genome.
referenceGenomeFile(value) - Method in class net.maizegenetics.analysis.gbs.v2.DiscoverySNPCallerPluginV2
Set Reference Genome File. Path to reference genome in fasta format. Ensures that a tag from the reference genome is always included when the tags at a locus are aligned against each other to call SNPs. The reference allele for each site is then provided in the output HapMap files, under the taxon name "REFERENCE_GENOME" (first taxon). DEFAULT: Don't use reference genome.
referenceGenomeVersion() - Method in class net.maizegenetics.analysis.data.AddReferenceAlleleToHDF5Plugin
Version of the reference genome
referenceGenomeVersion(value) - Method in class net.maizegenetics.analysis.data.AddReferenceAlleleToHDF5Plugin
Set Reference Genome Version. Version of the reference genome
referenceProb(site) - Method in class net.maizegenetics.phenotype.GenotypePhenotype
 
referenceProbability() - Method in class net.maizegenetics.dna.snp.CombineGenotypeTable
 
referenceProbability(taxon, site) - Method in class net.maizegenetics.dna.snp.CombineGenotypeTable
 
referenceProbability() - Method in class net.maizegenetics.dna.snp.CoreGenotypeTable
 
referenceProbability(taxon, site) - Method in class net.maizegenetics.dna.snp.CoreGenotypeTable
 
referenceProbability() - Method in interface net.maizegenetics.dna.snp.GenotypeTable
Returns reference probability object (null if not present)
referenceProbability(taxon, site) - Method in interface net.maizegenetics.dna.snp.GenotypeTable
 
referenceProbability() - Method in class net.maizegenetics.dna.snp.MergedGenotypeTable
 
referenceProbability(taxon, site) - Method in class net.maizegenetics.dna.snp.MergedGenotypeTable
 
ReferenceProbability - Class in net.maizegenetics.dna.snp.score
 
referenceProbability() - Method in class net.maizegenetics.dna.snp.TOPMGenotypeTable
 
referenceProbability(taxon, site) - Method in class net.maizegenetics.dna.snp.TOPMGenotypeTable
 
ReferenceProbabilityBuilder - Class in net.maizegenetics.dna.snp.score
 
ReferenceProbabilityFELM - Class in net.maizegenetics.analysis.association
 
ReferenceProbabilityFELM(data, parentPlugin) - Constructor for class net.maizegenetics.analysis.association.ReferenceProbabilityFELM
 
refFile() - Method in class net.maizegenetics.analysis.gobii.MarkerDNARun_IFLFilePlugin
Species reference file used to determine ref allele at marker position
refFile(value) - Method in class net.maizegenetics.analysis.gobii.MarkerDNARun_IFLFilePlugin
Set Reference File. Species reference file used to determine ref allele at marker position
refFile() - Method in class net.maizegenetics.analysis.monetdb.ColumnsToBinaryFullGenomeTablePlugin
Link to maize reference file.
refFile(value) - Method in class net.maizegenetics.analysis.monetdb.ColumnsToBinaryFullGenomeTablePlugin
Set refFile.
refGenome() - Method in class net.maizegenetics.analysis.gbs.repgen.RampSeqAlignFromBlastTags
Referemce Genome File for aligning against
refGenome(value) - Method in class net.maizegenetics.analysis.gbs.repgen.RampSeqAlignFromBlastTags
Set Reference Genome File. Referemce Genome File for aligning against
refGenome() - Method in class net.maizegenetics.analysis.gbs.repgen.RefTagData
 
refGenome() - Method in class net.maizegenetics.analysis.gbs.repgen.RepGenAlignerPlugin
Output fastq file to use as input for BWA or bowtie2
refGenome(value) - Method in class net.maizegenetics.analysis.gbs.repgen.RepGenAlignerPlugin
Set Output File. Output fastq file to use as input for BWA or bowtie2
refGenome() - Method in class net.maizegenetics.analysis.gbs.repgen.RepGenPhase2AlignerPlugin
Output fastq file to use as input for BWA or bowtie2
refGenome(value) - Method in class net.maizegenetics.analysis.gbs.repgen.RepGenPhase2AlignerPlugin
Set Output File. Output fastq file to use as input for BWA or bowtie2
refKmerLen() - Method in class net.maizegenetics.analysis.gbs.repgen.RepGenAlignerPlugin
Length of kmers as tag sequences in the db
refKmerLen(value) - Method in class net.maizegenetics.analysis.gbs.repgen.RepGenAlignerPlugin
Set Kmer length. Length of kmers to be stored as tag sequences in the db
refKmerLen() - Method in class net.maizegenetics.analysis.gbs.repgen.RepGenPhase2AlignerPlugin
Length of kmers as tag sequences in the db
refKmerLen(value) - Method in class net.maizegenetics.analysis.gbs.repgen.RepGenPhase2AlignerPlugin
Set Kmer length. Length of kmers to be stored as tag sequences in the db
refName() - Method in class net.maizegenetics.analysis.gobii.MarkerDNARun_IFLFilePlugin
Name of referenece, e.g agpv2. Must match name from entry in reference table in db.
refName(value) - Method in class net.maizegenetics.analysis.gobii.MarkerDNARun_IFLFilePlugin
Set Reference Name. Name of referenece, e.g agpv2. Must match name from entry in reference table in db.
RefProbAdditiveSite - Class in net.maizegenetics.analysis.modelfitter
An AdditiveSite that takes a float[] valued covariate as an argument. The covariate should equal the probability that a given allele (major or minor, for example) would be selected at random from that site. It also stores the value of a statistic determined by selectionCriteria which results from fitting a linear model.
RefProbAdditiveSite(site, chr, pos, id, selectionCriteria, covariate) - Constructor for class net.maizegenetics.analysis.modelfitter.RefProbAdditiveSite
 
RefTagData - Class in net.maizegenetics.analysis.gbs.repgen
Class needed for storing reference tags into RepGen SQLite tables
RefTagData(myTag, chromosome, position, refGenome) - Constructor for class net.maizegenetics.analysis.gbs.repgen.RefTagData
 
registerConversion(source, target, transformer) - Static method in class net.maizegenetics.util.db.TransformerService
 
RegRidgeEmmaDoubleMatrix - Class in net.maizegenetics.analysis.association
 
RegRidgeEmmaDoubleMatrix(phenotype, fixedEffects, genotypes, type) - Constructor for class net.maizegenetics.analysis.association.RegRidgeEmmaDoubleMatrix
Constructor using native double arrays. Need to specify DoubleMatrix FactoryType
RegRidgeEmmaDoubleMatrix(phenotype, fixedEffects, genotypes) - Constructor for class net.maizegenetics.analysis.association.RegRidgeEmmaDoubleMatrix
Constructor using Tassel DoubleMatrix.
RegRidgeEmmaDoubleMatrix(phenotype, fixedEffects, genotypes, kinship) - Constructor for class net.maizegenetics.analysis.association.RegRidgeEmmaDoubleMatrix
Constructor using Tassel DoubleMatrix. Use when kinship matrix from markers has already been calculated (XXt).
ReImputeUpdatedTaxaByFILLINPlugin - Class in net.maizegenetics.analysis.imputation
Compares an unfinished HDF5 file containing raw genotypes to a corresponding unfinished HDF5 file containing FILLIN-imputed genotypes to find new taxa (or taxa with additional depth) in the raw geno file, then imputes (or reimputes) these with FILLIN and adds them to (or replaces them in) the imputed geno file. This is part of the Automated Production Pipeline.
ReImputeUpdatedTaxaByFILLINPlugin() - Constructor for class net.maizegenetics.analysis.imputation.ReImputeUpdatedTaxaByFILLINPlugin
 
ReImputeUpdatedTaxaByFILLINPlugin(parentFrame, isInteractive) - Constructor for class net.maizegenetics.analysis.imputation.ReImputeUpdatedTaxaByFILLINPlugin
 
reindexTaxa(taxaIndex, uniqueTaxa) - Method in interface net.maizegenetics.analysis.modelfitter.AdditiveSite
This method re-indexes the taxa in the additive site so that the returned covariate will match the taxon order in the target phenotype
reindexTaxa(taxaIndex, uniqueTaxa) - Method in class net.maizegenetics.analysis.modelfitter.GenotypeAdditiveSite
 
reindexTaxa(taxaIndex, uniqueTaxa) - Method in class net.maizegenetics.analysis.modelfitter.RefProbAdditiveSite
 
remove(o) - Method in class net.maizegenetics.analysis.avro.GenericArrayPositions
 
remove(index) - Method in class net.maizegenetics.analysis.avro.GenericArrayPositions
 
remove(o) - Method in class net.maizegenetics.analysis.avro.GenericArrayTaxa
 
remove(index) - Method in class net.maizegenetics.analysis.avro.GenericArrayTaxa
 
remove(key) - Method in class net.maizegenetics.analysis.avro.GenericMapAnnotations
 
remove(hap) - Method in class net.maizegenetics.analysis.clustering.HaplotypeCluster
 
remove(o) - Method in class net.maizegenetics.dna.snp.FilterList
 
remove(index) - Method in class net.maizegenetics.dna.snp.FilterList
 
remove(index) - Method in class net.maizegenetics.gui.SelectFromAvailableDialog.SelectedListModel
 
remove(other) - Method in interface net.maizegenetics.util.BitSet
Remove all elements set in other. this = this AND_NOT other
remove(other) - Method in class net.maizegenetics.util.OpenBitSet
Remove all elements set in other. this = this AND_NOT other
remove() - Method in class net.maizegenetics.util.UndirectedGraph.UndirectedIterator
 
remove(o) - Method in class net.maizegenetics.util.UndirectedGraph.UndirectedSet
 
remove(other) - Method in class net.maizegenetics.util.UnmodifiableBitSet
 
removeAll(c) - Method in class net.maizegenetics.analysis.avro.GenericArrayPositions
 
removeAll(c) - Method in class net.maizegenetics.analysis.avro.GenericArrayTaxa
 
removeAll(cluster) - Method in class net.maizegenetics.analysis.clustering.HaplotypeCluster
All haplotypes in cluster that are also in this cluster will be removed from this cluster
removeAll(c) - Method in class net.maizegenetics.dna.snp.FilterList
 
removeAll(c) - Method in class net.maizegenetics.util.UndirectedGraph.UndirectedSet
 
removeBranch(node) - Static method in class net.maizegenetics.taxa.tree.NodeUtils
remove internal branch (collapse node with its parent)
removeBranchLengths(tree) - Static method in class net.maizegenetics.taxa.tree.NewickUtils
This removes the branch lengths from the given tree
RemoveBranchLengthsPlugin - Class in net.maizegenetics.analysis.tree
 
RemoveBranchLengthsPlugin(parentFrame, isInteractive) - Constructor for class net.maizegenetics.analysis.tree.RemoveBranchLengthsPlugin
 
RemoveBranchLengthsPlugin() - Constructor for class net.maizegenetics.analysis.tree.RemoveBranchLengthsPlugin
 
RemoveBranchLengthsPluginKt - Class in net.maizegenetics.analysis.tree
 
removeChild(n) - Method in interface net.maizegenetics.taxa.tree.Node
remove child
removeChild(parent, child) - Static method in class net.maizegenetics.taxa.tree.NodeUtils
remove child
removeChild(n) - Method in class net.maizegenetics.taxa.tree.SimpleNode
remove child
removeClusterHaplotypesFromOtherClusters(clusterIndex) - Method in class net.maizegenetics.analysis.clustering.HaplotypeClusterer
For this cluster, remove all of its haplotypes from other clusters, adjust the cluster scores, and re-sort the clusters. As a result, cluster size will equal cluster score for this cluster.
removeCollinearMarkers(removeCollinearMarker) - Method in class net.maizegenetics.analysis.modelfitter.StepwiseOLSModelFitter
 
removeFirstHaplotypes(maxdistance) - Method in class net.maizegenetics.analysis.clustering.HaplotypeClusterer
Removes all haplotypes within maxdistance of the haplotype of the first cluster. After the haplotypes have been removed clusters are remade and sorted.
removeHeterozygousClusters(maxHetSites) - Method in class net.maizegenetics.analysis.clustering.HaplotypeClusterer
 
removeIndelsForBeagle() - Method in class net.maizegenetics.analysis.imputation.RemoveIndelsForBeaglePlugin
 
RemoveIndelsForBeaglePlugin - Class in net.maizegenetics.analysis.imputation
 
RemoveIndelsForBeaglePlugin() - Constructor for class net.maizegenetics.analysis.imputation.RemoveIndelsForBeaglePlugin
 
RemoveIndelsForBeaglePlugin(parentFrame, isInteractive) - Constructor for class net.maizegenetics.analysis.imputation.RemoveIndelsForBeaglePlugin
 
removeInstance(alignment) - Static method in class net.maizegenetics.tassel.SeqViewerPanel
 
removeMinorSNPStates() - Method in class net.maizegenetics.analysis.filter.FilterSiteBuilderPlugin
Remove Minor SNP States
removeMinorSNPStates(value) - Method in class net.maizegenetics.analysis.filter.FilterSiteBuilderPlugin
Set Remove Minor SNP States. Remove Minor S N P States
removeMinorSNPStates() - Method in class net.maizegenetics.dna.snp.FilterSite
 
removeMissingObservations() - Method in class net.maizegenetics.phenotype.PhenotypeBuilder
 
removeNaN() - Method in class net.maizegenetics.analysis.distance.MultiDimensionalScalingPlugin
Remove NaNs from matrix before performing MDS
removeNaN(value) - Method in class net.maizegenetics.analysis.distance.MultiDimensionalScalingPlugin
Set Remove NaNs. Remove NaNs from matrix before performing MDS
RemoveNaNFromDistanceMatrixPlugin - Class in net.maizegenetics.analysis.distance
 
RemoveNaNFromDistanceMatrixPlugin(parentFrame, isInteractive) - Constructor for class net.maizegenetics.analysis.distance.RemoveNaNFromDistanceMatrixPlugin
 
removeParent() - Method in class net.maizegenetics.taxa.tree.SimpleNode
removes parent.
removePolyAFromEnd(s) - Static method in class net.maizegenetics.dna.BaseEncoder
Trim the poly-A off the sequence string
removeProgressUnit(unit) - Method in class net.maizegenetics.progress.ProgressPanel
 
removeRareTag(minCutoff) - Method in class net.maizegenetics.dna.tag.TagCountMutable
 
removeSeqAfterSecondCutSite(seq, maxLength) - Static method in class net.maizegenetics.analysis.gbs.ParseBarcodeRead
The barcode libraries used for this study can include two types of extraneous sequence at the end of reads. The first are chimeras created with the free ends. These will recreate the restriction site. The second are short regions (less than 64bp), so that will they will contain a portion of site and the universal adapter. This finds the first of site in likelyReadEnd, keeps the restriction site overhang and then sets everything to polyA afterwards
removeSeqAfterSecondCutSite(seq, maxLength, tagLengthInLong, taxaName, ifForward) - Method in class net.maizegenetics.analysis.gbs.PEParseBarcodeRead
Remove the sequence of the second cutsite
removeSitesBasedOnFreqIgnoreMissing(aa, minimumProportion, maximumProportion, minimumCount) - Static method in class net.maizegenetics.dna.snp.GenotypeTableUtils
remove sites based on minimum frequency (the count of good bases, INCLUDING GAPS) and based on the proportion of good alleles (including gaps) different from consensus
RemoveSitesThatDoNotMatchMinMaj(donorFile, unimp, verboseOutput) - Static method in class net.maizegenetics.analysis.imputation.FILLINDonorGenotypeUtils
Remove sites in Donor and Unimp that don't match minMaj. Assumes same coordinate system. Designed to match sites between GBS and hapmap. Removes sites where minMaj is indel. Keeps sites with same minMaj even if third allele differs.
removeSitesWithIndels() - Method in class net.maizegenetics.analysis.filter.FilterSiteBuilderPlugin
Removes sites containing an indel (+ or -)
removeSitesWithIndels(value) - Method in class net.maizegenetics.analysis.filter.FilterSiteBuilderPlugin
Set Remove Sites With Indels. Removes sites containing an indel (+ or -)
removeSitesWithIndels() - Method in class net.maizegenetics.dna.snp.FilterSite
 
removeSpecificAnnotations(baseTaxaList, annotationsToRemove) - Static method in class net.maizegenetics.taxa.TaxaListIOUtils
Creates a new taxa list with the taxa retaining annotations EXCEPT those specified by the list. All taxa are retained, only the annotations are changed.
removeSynonyms(rowNumber) - Method in class net.maizegenetics.taxa.IdentifierSynonymizer
 
removeTagByCount(minCnt) - Method in class net.maizegenetics.analysis.gbs.repgen.RepGenLoadSeqToDBPlugin.TagCountQualityScoreMap
 
removeTaxa(taxaToRemove) - Method in class net.maizegenetics.phenotype.PhenotypeBuilder
 
removeTerm(termNumber) - Method in class net.maizegenetics.stats.linearmodels.LinearModelForStepwiseRegression
 
reorderColumns(newIndices) - Method in interface net.maizegenetics.util.SuperByteMatrix
Reorders columns of this matrix based on the given indices.
reorderColumns(newIndices) - Method in class net.maizegenetics.util.SuperByteMatrixMultiple
 
reorderColumns(newIndices) - Method in class net.maizegenetics.util.SuperByteMatrixSingle
 
reorderColumns(newIndices) - Method in class net.maizegenetics.util.SuperByteMatrixSingleValue
 
reorderColumns(newIndices) - Method in class net.maizegenetics.util.SuperByteMatrixTranspose
 
reorderPositions(newIndices) - Method in class net.maizegenetics.dna.snp.byte2d.Byte2DBuilder
 
reorderPositions(newIndices) - Method in class net.maizegenetics.dna.snp.genotypecall.GenotypeCallTableBuilder
 
reorderPositions(newIndices) - Method in class net.maizegenetics.dna.snp.score.AlleleDepthBuilder
 
reorderRows(newIndices) - Method in interface net.maizegenetics.util.SuperByteMatrix
Reorders rows of this matrix based on the given indices.
reorderRows(newIndices) - Method in class net.maizegenetics.util.SuperByteMatrixMultiple
 
reorderRows(newIndices) - Method in class net.maizegenetics.util.SuperByteMatrixSingle
 
reorderRows(newIndices) - Method in class net.maizegenetics.util.SuperByteMatrixSingleValue
 
reorderRows(newIndices) - Method in class net.maizegenetics.util.SuperByteMatrixTranspose
 
reorderTaxa(newIndices) - Method in class net.maizegenetics.dna.snp.genotypecall.GenotypeCallTableBuilder
 
repeatFilter(rbt, ratio) - Method in class net.maizegenetics.analysis.gbs.Clusters
 
repeatLibraryFilter(rbt, TagSeqS, repeatlibS) - Method in class net.maizegenetics.analysis.gbs.Clusters
 
RepGenAlignerPlugin - Class in net.maizegenetics.analysis.gbs.repgen
This plugin takes an existing repGen db, grabs the tags whose depth meets that specified in the minCount parameter, makes kmer seeds from these tags. Window for kmer seeds is default 20. The ref genome is walked with a sliding window of 1. Reference tags are created based on peaks within clusters where kmer seeds align. The kmerLen field should match the length of the kmers stored as tags during the RepGenLoadSeqToDBPlugin step. The default is 150. The refKmerLen() should minimally be the length of the db kmer tags, but can be longer. Our defaults are 150 for kmer tags, and twice this length (300) for the refKmerLen. There are 2 count parameters: minTagCount specifies the minimum depth of a tag for it to be used when creating seed kmers. minHitCount specifies the number of "hits" that must occur within a sliding window (window size = refKmerLen) for the window to remain part of a cluser. When sliding, if the hit count drops below the minhitCount threshold, the cluster ends. A new cluster does not begin until the hit count is back up to threshold. See createRefTagsForAlignment() and storeRefTagPositions() for specifics. This plugin creates and stores the reference tags in the refTag table in the database. Both the tagMapping and the physicalMapPosition table will we populated with the reference tag information. Once the tables have been populated with the reference information, Smith Waterman is run to align all the nonreference tags in the db against each other; each non-reference tag against the reference tags; finally each refTag against all other refTags. ALignment data is stored in the tagAlignments table. Smith Waterman from SourceForge neobio project is used to determine alignment score. Settings for match rewards, mismatch penalty and gap penalty may be changed by user via plugin parameters.
RepGenAlignerPlugin() - Constructor for class net.maizegenetics.analysis.gbs.repgen.RepGenAlignerPlugin
 
RepGenAlignerPlugin(parentFrame) - Constructor for class net.maizegenetics.analysis.gbs.repgen.RepGenAlignerPlugin
 
RepGenAlignerPlugin(parentFrame, isInteractive) - Constructor for class net.maizegenetics.analysis.gbs.repgen.RepGenAlignerPlugin
 
RepGenData - Interface in net.maizegenetics.dna.tag
 
RepGenDataWriter - Interface in net.maizegenetics.dna.tag
 
RepGenLDAnalysisPlugin - Class in net.maizegenetics.analysis.gbs.repgen
This class takes a rAmpSeq (formerly RepGen) database and for each tag in the tag table, performs the following tag-tag correlations based on the taxa distribution for each tag (1) tag-tag Pearson's correlation (2) tag-tag Spearman's correlation (3) tag-tag presence/absence correlations (4) r-squared The vectors presented to the analysis methods represent a list of taxa and the number of times the tag was seen in that taxa. The presence/absence vectors have a 1 or 0 as values in each slot.
RepGenLDAnalysisPlugin() - Constructor for class net.maizegenetics.analysis.gbs.repgen.RepGenLDAnalysisPlugin
 
RepGenLDAnalysisPlugin(parentFrame) - Constructor for class net.maizegenetics.analysis.gbs.repgen.RepGenLDAnalysisPlugin
 
RepGenLDAnalysisPlugin(parentFrame, isInteractive) - Constructor for class net.maizegenetics.analysis.gbs.repgen.RepGenLDAnalysisPlugin
 
RepGenLoadSeqToDBPlugin - Class in net.maizegenetics.analysis.gbs.repgen
Develops a discovery rGBS database based on a folder of sequencing files Keeps only good reads having no N's in the useful part of the sequence. Trims off the barcodes and truncates sequences that (1) have a second cut site, or (2) read into the common adapter. Originally the reference throughout was to "tag". This is being changed to "kmer" as the pipeline is a kmer alignment process.
RepGenLoadSeqToDBPlugin() - Constructor for class net.maizegenetics.analysis.gbs.repgen.RepGenLoadSeqToDBPlugin
 
RepGenLoadSeqToDBPlugin(parentFrame, isInteractive) - Constructor for class net.maizegenetics.analysis.gbs.repgen.RepGenLoadSeqToDBPlugin
 
RepGenLoadSeqToDBPlugin.TagCountQualityScoreMap - Class in net.maizegenetics.analysis.gbs.repgen
 
RepGenPhase2AlignerPlugin - Class in net.maizegenetics.analysis.gbs.repgen
This plugin takes an existing repGen db, grabs the tags whose depth meets that specified in the minCount parameter, makes kmer seeds from these tags. Forward and reverse primer sequences are added as an input parameter. When a kmer seed is found on a reference chromosome, a ref sequence is created from 300bp before the hit, to 300 bp after the hit. This value is half the refKmerLen parameter passed by user. Default refKmerLen is 600. From the ref sequence created, a search is made for the primer pairs within this sequence. IF either both forward primer and the reverse complement of the reverse primer; or reverse primer and the reverse complement of the forward primer are found, a reference tag is created starting at the start of the first occurring primer from the primer pair found in the sequence. If both forward and reverse pairs are found, the ref tag is created based on the best match, defaulting to the forward primer if both are found. Search for additional kmer matches on the chromosome begins at the position on the ref chrom following the end of the second primer in the matched pair. The kmerLen field should match the length of the kmers stored as tags during the RepGenLoadSeqToDBPlugin step. The default is 150. The refKmerLen() should minimally be the length of the db kmer tags, but can be longer. Our defaults are 150 for kmer tags, and twice this length (300) for the refKmerLen. There are 2 count parameters: minTagCount specifies the minimum depth of a tag for it to be used when creating seed kmers. This plugin creates and stores the reference tags in the refTag table in the database. Both the tagMapping and the physicalMapPosition table will we populated with the reference tag information. Once the tables have been populated with the reference information, Smith Waterman is run to align all the nonreference tags in the db against each other; each non-reference tag against the reference tags; finally each refTag against all other refTags. ALignment data is stored in the tagAlignments table. Smith Waterman from SourceForge neobio project is used to determine alignment score. Settings for match rewards, mismatch penalty and gap penalty may be changed by user via plugin parameters.
RepGenPhase2AlignerPlugin() - Constructor for class net.maizegenetics.analysis.gbs.repgen.RepGenPhase2AlignerPlugin
 
RepGenPhase2AlignerPlugin(parentFrame) - Constructor for class net.maizegenetics.analysis.gbs.repgen.RepGenPhase2AlignerPlugin
 
RepGenPhase2AlignerPlugin(parentFrame, isInteractive) - Constructor for class net.maizegenetics.analysis.gbs.repgen.RepGenPhase2AlignerPlugin
 
RepGenPhase2AlignerPlugin.BestScore - Enum in net.maizegenetics.analysis.gbs.repgen
 
RepGenSQLite - Class in net.maizegenetics.dna.tag
 
RepGenSQLite(filename) - Constructor for class net.maizegenetics.dna.tag.RepGenSQLite
 
rephase() - Method in class net.maizegenetics.analysis.imputation.ImputeProgenyStatesPlugin
If true, rephase parents before imputing. If false, input haplotypes from file.
rephase(value) - Method in class net.maizegenetics.analysis.imputation.ImputeProgenyStatesPlugin
Set Rephase Parents First. If true, rephase parents before imputing. If false, input haplotypes from file.
RephaseParents - Class in net.maizegenetics.analysis.imputation
 
RephaseParents() - Constructor for class net.maizegenetics.analysis.imputation.RephaseParents
 
RephaseParents(originalGenotypes, phasedProgeny, plotList, parentHapmap) - Constructor for class net.maizegenetics.analysis.imputation.RephaseParents
 
RephaseParents(originalGenotypes, phasedProgeny, parentage, parentHaps) - Constructor for class net.maizegenetics.analysis.imputation.RephaseParents
 
replaceFeature(feature) - Method in class net.maizegenetics.dna.map.GenomeFeatureMapBuilder
Replaces the GenomeFeature with a specified ID with a new one. If unique ID isn't already in the map, it throws an UnsupportedOperationException.
replaceHDF5GenotypesCalls(h5w, taxon, calls) - Static method in class net.maizegenetics.util.HDF5Utils
 
replaceHDF5GenotypesCalls(h5w, taxon, startSite, calls) - Static method in class net.maizegenetics.util.HDF5Utils
 
replaceHDF5GenotypesDepth(h5w, taxon, depth) - Static method in class net.maizegenetics.util.HDF5Utils
 
replaceInNames(regex, replacement, inputFileName, format, outputFileName) - Static method in class net.maizegenetics.dna.tag.TagsByTaxaUtils
Replaces the supplied regex with the supplied string in taxon names.
replaceTaxonAnnotations(h5w, modifiedTaxon) - Static method in class net.maizegenetics.util.HDF5Utils
 
report() - Method in class net.maizegenetics.analysis.association.PhenotypeLM
 
report(out) - Method in class net.maizegenetics.taxa.IdentifierSynonymizer
 
report(out) - Method in class net.maizegenetics.taxa.tree.SimpleTree
 
report(tree, out) - Static method in class net.maizegenetics.taxa.tree.TreeUtils
 
reportAllSitesGWASStatus(outFile, minAlleleFreq, maxAlleleFreq, delimiter) - Method in class net.maizegenetics.dna.pd.PDReport
 
reportBuilder - Variable in class net.maizegenetics.analysis.association.PhenotypeLM
 
reportBuilder - Variable in class net.maizegenetics.analysis.imputation.BiparentalHaplotypeFinder
 
ReportDestinationDialog - Class in net.maizegenetics.gui
 
ReportDestinationDialog() - Constructor for class net.maizegenetics.gui.ReportDestinationDialog
Creates a dialog that allows the user to send results to a file rather than to save them to memory. Very large output sets can fill up memory and cause TASSEL to crash otherwise.
reportFilename() - Method in class net.maizegenetics.analysis.association.FastMultithreadedAssociationPlugin
The name of the file to which these results will be saved.
reportFilename(value) - Method in class net.maizegenetics.analysis.association.FastMultithreadedAssociationPlugin
Set Output File. The name of the file to which these results will be saved.
required(required) - Method in class net.maizegenetics.plugindef.PluginParameter.Builder
 
required() - Method in class net.maizegenetics.plugindef.PluginParameter
 
reroot(num) - Method in class net.maizegenetics.taxa.tree.SimpleTree
make node with number num to root node
reroot(node) - Method in class net.maizegenetics.taxa.tree.SimpleTree
make provided node the root node
reroot(tree, node) - Static method in class net.maizegenetics.taxa.tree.TreeUtils
a tree that has been re-rooted at the given internal node. The original root of the tree must have had at least 3 children.
res - Variable in class net.maizegenetics.stats.EMMA.EMMAforDoubleMatrix
 
resampleProportion() - Method in class net.maizegenetics.analysis.modelfitter.ResamplingGWASPlugin
The size of the sample is resample proportion times the number of observations in the complete data. For bootstrap, set this value to 1 and with replacement to true. (Default = 0.8)
resampleProportion(value) - Method in class net.maizegenetics.analysis.modelfitter.ResamplingGWASPlugin
Set Resample Proportion. The size of the sample is resample proportion times the number of observations in the complete data. For bootstrap, set this value to 1 and with replacement to true. (Default = 0.8)
ResamplingGWASPlugin - Class in net.maizegenetics.analysis.modelfitter
 
ResamplingGWASPlugin(parentFrame, isInteractive) - Constructor for class net.maizegenetics.analysis.modelfitter.ResamplingGWASPlugin
 
rescanAlpha - Variable in class net.maizegenetics.analysis.modelfitter.StepwiseAdditiveModelFitter
 
reset() - Method in class net.maizegenetics.analysis.data.CombineDataSetsPlugin
 
reset() - Static method in class net.maizegenetics.stats.linearmodels.BasicShuffler
 
reset() - Method in interface net.maizegenetics.stats.math.OrderEnumerator
Reset back to starting state, may have a differnet number of values, and a different ordering after a reset!
reset() - Method in class net.maizegenetics.taxa.tree.SimpleNode
 
resetCounters() - Method in interface net.maizegenetics.dna.map.GVCFGenomeSequence
 
resetModel(phenotypeIndex, enterLimit, maxVariants) - Method in class net.maizegenetics.analysis.modelfitter.AbstractForwardRegression
 
resetModel(phenotypeIndex, enterLimit, maxVariants) - Method in interface net.maizegenetics.analysis.modelfitter.ForwardRegression
This method resets the fitted model to the base model and sets the index of the trait to be fit.
resetTable() - Method in class net.maizegenetics.gui.AlignmentTableModel
Resets the table backing this matrix table model to an empty table.
resetTable() - Method in class net.maizegenetics.gui.TableReportNoPagingTableModel
Resets the table backing this matrix table model to an empty table.
resetTempTaxaList() - Method in class net.maizegenetics.taxa.IdentifierSynonymizer
 
resolveRefSorted(sortedAlleles, refAllele) - Static method in class net.maizegenetics.dna.snp.io.VCFUtil
 
resolveSortedAndKnownVariantsExport(sortedAllelesInput, knownVariantsInput) - Static method in class net.maizegenetics.dna.snp.io.VCFUtil
 
resolveVCFGeno(alleles, allelesInTaxa, tx) - Static method in class net.maizegenetics.dna.snp.io.VCFUtil
 
resolveVCFGeno(alleles, alleleDepth) - Static method in class net.maizegenetics.dna.snp.io.VCFUtil
 
restoreBranch(node) - Static method in class net.maizegenetics.taxa.tree.NodeUtils
restore internal branch
restoreOddColumns(original_numcols) - Method in class net.maizegenetics.analysis.gbs.neobio.Smawk
Restores the col array of indexes to the state it was before the deleteOddColumns method was called. It only needs to know how many columns there was originally. The indexes that were moved to the end of the array are restored to their original position.
restorePhasedHaplotypes(restorePath) - Static method in class net.maizegenetics.analysis.imputation.ImputationUtils
 
restorePhasedHaplotypes(restorePath) - Static method in class net.maizegenetics.analysis.imputation.SelfedHaplotypeFinder
 
restoreRows(original_numrows) - Method in class net.maizegenetics.analysis.gbs.neobio.Smawk
Restores the row array of indexes to the state it was before the reduce method was called. It only needs to know how many rows there was originally. The indexes that were moved to the end of the array are restored to their original position.
ResultSetIterator - Class in net.maizegenetics.util.db
Result Set Iterator User: julian3 Date: Time: PROJECT: ${PROJECT} DESCRIPTION: Code Borrowed from http://java.dzone.com/articles/adding-java-8-lambda-goodness Original package can be downloaded from https://github.com/jexenberger/lambda-tuples
ResultSetIterator(connection, sql) - Constructor for class net.maizegenetics.util.db.ResultSetIterator
 
ResultSetProcessor - Interface in net.maizegenetics.util.db
Result Set Processor User: julian3 Date: Time: PROJECT: ${PROJECT} DESCRIPTION: Code Borrowed from http://java.dzone.com/articles/adding-java-8-lambda-goodness Original package can be downloaded from https://github.com/jexenberger/lambda-tuples
RETAIN_RARE_ALLELES - Static variable in class net.maizegenetics.dna.snp.HapMapHDF5Constants
 
retainAll(c) - Method in class net.maizegenetics.analysis.avro.GenericArrayPositions
 
retainAll(c) - Method in class net.maizegenetics.analysis.avro.GenericArrayTaxa
 
retainAll(c) - Method in class net.maizegenetics.dna.snp.FilterList
 
retainAll(c) - Method in class net.maizegenetics.util.UndirectedGraph.UndirectedSet
 
retainRareAlleles() - Method in class net.maizegenetics.tassel.PreferencesDialog
Retain Rare Alleles
retainRareAlleles(value) - Method in class net.maizegenetics.tassel.PreferencesDialog
Set Retain Rare Alleles. Retain Rare Alleles
retainSpecificAnnotations(baseTaxaList, annotationsToKeep) - Static method in class net.maizegenetics.taxa.TaxaListIOUtils
Creates a new taxa list with the taxa only retaining annotations within a specified list. All taxa are retained, only the annotations are changed.
retainsRareAlleles() - Method in class net.maizegenetics.dna.snp.CombineGenotypeTable
 
retainsRareAlleles() - Method in class net.maizegenetics.dna.snp.CoreGenotypeTable
 
retainsRareAlleles() - Method in interface net.maizegenetics.dna.snp.genotypecall.GenotypeCallTable
Returns true if this Alignment retains rare alleles. If false, rare alleles are recorded as unknown.
retainsRareAlleles() - Method in interface net.maizegenetics.dna.snp.GenotypeTable
Returns true if this genotype table retains rare alleles. If false, rare alleles are recorded as unknown.
retainsRareAlleles() - Method in class net.maizegenetics.dna.snp.MergedGenotypeTable
 
retainsRareAlleles() - Method in class net.maizegenetics.dna.snp.TOPMGenotypeTable
 
returnAverageQuality(phredScale) - Method in class net.maizegenetics.dna.read.Read
Return average quality value of read
returnEigenvalues() - Method in class net.maizegenetics.analysis.data.PrincipalComponentsPlugin
Returns a list of eigenvalues sorted high to low.
returnEigenvalues(value) - Method in class net.maizegenetics.analysis.data.PrincipalComponentsPlugin
Set Return Eigenvalues. Returns a list of eigenvalues sorted high to low.
returnEigenvectors() - Method in class net.maizegenetics.analysis.data.PrincipalComponentsPlugin
Returns the eigenvectors calculated from a Singular Value Decomposition of the data. The resulting table can be quite large if the number of variants and taxa are big.
returnEigenvectors(value) - Method in class net.maizegenetics.analysis.data.PrincipalComponentsPlugin
Set Return Eigenvectors. Returns the eigenvectors calculated from a Singular Value Decomposition of the data. The resulting table can be quite large if the number of variants and taxa are big.
ReturnHaplotype - Static variable in class net.maizegenetics.analysis.clustering.HaplotypeCluster
The TYPE used to represent all HaplotypeClusters
revComplement(seq) - Static method in class net.maizegenetics.analysis.gbs.DiscoverySNPCallerPlugin
 
reverse() - Method in class net.maizegenetics.analysis.avro.GenericArrayPositions
 
reverse() - Method in class net.maizegenetics.analysis.avro.GenericArrayTaxa
 
reverseComplement(tag) - Static method in class net.maizegenetics.dna.tag.TagBuilder
 
reverseComplementAlleleByteArray(alleles) - Static method in class net.maizegenetics.dna.snp.NucleotideAlignmentConstants
Convert a haploid (allele) string (e.g. {0,1,2,3,0}) to its reverse complement (e.g. {3,0,1,2,3})
reverseOrder(array) - Static method in class net.maizegenetics.analysis.imputation.ImputationUtils
 
reversep() - Method in class net.maizegenetics.analysis.gbs.repgen.RampSeqAlignFromBlastTags
String containing the reverse primer sequence.
reversep(value) - Method in class net.maizegenetics.analysis.gbs.repgen.RampSeqAlignFromBlastTags
Set Reverse Primer. String containing the reverse primer sequence.
reverseTrace(indent) - Method in class net.maizegenetics.plugindef.AbstractPlugin
 
reverseTranslateIndex(index) - Method in class net.maizegenetics.dna.snp.TranslateIndex
Translates base index to this index. This class has no translation.
reverseTranslateIndex(index) - Method in class net.maizegenetics.dna.snp.TranslateIndexRange
 
reverseTranslateIndex(index) - Method in class net.maizegenetics.dna.snp.TranslateIndexRedirect
Translates base index to this index. Uses binary search algorithm since indices are ordered.
reverseTranslateIndex(index) - Method in class net.maizegenetics.dna.snp.TranslateIndexRedirectUnordered
Translates base index to this index. Searches all indices since not ordered.
revg2sweep(column) - Method in class net.maizegenetics.stats.linearmodels.SweepFast
 
RGBSProductionSNPCallerPlugin - Class in net.maizegenetics.analysis.gbs.repgen
This plugin converts all of the fastq (and/or qseq) files in the input folder and keyfile to genotypes and adds these to a genotype file in HDF5 format. We refer to this step as the "Production Pipeline". The output format is either HDF5 or VCF genotypes with allelic depth stored. Output file type is determined by presence of the ".h5" suffix. SNP calling is quantitative with the option of using either the Glaubitz/Buckler binomial method (pHet/pErr > 1 = het) (=default), or the Stacks method. Merging of samples with the same LibraryPrepID is handled by GenotypeTableBuilder.addTaxon(), with the genotypes re-called based upon the new depths. Therefore, if you want to keep adding genotypes to the same target HDF5 file in subsequent runs, use the -ko (keep open) option so that the output GenotypeTableBuilder will be mutable, using closeUnfinished() rather than build(). If the target output is HDF5, and that GenotypeTable file doesn't exist, it will be created. Each taxon in the output file is named "ShortName:LibraryPrepID" and is annotated with "Flowcell_Lanes" (=source seq data for current genotype). Requires a database with variants added from a previous "Discovery Pipeline" run. References to "tag" are being replaced by references to "kmer" as the pipeline is really a kmer alignment process. TODO add the Stacks likelihood method to BasicGenotypeMergeRule
RGBSProductionSNPCallerPlugin() - Constructor for class net.maizegenetics.analysis.gbs.repgen.RGBSProductionSNPCallerPlugin
 
RGBSProductionSNPCallerPlugin(parentFrame, isInteractive) - Constructor for class net.maizegenetics.analysis.gbs.repgen.RGBSProductionSNPCallerPlugin
 
RidgeRegressionEmmaPlugin - Class in net.maizegenetics.analysis.association
 
RidgeRegressionEmmaPlugin(parentFrame, isInteractive) - Constructor for class net.maizegenetics.analysis.association.RidgeRegressionEmmaPlugin
 
RNADeMultiplexProductionPlugin - Class in net.maizegenetics.analysis.rna
 
RNADeMultiplexProductionPlugin() - Constructor for class net.maizegenetics.analysis.rna.RNADeMultiplexProductionPlugin
 
RNADeMultiplexProductionPlugin(parentFrame, isInteractive) - Constructor for class net.maizegenetics.analysis.rna.RNADeMultiplexProductionPlugin
 
RNADeMultiPlexSeqToDBPlugin - Class in net.maizegenetics.analysis.rna
 
RNADeMultiPlexSeqToDBPlugin() - Constructor for class net.maizegenetics.analysis.rna.RNADeMultiPlexSeqToDBPlugin
 
RNADeMultiPlexSeqToDBPlugin(parentFrame) - Constructor for class net.maizegenetics.analysis.rna.RNADeMultiPlexSeqToDBPlugin
 
RNADeMultiPlexSeqToDBPlugin(parentFrame, isInteractive) - Constructor for class net.maizegenetics.analysis.rna.RNADeMultiPlexSeqToDBPlugin
 
ROOT - Static variable in class net.maizegenetics.dna.snp.HapMapHDF5Constants
 
ROOT - Static variable in class net.maizegenetics.dna.tag.GBSHDF5Constants
 
ROOT - Static variable in class net.maizegenetics.util.Tassel5HDF5Constants
 
root_factor - Variable in class net.maizegenetics.analysis.gbs.neobio.FactorSequence
A pointer to the root factor, the one that starts the list of factors.
RootedTreeUtils - Class in net.maizegenetics.taxa.tree
This class contains utility methods. These include:
1. gathering information about subtrees from a set of trees
2. comparing subtrees and clades.
All these methods assume rooted trees!
rotateByLeafCount(tree) - Static method in class net.maizegenetics.taxa.tree.TreeUtils
Rotates branches by leaf count. WARNING: assumes binary tree!
row - Variable in class net.maizegenetics.analysis.gbs.neobio.Smawk
An array of row indexes reflecting the current state of the matrix. When rows are deleted, the corresponding indexes are simply moved to the end of the vector.
row(i) - Method in class net.maizegenetics.matrixalgebra.Matrix.BlasDoubleMatrix
 
row(i) - Method in class net.maizegenetics.matrixalgebra.Matrix.ColtDoubleMatrix
 
row(i) - Method in interface net.maizegenetics.matrixalgebra.Matrix.DoubleMatrix
 
row(i) - Method in class net.maizegenetics.matrixalgebra.Matrix.EJMLDoubleMatrix
 
row_codes - Variable in class net.maizegenetics.analysis.gbs.neobio.ScoringMatrix
Stores matrix row headers in the order they were found.
row_position - Variable in class net.maizegenetics.analysis.gbs.neobio.Smawk
This array is used to store for each row of the original matrix, its index in the current state of the matrix, i.e. its index in the row array.
rowAsTuple(sql, rs) - Static method in class net.maizegenetics.util.db.SQL
 
RowHeaderRenderer - Class in net.maizegenetics.gui
 
RowHeaderRenderer(table) - Constructor for class net.maizegenetics.gui.RowHeaderRenderer
 
rowStart - Variable in class net.maizegenetics.analysis.gbs.neobio.PairwiseAlignment
Basically, the longer sequence is stored in rows, the shorter on is stored in the columns. The beginning ROW of matrix that was aligned. If seq1 is the same length or shorter then seq2, this correlates to the position on seq2 where alignment started. If seq2 is shorter than seq1, this correlates to the position on seq1 where alignment started.
rowSum(row) - Method in class net.maizegenetics.matrixalgebra.Matrix.BlasDoubleMatrix
 
rowSum(row) - Method in class net.maizegenetics.matrixalgebra.Matrix.ColtDoubleMatrix
 
rowSum(row) - Method in interface net.maizegenetics.matrixalgebra.Matrix.DoubleMatrix
 
rowSum(row) - Method in class net.maizegenetics.matrixalgebra.Matrix.EJMLDoubleMatrix
 
Rsq - Variable in class net.maizegenetics.stats.EMMA.EMMAforDoubleMatrix
 
RSQUARE - Static variable in class net.maizegenetics.analysis.popgen.LinkageDisequilibriumComponent
 
run() - Method in class net.maizegenetics.analysis.popgen.LinkageDisequilibrium
starts the thread to calculate LD
run() - Method in class net.maizegenetics.gui.PrintHeapAction
Method executed when this thread starts that removes all items from the associated tree.
run() - Method in class net.maizegenetics.plugindef.AbstractPlugin
 
run() - Method in class net.maizegenetics.plugindef.ThreadedPluginListener
 
runAnalysis() - Method in class net.maizegenetics.analysis.modelfitter.StepwiseAddDomModelFitter
 
runAnalysis() - Method in class net.maizegenetics.analysis.modelfitter.StepwiseAdditiveModelFitter
This is called to run the analysis
runAnalysis() - Method in class net.maizegenetics.analysis.modelfitter.StepwiseOLSModelFitter
 
runDiscoverySNPCallerPlugin() - Static method in class net.maizegenetics.analysis.gbs.TerryPipelines
 
runFindMergeHaplotypes(inFile, exportFile, errorExportFile, maxDistance, minSites, appoxSitesPerHaplotype) - Method in class net.maizegenetics.analysis.imputation.FindMergeHaplotypesPlugin
Produces donor haplotypes that can be used for imputation.
runPermutationTest() - Method in class net.maizegenetics.analysis.modelfitter.StepwiseAddDomModelFitter
 
runPermutationTest() - Method in class net.maizegenetics.analysis.modelfitter.StepwiseAdditiveModelFitter
 
runPermutationTestNoMissingData() - Method in class net.maizegenetics.analysis.modelfitter.StepwiseOLSModelFitter
 
runPlugin(input) - Method in class net.maizegenetics.analysis.association.EqtlAssociationPlugin
Convenience method to run plugin with one return object.
runPlugin(input) - Method in class net.maizegenetics.analysis.association.FastMultithreadedAssociationPlugin
Convenience method to run plugin with one return object.
runPlugin(input) - Method in class net.maizegenetics.analysis.association.GenomicSelectionPlugin
Convenience method to run plugin with one return object.
runPlugin(input) - Method in class net.maizegenetics.analysis.b4r.GetPhenotypeFromB4RPlugin
Convenience method to run plugin with one return object.
runPlugin(filename) - Static method in class net.maizegenetics.analysis.data.FileLoadPlugin
 
runPlugin(input) - Method in class net.maizegenetics.analysis.data.GenomeAnnosDBQueryToPositionListPlugin
Convenience method to run plugin with one return object.
runPlugin(input) - Method in class net.maizegenetics.analysis.data.GenosToABHPlugin
Convenience method to run plugin with one return object.
runPlugin(genotype) - Method in class net.maizegenetics.analysis.data.GenotypeSummaryPlugin
Convenience method to run plugin with one return object.
runPlugin(genotype) - Method in class net.maizegenetics.analysis.data.GenotypeToAdditiveValuesPlugin
 
runPlugin(input) - Method in class net.maizegenetics.analysis.data.MaskGenotypePlugin
Convenience method to run plugin with one return object.
runPlugin(inputGenos) - Method in class net.maizegenetics.analysis.data.MergeRenameDeleteTaxaPlugin
Convenience method to run plugin with input and output GenotypeTable objects (rather than DataSets)
runPlugin(input) - Method in class net.maizegenetics.analysis.data.MergeRenameDeleteTaxaPlugin
Convenience method to run plugin.
runPlugin(input) - Method in class net.maizegenetics.analysis.data.PlinkLoadPlugin
Convenience method to run plugin with one return object.
runPlugin(input) - Method in class net.maizegenetics.analysis.data.PrincipalComponentsPlugin
Convenience method to run plugin with one return object.
runPlugin(input) - Method in class net.maizegenetics.analysis.data.ProjectionLoadPlugin
Convenience method to run plugin with one return object.
runPlugin(input) - Method in class net.maizegenetics.analysis.data.ProjectPcsAndRunModelSelectionPlugin
Convenience method to run plugin with one return object.
runPlugin(inputGenos) - Method in class net.maizegenetics.analysis.data.SetLowDepthGenosToMissingPlugin
Convenience method to run plugin with input and output GenotypeTable objects (rather than DataSets)
runPlugin(input) - Method in class net.maizegenetics.analysis.data.ThinSitesByPositionPlugin
Convenience method to run plugin with one return object.
runPlugin(input) - Method in class net.maizegenetics.analysis.distance.KinshipPlugin
Convenience method to run plugin with one return object.
runPlugin(input) - Method in class net.maizegenetics.analysis.distance.KinshipPlugin
Convenience method to run plugin with one return object.
runPlugin(matrix) - Static method in class net.maizegenetics.analysis.distance.RemoveNaNFromDistanceMatrixPlugin
 
runPlugin(input) - Static method in class net.maizegenetics.analysis.distance.RemoveNaNFromDistanceMatrixPlugin
 
runPlugin() - Method in class net.maizegenetics.analysis.filter.FilterSiteBuilderPlugin
Convenience method to run plugin with one return object.
runPlugin(input) - Method in class net.maizegenetics.analysis.filter.FilterSiteBuilderPlugin
 
runPlugin(input) - Method in class net.maizegenetics.analysis.filter.FilterSiteBuilderPlugin
 
runPlugin() - Method in class net.maizegenetics.analysis.filter.FilterTaxaBuilderPlugin
Convenience method to run plugin with one return object.
runPlugin(input) - Method in class net.maizegenetics.analysis.filter.FilterTaxaBuilderPlugin
 
runPlugin(input) - Method in class net.maizegenetics.analysis.filter.FilterTaxaBuilderPlugin
 
runPlugin(input) - Method in class net.maizegenetics.analysis.filter.FilterTaxaPropertiesPlugin
Convenience method to run plugin with one return object.
runPlugin(input) - Method in class net.maizegenetics.analysis.gbs.repgen.RGBSProductionSNPCallerPlugin
Convenience method to run plugin with one return object.
runPlugin(input) - Method in class net.maizegenetics.analysis.gbs.v2.GetTagSequenceFromDBPlugin
Convenience method to run plugin with one return object.
runPlugin(input) - Method in class net.maizegenetics.analysis.gbs.v2.ProductionSNPCallerPluginV2
Convenience method to run plugin with one return object.
runPlugin(input) - Method in class net.maizegenetics.analysis.gbs.v2.SAMToGBSdbPlugin
Convenience method to run plugin with one return object.
runPlugin(input) - Method in class net.maizegenetics.analysis.gbs.v2.SNPCutPosTagVerificationPlugin
Convenience method to run plugin with one return object.
runPlugin(input) - Method in class net.maizegenetics.analysis.gbs.v2.SNPQualityProfilerPlugin
Convenience method to run plugin with one return object.
runPlugin(input) - Method in class net.maizegenetics.analysis.gbs.v2.TagExportToFastqPlugin
Convenience method to run plugin with one return object.
runPlugin(input) - Method in class net.maizegenetics.analysis.gbs.v2.UpdateSNPPositionQualityPlugin
Convenience method to run plugin with one return object.
runPlugin(input) - Method in class net.maizegenetics.analysis.imputation.FILLINFindHaplotypesPlugin
Convenience method to run plugin with one return object.
runPlugin(input) - Method in class net.maizegenetics.analysis.imputation.FSFHapImputationPlugin
Convenience method to run plugin with one return object.
runPlugin(input) - Method in class net.maizegenetics.analysis.imputation.ImputationAccuracyPlugin
Convenience method to run plugin with one return object.
runPlugin(input) - Method in class net.maizegenetics.analysis.imputation.LDKNNiImputationHetV2Plugin
Convenience method to run plugin with one return object.
runPlugin(input) - Method in class net.maizegenetics.analysis.imputation.LDKNNiImputationHetV3Plugin
Convenience method to run plugin with one return object.
runPlugin(input) - Method in class net.maizegenetics.analysis.imputation.LDKNNiImputationPlugin
Convenience method to run plugin with one return object.
runPlugin(input) - Method in class net.maizegenetics.analysis.imputation.ReImputeUpdatedTaxaByFILLINPlugin
Convenience method to run plugin with one return object.
runPlugin(input) - Method in class net.maizegenetics.analysis.modelfitter.ResamplingGWASPlugin
Convenience method to run plugin with one return object.
runPlugin(input) - Method in class net.maizegenetics.analysis.modelfitter.StepwiseOLSModelFitterPlugin
Convenience method to run plugin with one return object.
runPlugin(input) - Method in class net.maizegenetics.analysis.numericaltransform.AvgPhenotypeByTaxaPlugin
Convenience method to run plugin with one return object.
runPlugin(input) - Method in class net.maizegenetics.analysis.numericaltransform.BoxCoxTransformationPlugin
Convenience method to run plugin with one return object.
runPlugin(input) - Method in class net.maizegenetics.analysis.numericaltransform.SubtractPhenotypeByTaxaPlugin
Convenience method to run plugin with one return object.
runPlugin(input) - Method in class net.maizegenetics.analysis.rna.LoadRNAContigsToGBSDBPlugin
Convenience method to run plugin with one return object.
runPlugin(input) - Method in class net.maizegenetics.analysis.rna.RNADeMultiplexProductionPlugin
Convenience method to run plugin with one return object.
runPlugin(input) - Method in class net.maizegenetics.analysis.tree.CreateTreePlugin
Convenience method to run plugin with one return object.
runPluginDataSet(filename) - Static method in class net.maizegenetics.analysis.data.FileLoadPlugin
 
runStep1(data, datumArray, fileOptions) - Method in class net.maizegenetics.analysis.data.SynonymizerPlugin
 
runStep2(currentData, end2end) - Method in class net.maizegenetics.analysis.data.SynonymizerPlugin
 
runStep3(data, step1Result, fileOptions) - Method in class net.maizegenetics.analysis.data.SynonymizerPlugin
 

S

S_direction - Variable in class net.maizegenetics.analysis.gbs.neobio.LocalAlignmentBlock
The direction to the source of the S-path of the new vertex of this block.
S_path_score - Variable in class net.maizegenetics.analysis.gbs.neobio.LocalAlignmentBlock
The value of the highest scoring path which starts inside the block and ends at its output border.
SAMConverterPlugin - Class in net.maizegenetics.analysis.gbs
This class can read in a CBSU TagMapFile into the gbs.TagsOnPhysicalMap data structure.
SAMConverterPlugin() - Constructor for class net.maizegenetics.analysis.gbs.SAMConverterPlugin
 
SAMConverterPlugin(parentFrame, isInteractive) - Constructor for class net.maizegenetics.analysis.gbs.SAMConverterPlugin
 
sameTaxa(node1, node2) - Static method in class net.maizegenetics.taxa.tree.RootedTreeUtils
 
sAMInputFile() - Method in class net.maizegenetics.analysis.gbs.v2.SAMToGBSdbPlugin
Name of input file in SAM text format
sAMInputFile(value) - Method in class net.maizegenetics.analysis.gbs.v2.SAMToGBSdbPlugin
Set SAM Input File. Name of input file in SAM text format
sampleNameField - Static variable in class net.maizegenetics.analysis.gbs.v2.GBSUtils
 
sampleNameField - Static variable in class net.maizegenetics.util.ConvertOldFastqToModernFormatPlugin
 
SAMToGBSdbPlugin - Class in net.maizegenetics.analysis.gbs.v2
Reads SAM file formats to determine the potential positions of Tags against the reference genome.
SAMToGBSdbPlugin() - Constructor for class net.maizegenetics.analysis.gbs.v2.SAMToGBSdbPlugin
 
SAMToGBSdbPlugin(parentFrame, isInteractive) - Constructor for class net.maizegenetics.analysis.gbs.v2.SAMToGBSdbPlugin
 
samToMultiPositionTOPMPlugin() - Method in class net.maizegenetics.analysis.gbs.pana.PanAUsageExample
 
SAMUtils - Class in net.maizegenetics.dna.tag
 
SAMWGMapConverterPlugin - Class in net.maizegenetics.analysis.gbs
This class reads in SAM mapping results tests them against an anchor map and creates a update HDF5 TOPM file
SAMWGMapConverterPlugin() - Constructor for class net.maizegenetics.analysis.gbs.SAMWGMapConverterPlugin
 
SAMWGMapConverterPlugin(parentFrame) - Constructor for class net.maizegenetics.analysis.gbs.SAMWGMapConverterPlugin
 
saveAsFile() - Method in class net.maizegenetics.analysis.association.FastMultithreadedAssociationPlugin
Should the results be saved to a file rather than stored in memory? It true, the results will be written to a file as each SNP is analyzed in order to reduce memory requirementsand the results will NOT be saved to the data tree. Default = false.
saveAsFile(value) - Method in class net.maizegenetics.analysis.association.FastMultithreadedAssociationPlugin
Set Write to file. Should the results be saved to a file rather than stored in memory? It true, the results will be written to a file as each SNP is analyzed in order to reduce memory requirementsand the results will NOT be saved to the data tree. Default = false.
saveAsFile() - Method in class net.maizegenetics.analysis.association.FixedEffectLMPlugin
Should the results be saved to a file rather than stored in memory? It true, the results will be written to a file as each SNP is analyzed in order to reduce memory requirementsand the results will NOT be saved to the data tree. Default = false.
saveAsFile(value) - Method in class net.maizegenetics.analysis.association.FixedEffectLMPlugin
Set Save to file. Should the results be saved to a file rather than stored in memory? It true, the results will be written to a file as each SNP is analyzed in order to reduce memory requirementsand the results will NOT be saved to the data tree. Default = false.
saveBinMultiBlupCounts(filename, matrix) - Static method in class net.maizegenetics.taxa.distance.WriteDistanceMatrix
 
saveBinMultiBlupMatrix(matrix, filename) - Static method in class net.maizegenetics.taxa.distance.WriteDistanceMatrix
 
saveBinMultiBlupMatrix(matrix, taxaFile, matrixFile, countFile) - Static method in class net.maizegenetics.taxa.distance.WriteDistanceMatrix
 
saveDARwinIDs(filename, taxa) - Static method in class net.maizegenetics.taxa.distance.WriteDistanceMatrix
 
saveDARwinMatrix(matrix, saveFile) - Static method in class net.maizegenetics.taxa.distance.WriteDistanceMatrix
 
saveDARwinMatrix(matrix, donFile, disFile) - Static method in class net.maizegenetics.taxa.distance.WriteDistanceMatrix
 
saveDataToFile(img, format, saveFile) - Method in class net.maizegenetics.analysis.chart.AbstractDisplayPlugin
 
saveDataToFile(comp) - Method in class net.maizegenetics.analysis.chart.AbstractDisplayPlugin
 
saveDataToFile(comp, saveFile) - Method in class net.maizegenetics.analysis.chart.AbstractDisplayPlugin
 
saveDataToFile(tr, delimit, fileExtensions) - Method in class net.maizegenetics.analysis.chart.TableDisplayPlugin
 
saveDataToFile(tr, delimit) - Method in class net.maizegenetics.analysis.chart.TableDisplayPlugin
 
saveDelimitedAlignment(theAlignment, delimit, saveFile) - Static method in class net.maizegenetics.dna.snp.ExportUtils
 
saveDelimitedDistanceMatrix(matrix, saveFile) - Static method in class net.maizegenetics.taxa.distance.WriteDistanceMatrix
 
saveDelimitedTableReport(theTableReport, saveFile) - Static method in class net.maizegenetics.util.TableReportUtils
Saves Table Report to file delimited by tabs.
saveDelimitedTableReport(theTableSource, delimit, saveFile) - Static method in class net.maizegenetics.util.TableReportUtils
Saves Table Report to file delimited by specified delimiter.
saveDelimitedTableReport(theTableSource, delimit, bw, includeHeader) - Static method in class net.maizegenetics.util.TableReportUtils
Saves Table Report to file delimited by specified delimiter.
saveDistanceMatrix() - Method in class net.maizegenetics.analysis.tree.CreateTreePlugin
Save Distance Matrix
saveDistanceMatrix(value) - Method in class net.maizegenetics.analysis.tree.CreateTreePlugin
Set Save Distance Matrix. Save Distance Matrix
saveFile() - Method in class net.maizegenetics.analysis.data.ExportPlugin
Save file as...
saveFile(value) - Method in class net.maizegenetics.analysis.data.ExportPlugin
Save file as...
saveMultiBlupIDs(filename, taxa) - Static method in class net.maizegenetics.taxa.distance.WriteDistanceMatrix
 
saveRawMultiBlupMatrix(matrix, filename) - Static method in class net.maizegenetics.taxa.distance.WriteDistanceMatrix
 
saveRawMultiBlupMatrix(matrix, taxaFile, matrixFile) - Static method in class net.maizegenetics.taxa.distance.WriteDistanceMatrix
 
saveSiteStats(siteStats) - Method in class net.maizegenetics.analysis.association.AbstractFixedEffectLM
 
saveSiteStats(siteStats) - Method in interface net.maizegenetics.analysis.association.FixedEffectLM
 
saveTempTaxaList() - Method in class net.maizegenetics.taxa.IdentifierSynonymizer
 
saveToFile - Variable in class net.maizegenetics.analysis.association.AbstractFixedEffectLM
 
SBIT - Static variable in class net.maizegenetics.dna.snp.HapMapHDF5Constants
 
scalarAdd(s) - Method in class net.maizegenetics.matrixalgebra.Matrix.BlasDoubleMatrix
 
scalarAdd(s) - Method in class net.maizegenetics.matrixalgebra.Matrix.ColtDoubleMatrix
 
scalarAdd(s) - Method in interface net.maizegenetics.matrixalgebra.Matrix.DoubleMatrix
Adds a scalar to this matrix and returns a new matrix. The original is not modified.
scalarAdd(s) - Method in class net.maizegenetics.matrixalgebra.Matrix.EJMLDoubleMatrix
 
scalarAddEquals(s) - Method in class net.maizegenetics.matrixalgebra.Matrix.BlasDoubleMatrix
 
scalarAddEquals(s) - Method in class net.maizegenetics.matrixalgebra.Matrix.ColtDoubleMatrix
 
scalarAddEquals(s) - Method in interface net.maizegenetics.matrixalgebra.Matrix.DoubleMatrix
Adds a scalar s to this matrix, replacing the original matrix with the result.
scalarAddEquals(s) - Method in class net.maizegenetics.matrixalgebra.Matrix.EJMLDoubleMatrix
 
scalarMult(s) - Method in class net.maizegenetics.matrixalgebra.Matrix.BlasDoubleMatrix
 
scalarMult(s) - Method in class net.maizegenetics.matrixalgebra.Matrix.ColtDoubleMatrix
 
scalarMult(s) - Method in interface net.maizegenetics.matrixalgebra.Matrix.DoubleMatrix
Multiplies this matrix times a scalar and returns a new matrix. The original is not modified.
scalarMult(s) - Method in class net.maizegenetics.matrixalgebra.Matrix.EJMLDoubleMatrix
 
scalarMultEquals(s) - Method in class net.maizegenetics.matrixalgebra.Matrix.BlasDoubleMatrix
 
scalarMultEquals(s) - Method in class net.maizegenetics.matrixalgebra.Matrix.ColtDoubleMatrix
 
scalarMultEquals(s) - Method in interface net.maizegenetics.matrixalgebra.Matrix.DoubleMatrix
Multiplies this matrix times a scalar s, replacing the original matrix with the result.
scalarMultEquals(s) - Method in class net.maizegenetics.matrixalgebra.Matrix.EJMLDoubleMatrix
 
scale(values) - Static method in class net.maizegenetics.stats.linearmodels.SolveByOrthogonalizing
 
scanAndFindCI() - Method in class net.maizegenetics.analysis.modelfitter.StepwiseOLSModelFitter
 
scanToFindCI() - Method in class net.maizegenetics.analysis.modelfitter.StepwiseAddDomModelFitter
 
scanToFindCI() - Method in class net.maizegenetics.analysis.modelfitter.StepwiseAdditiveModelFitter
 
SCHEMA - Static variable in class net.maizegenetics.util.db.LambdaTuplesContext
 
score - Variable in class net.maizegenetics.analysis.gbs.neobio.PairwiseAlignment
The overall score value for this alignment.
score - Variable in class net.maizegenetics.analysis.gbs.neobio.PairwiseAlignmentAlgorithm
This field stores just the score of the last pairwise alignment performed (if the score_computed flag is set to true). It is useful when just the score is needed (and not the alignment itselft). Its value is set after a successful execution of both computePairwiseAlignment or computeScore methods that subclasses must implement. If new sequences are loaded or a new scoring scheme is set, the score_computed flag is set to false, and this field's value becomes undefined.
score() - Method in class net.maizegenetics.analysis.gbs.repgen.AlignmentInfo
 
score_computed - Variable in class net.maizegenetics.analysis.gbs.neobio.PairwiseAlignmentAlgorithm
Flags whether the score of the alignment between the last two loaded sequences has already been computed. It is set to true after a successful execution of both computePairwiseAlignment or computeScore methods that subclasses must implement. It is set to falsef if new sequences are loaded or a new scoring scheme is set.
score_tag_line - Variable in class net.maizegenetics.analysis.gbs.neobio.PairwiseAlignment
The score tag line.
scoreDeletion(a) - Method in class net.maizegenetics.analysis.gbs.neobio.BasicScoringScheme
Always returns gap_cost for the deletion of any character.
scoreDeletion(a) - Method in class net.maizegenetics.analysis.gbs.neobio.PairwiseAlignmentAlgorithm
Helper method to invoke the scoreDeletion method of the scoring scheme set to this algorithm.
scoreDeletion(a) - Method in class net.maizegenetics.analysis.gbs.neobio.ScoringMatrix
Returns the score of a deletion of character a according to this scoring matrix.
scoreDeletion(a) - Method in class net.maizegenetics.analysis.gbs.neobio.ScoringScheme
Returns the score of a deletion of character a according to this scoring scheme. If this character is not recognised, an exception is raised.
scoreDeletion(a) - Method in class net.maizegenetics.analysis.gbs.SmithWaterman
 
scoreInsertion(a) - Method in class net.maizegenetics.analysis.gbs.neobio.BasicScoringScheme
Always returns gap_cost for the insertion of any character.
scoreInsertion(a) - Method in class net.maizegenetics.analysis.gbs.neobio.PairwiseAlignmentAlgorithm
Helper method to invoke the scoreInsertion method of the scoring scheme set to this algorithm.
scoreInsertion(a) - Method in class net.maizegenetics.analysis.gbs.neobio.ScoringMatrix
Returns the score of an insertion of character a according to this scoring matrix.
scoreInsertion(a) - Method in class net.maizegenetics.analysis.gbs.neobio.ScoringScheme
Returns the score of an insertion of character a according to this scoring scheme. If this character is not recognised, an exception is raised.
scoreInsertion(a) - Method in class net.maizegenetics.analysis.gbs.SmithWaterman
 
scoreMatch(s1, s2, ignoreCase, ignoreWhite, ignorePunc) - Static method in class net.maizegenetics.taxa.IdentifierSynonymizer
 
scoreSubstitution(a, b) - Method in class net.maizegenetics.analysis.gbs.neobio.BasicScoringScheme
Returns the score of a substitution of character a for character b according to this scoring scheme. It is match_reward if a equals b, mismatch_penalty otherwise.
scoreSubstitution(a, b) - Method in class net.maizegenetics.analysis.gbs.neobio.PairwiseAlignmentAlgorithm
Helper method to invoke the scoreSubstitution method of the scoring scheme set to this algorithm.
scoreSubstitution(a, b) - Method in class net.maizegenetics.analysis.gbs.neobio.ScoringMatrix
Returns the score of a substitution of character a for character b according to this scoring matrix.
scoreSubstitution(a, b) - Method in class net.maizegenetics.analysis.gbs.neobio.ScoringScheme
Returns the score of a substitution of character a for character b according to this scoring scheme. If this substitution is not defined, an exception is raised.
scoreSubstitution(a, b) - Method in class net.maizegenetics.analysis.gbs.SmithWaterman
 
scoring - Variable in class net.maizegenetics.analysis.gbs.neobio.PairwiseAlignmentAlgorithm
The scoring scheme used to compute a pairwise sequence alignment. It must be set before performing the alignment, and if a new scoring scheme is set, any alignment or score already computed is lost.
ScoringMatrix - Class in net.maizegenetics.analysis.gbs.neobio
This class implements a scoring scheme based on a substitution matrix. It is useful to represent PAM and BLOSUM family of amino acids scoring matrices. Its constructor loads such matrices from a file (or any other character stream). The following is an extract of a BLOSUM62 scoring matrix file: A R N D C Q E G H I L K M F P S T W Y V B Z X * A 4 -1 -2 -2 0 -1 -1 0 -2 -1 -1 -1 -1 -2 -1 1 0 -3 -2 0 -2 -1 0 -4 R -1 5 0 -2 -3 1 0 -2 0 -3 -2 2 -1 -3 -2 -1 -1 -3 -2 -3 -1 0 -1 -4 ... B -2 -1 3 4 -3 0 1 -1 0 -3 -4 0 -3 -3 -2 0 -1 -4 -3 -3 4 1 -1 -4 Z -1 0 0 1 -3 3 4 -2 0 -3 -3 1 -1 -3 -1 0 -1 -3 -2 -2 1 4 -1 -4 X 0 -1 -1 -1 -2 -1 -1 -1 -1 -1 -1 -1 -1 -1 -2 0 0 -2 -1 -1 -1 -1 -1 -4 * -4 -4 -4 -4 -4 -4 -4 -4 -4 -4 -4 -4 -4 -4 -4 -4 -4 -4 -4 -4 -4 -4 -4 1
ScoringMatrix(input) - Constructor for class net.maizegenetics.analysis.gbs.neobio.ScoringMatrix
Creates a new instance of a substitution matrix loaded from the character stream. The case of characters is significant when subsequently computing their score.
ScoringMatrix(input, case_sensitive) - Constructor for class net.maizegenetics.analysis.gbs.neobio.ScoringMatrix
Creates a new instance of a substitution matrix loaded from the character stream. If case_sensitive is true, the case of characters is significant when subsequently computing their score; otherwise the case is ignored.
ScoringScheme - Class in net.maizegenetics.analysis.gbs.neobio
This abstract class is the superclass of all scoring schemes. It defines basic operations that must be provided by all subclasses. Scoring schemes are used by sequence alignment algorithms to compute the score of an alignment.
ScoringScheme() - Constructor for class net.maizegenetics.analysis.gbs.neobio.ScoringScheme
Creates a new instance of an scoring scheme. The case of characters is significant when subsequently computing their score.
ScoringScheme(case_sensitive) - Constructor for class net.maizegenetics.analysis.gbs.neobio.ScoringScheme
Creates a new instance of an scoring scheme. If case_sensitive is true, the case of characters is significant when subsequently computing their score; otherwise the case is ignored.
screenPrint(rc) - Method in class net.maizegenetics.analysis.gbs.UNetworkFilter
 
screenPrintTps() - Method in class net.maizegenetics.analysis.gbs.UNetworkFilter
 
searchBiDirectional(searchBiDirectional) - Method in class net.maizegenetics.analysis.rna.FindMatchByWordHash.Builder
 
searchReverseComplement() - Method in class net.maizegenetics.analysis.rna.RNADeMultiplexProductionPlugin
Search of the reverse complements of the reference sequences
searchReverseComplement(value) - Method in class net.maizegenetics.analysis.rna.RNADeMultiplexProductionPlugin
Set Search reverse complement. Search of the reverse complements of the reference sequences
seedLen() - Method in class net.maizegenetics.analysis.gbs.repgen.RepGenAlignerPlugin
Length of seed kmers
seedLen(value) - Method in class net.maizegenetics.analysis.gbs.repgen.RepGenAlignerPlugin
Set Seed kmer length. Length of seeds to use in aligning.
seedLen() - Method in class net.maizegenetics.analysis.gbs.repgen.RepGenPhase2AlignerPlugin
Length of seed kmers
seedLen(value) - Method in class net.maizegenetics.analysis.gbs.repgen.RepGenPhase2AlignerPlugin
Set Seed kmer length. Length of seeds to use in aligning.
seedWindow() - Method in class net.maizegenetics.analysis.gbs.repgen.RepGenAlignerPlugin
Length of window between positions when creating seed from DB tags
seedWindow(value) - Method in class net.maizegenetics.analysis.gbs.repgen.RepGenAlignerPlugin
Set Seed window length. Length of window between positions when creating seed from DB tags
seedWindow() - Method in class net.maizegenetics.analysis.gbs.repgen.RepGenPhase2AlignerPlugin
Length of window between positions when creating seed from DB tags
seedWindow(value) - Method in class net.maizegenetics.analysis.gbs.repgen.RepGenPhase2AlignerPlugin
Set Seed window length. Length of window between positions when creating seed from DB tags
select(connection, sql, processor, params) - Static method in class net.maizegenetics.util.db.SQL
 
selectedFilesList() - Method in class net.maizegenetics.analysis.imputation.MergeBreakpointFilesPlugin
The name and path of a file containing the names of the breakpoint files to be merged.
selectedFilesList(value) - Method in class net.maizegenetics.analysis.imputation.MergeBreakpointFilesPlugin
Set List of files to merge. The name and path of a file containing the names of the breakpoint files to be merged.
SelectedListModel() - Constructor for class net.maizegenetics.gui.SelectFromAvailableDialog.SelectedListModel
 
selectFiles() - Method in class net.maizegenetics.analysis.imputation.MergeBreakpointFilesPlugin
Select the files to merge. Alternatively, merge all files in a directory. (Default = false)
selectFiles(value) - Method in class net.maizegenetics.analysis.imputation.MergeBreakpointFilesPlugin
Set Select Files to Merge. Select the files to merge. Alternatively, merge all files in a directory. (Default = false)
SelectFromAvailableDialog - Class in net.maizegenetics.gui
 
SelectFromAvailableDialog(frame, title, availableModel) - Constructor for class net.maizegenetics.gui.SelectFromAvailableDialog
 
SelectFromAvailableDialog.SelectedListModel - Class in net.maizegenetics.gui
 
SelectFromAvailableSitesDialog - Class in net.maizegenetics.gui
 
SelectFromAvailableSitesDialog(frame, title, availableModel) - Constructor for class net.maizegenetics.gui.SelectFromAvailableSitesDialog
 
selectionCriterion - Variable in class net.maizegenetics.analysis.modelfitter.AbstractAdditiveSite
 
selectionCriterion() - Method in class net.maizegenetics.analysis.modelfitter.AbstractAdditiveSite
 
selectionCriterion() - Method in interface net.maizegenetics.analysis.modelfitter.AdditiveSite
 
SelfedHaplotypeFinder - Class in net.maizegenetics.analysis.imputation
 
SelfedHaplotypeFinder(window, minProportionNotMissing) - Constructor for class net.maizegenetics.analysis.imputation.SelfedHaplotypeFinder
 
sendErrorMessage(text) - Method in class net.maizegenetics.tassel.TASSELMainFrame
 
sendLogToConsole() - Method in class net.maizegenetics.tassel.PreferencesDialog
Flag whether to send logging to the console.
sendLogToConsole(value) - Method in class net.maizegenetics.tassel.PreferencesDialog
Set Send Log To Console. Flag whether to send logging to the console.
sendMessage(text) - Method in class net.maizegenetics.tassel.TASSELMainFrame
 
sendMessage(subject, msg) - Method in class net.maizegenetics.util.SMTPClient
 
sendMessageWithAttachment(subject, msg, fileAttachment) - Method in class net.maizegenetics.util.SMTPClient
 
separateAlignmentIntoLoci(alignment, dataSetName) - Static method in class net.maizegenetics.analysis.data.SeparatePlugin
 
separateAlignmentIntoLoci(alignment, dataSetName, chromosomesToSeparate) - Static method in class net.maizegenetics.analysis.data.SeparatePlugin
 
separateOn(factors) - Method in class net.maizegenetics.phenotype.PhenotypeBuilder
 
SeparatePlugin - Class in net.maizegenetics.analysis.data
 
SeparatePlugin(parentFrame, isInteractive) - Constructor for class net.maizegenetics.analysis.data.SeparatePlugin
Creates a new instance of SeparatePlugin
seq - Variable in class net.maizegenetics.analysis.clustering.Haplotype
The haplotype (or genotype) sequence
seq1 - Variable in class net.maizegenetics.analysis.gbs.neobio.CrochemoreLandauZivUkelson
The first factorised sequence being aligned.
seq1 - Variable in class net.maizegenetics.analysis.gbs.neobio.NeedlemanWunsch
The first sequence of an alignment.
seq1 - Variable in class net.maizegenetics.analysis.gbs.neobio.SmithWaterman
The first sequence of an alignment.
seq1 - Variable in class net.maizegenetics.analysis.gbs.SmithWaterman
The first sequence of an alignment.
seq2 - Variable in class net.maizegenetics.analysis.gbs.neobio.CrochemoreLandauZivUkelson
The second factorised sequence being aligned.
seq2 - Variable in class net.maizegenetics.analysis.gbs.neobio.NeedlemanWunsch
The second sequence of an alignment.
seq2 - Variable in class net.maizegenetics.analysis.gbs.neobio.SmithWaterman
The second sequence of an alignment.
seq2 - Variable in class net.maizegenetics.analysis.gbs.SmithWaterman
The second sequence of an alignment.
seq2Bit() - Method in interface net.maizegenetics.dna.tag.Tag
 
seq2BitAsBytes() - Method in class net.maizegenetics.dna.tag.AbstractTag
 
seq2BitAsBytes() - Method in interface net.maizegenetics.dna.tag.Tag
 
seqDifferences(seq1, seq2, maxDivergence) - Static method in class net.maizegenetics.dna.BaseEncoder
Returns the number of bp differences between two 2-bit encoded longs. Maximum divergence is used to save time when only interested in very similar sequences.
seqDifferences(seq1, seq2) - Static method in class net.maizegenetics.dna.BaseEncoder
Returns the number of bp differences between two 2-bit encoded longs.
seqDifferencesForSubset(seq1, seq2, lengthOfComp, maxDivergence) - Static method in class net.maizegenetics.dna.BaseEncoder
Returns the number of sequencing differences between two 2-bit encoded longs. Maximum divergence is used to save time when only interested in very similar sequences.
seqlen - Variable in class net.maizegenetics.analysis.clustering.Haplotype
The length of the sequence
seqLength() - Method in class net.maizegenetics.analysis.phg.ParseGVCF.GVCFLine
Length of sequence represented by this line
seqLength() - Method in class net.maizegenetics.dna.tag.AbstractTag
 
seqLength() - Method in interface net.maizegenetics.dna.tag.Tag
 
SeqToTBTHDF5Plugin - Class in net.maizegenetics.analysis.gbs
This pipeline converts a series of fastq or qseq files to a single TagsByTaxa HDF5 file. It requires a list of existing tags (Tags object), which may come from a TagCounts file or TOPM file.
SeqToTBTHDF5Plugin() - Constructor for class net.maizegenetics.analysis.gbs.SeqToTBTHDF5Plugin
 
SeqToTBTHDF5Plugin(parentFrame, isInteractive) - Constructor for class net.maizegenetics.analysis.gbs.SeqToTBTHDF5Plugin
 
sequence - Variable in class net.maizegenetics.analysis.gbs.neobio.CharSequence
Stores the sequence as an array of characters.
sequence() - Method in class net.maizegenetics.analysis.rna.FindMatchByWordHash.Match
 
sequence() - Method in class net.maizegenetics.dna.tag.AbstractTag
 
sequence() - Method in interface net.maizegenetics.dna.tag.Tag
 
SequenceDiversityPlugin - Class in net.maizegenetics.analysis.popgen
 
SequenceDiversityPlugin(parentFrame, isInteractive) - Constructor for class net.maizegenetics.analysis.popgen.SequenceDiversityPlugin
 
sequences_loaded - Variable in class net.maizegenetics.analysis.gbs.neobio.PairwiseAlignmentAlgorithm
Flags whether sequences have been loaded. It is set to true after subclasses successfully load two sequences.
SeqViewerPanel - Class in net.maizegenetics.tassel
 
SeqViewerPanel.MyTableUI - Class in net.maizegenetics.tassel
 
serial_number - Variable in class net.maizegenetics.analysis.gbs.neobio.Factor
This factor's serial number, which indicates the order of this factor inside the linked list of factors of a text.
serializeAdditiveSites(geno, outFile) - Static method in class net.maizegenetics.analysis.modelfitter.GenotypeAdditiveSite
 
serializePhasedHaplotypes(phasedHaps, filename) - Static method in class net.maizegenetics.analysis.imputation.ImputationUtils
 
serializePhasedHaplotypes(phasedHaps, savePath) - Static method in class net.maizegenetics.analysis.imputation.SelfedHaplotypeFinder
 
set(index, element) - Method in class net.maizegenetics.analysis.avro.GenericArrayPositions
 
set(index, element) - Method in class net.maizegenetics.analysis.avro.GenericArrayTaxa
 
set(index, element) - Method in class net.maizegenetics.dna.map.PositionListBuilder
Replaces the element at the specified position in this list with the specified element.
set(index, element) - Method in class net.maizegenetics.dna.snp.FilterList
 
set(taxon, site) - Method in class net.maizegenetics.dna.snp.genotypecall.MaskedGenotypes
 
set(taxon, site) - Method in class net.maizegenetics.dna.snp.MaskMatrixBuilder
 
set(row, col, value) - Method in class net.maizegenetics.matrixalgebra.Matrix.BlasDoubleMatrix
 
set(row, col, value) - Method in class net.maizegenetics.matrixalgebra.Matrix.ColtDoubleMatrix
 
set(row, col, value) - Method in interface net.maizegenetics.matrixalgebra.Matrix.DoubleMatrix
Sets the matrix value at row, col. The coordinates are not checked to make sure they fall in the matrix.
set(row, col, value) - Method in class net.maizegenetics.matrixalgebra.Matrix.EJMLDoubleMatrix
 
set(x, y, value) - Method in class net.maizegenetics.taxa.distance.DistanceMatrixBuilder
 
set(x, y, value) - Method in class net.maizegenetics.taxa.distance.DistanceMatrixBuilder
 
set(index) - Method in interface net.maizegenetics.util.BitSet
Sets a bit, expanding the set size if necessary
set(startIndex, endIndex) - Method in interface net.maizegenetics.util.BitSet
Sets a range of bits, expanding the set size if necessary
set(row, column, value) - Method in class net.maizegenetics.util.ColumnMatrix.Builder
 
set(columns) - Method in interface net.maizegenetics.util.db.DBTuple
 
set(index) - Method in class net.maizegenetics.util.OpenBitSet
sets a bit, expanding the set size if necessary
set(startIndex, endIndex) - Method in class net.maizegenetics.util.OpenBitSet
Sets a range of bits, expanding the set size if necessary
set(row, column, value) - Method in interface net.maizegenetics.util.SuperByteMatrix
Sets value at given row and column.
set(row, column, value) - Method in class net.maizegenetics.util.SuperByteMatrixMultiple
 
set(row, column, value) - Method in class net.maizegenetics.util.SuperByteMatrixSingle
 
set(row, column, value) - Method in class net.maizegenetics.util.SuperByteMatrixSingleValue
 
set(row, column, value) - Method in class net.maizegenetics.util.SuperByteMatrixTranspose
 
set(index) - Method in class net.maizegenetics.util.UnmodifiableBitSet
 
set(startIndex, endIndex) - Method in class net.maizegenetics.util.UnmodifiableBitSet
 
setAlgorithmName(algorithm) - Method in class net.maizegenetics.analysis.imputation.WritePopulationAlignmentPlugin
 
setAlignment(pChr, pPos, ifMap, ifRef, ifUnique) - Method in class net.maizegenetics.dna.map.TagGWASMapInfo
 
setAlignmentFileType(type) - Method in class net.maizegenetics.analysis.data.ExportMultiplePlugin
 
setAlignmentFileType(type) - Method in class net.maizegenetics.analysis.data.ExportPlugin
Deprecated. 
setAlignmentFileTypes(types) - Method in class net.maizegenetics.analysis.data.ExportMultiplePlugin
 
setAll(value) - Method in interface net.maizegenetics.util.SuperByteMatrix
Sets value for all elements.
setAll(value) - Method in class net.maizegenetics.util.SuperByteMatrixMultiple
 
setAll(value) - Method in class net.maizegenetics.util.SuperByteMatrixSingle
 
setAll(value) - Method in class net.maizegenetics.util.SuperByteMatrixSingleValue
 
setAll(value) - Method in class net.maizegenetics.util.SuperByteMatrixTranspose
 
setAllVariantInfo(tagIndex, defAndOffset) - Method in class net.maizegenetics.dna.map.TagsOnPhysicalMapV3
Preferred method for setting variant information
setAllVariantInfo(tagIndex, defAndOffset) - Method in class net.maizegenetics.dna.map.TagsOnPhysMapHDF5
Preferred method for setting variant information
setAlpha(alpha) - Method in class net.maizegenetics.analysis.modelfitter.StepwiseOLSModelFitter
 
setAlternateMinorAllelesToMajor(myGenotype) - Static method in class net.maizegenetics.analysis.numericaltransform.NumericalGenotypePlugin
 
setAlternateMinorAllelesToMinor(myGenotype) - Static method in class net.maizegenetics.analysis.numericaltransform.NumericalGenotypePlugin
 
setAlternateMinorAllelesToMissing(myGenotype) - Static method in class net.maizegenetics.analysis.numericaltransform.NumericalGenotypePlugin
 
setAlternateTagMappingInfo(index, mapIndex, theTMI) - Method in class net.maizegenetics.dna.map.TagsOnPhysMapHDF5
 
setAnalyzeByColumn(analyzeByColumn) - Method in class net.maizegenetics.analysis.association.MLMPlugin
 
setAnalyzeByColumn(analyzeByColumn) - Method in class net.maizegenetics.analysis.association.WeightedMLMPlugin
 
setAnnotations(annotationsIn) - Method in class net.maizegenetics.dna.pd.SiteAnnotation
 
setAttribute(name, value) - Method in interface net.maizegenetics.taxa.tree.AttributeNode
Sets a named attribute to the given value.
setAttribute(name, value) - Method in class net.maizegenetics.taxa.tree.SimpleNode
Sets a named attribute to the given value.
setAttribute(node, name, value) - Method in class net.maizegenetics.taxa.tree.SimpleTree
Sets an named attribute for a given node.
setAttribute(node, name, value) - Method in interface net.maizegenetics.taxa.tree.Tree
Sets an named attribute for a given node.
setAverageSegmentLength(length) - Method in class net.maizegenetics.analysis.imputation.TransitionProbability
 
setBar(bar) - Method in class net.maizegenetics.analysis.chart.ChartDisplayPlugin
 
setBase(taxon, site, value) - Method in class net.maizegenetics.dna.snp.genotypecall.GenotypeCallTableBuilder
 
setBaseFile(baseFile) - Method in class net.maizegenetics.analysis.imputation.WritePopulationAlignmentPlugin
 
setBaseRangeForTaxon(taxon, startSite, value) - Method in class net.maizegenetics.dna.snp.genotypecall.GenotypeCallTableBuilder
 
setBases(data) - Method in class net.maizegenetics.dna.snp.genotypecall.GenotypeCallTableBuilder
 
setBases(data) - Method in class net.maizegenetics.dna.snp.genotypecall.GenotypeCallTableBuilder
 
setBins(bins) - Method in class net.maizegenetics.analysis.chart.ChartDisplayPlugin
 
setBits(bits) - Method in interface net.maizegenetics.util.BitSet
Expert: sets a new long[] to use as the bit storage
setBits(bits) - Method in class net.maizegenetics.util.OpenBitSet
Expert: sets a new long[] to use as the bit storage
setBits(bits) - Method in class net.maizegenetics.util.UnmodifiableBitSet
 
setBlockSchematic(blockSchematic) - Method in class net.maizegenetics.analysis.popgen.LinkageDiseqDisplayPlugin
 
setBoxWhisker(boxWhisker) - Method in class net.maizegenetics.analysis.chart.ChartDisplayPlugin
 
setBranchLength(value) - Method in interface net.maizegenetics.taxa.tree.Node
Set the length of the branch attaching this node to its parent.
setBranchLength(value) - Method in class net.maizegenetics.taxa.tree.SimpleNode
Set the length of the branch attaching this node to its parent.
setBranchLengthSE(value) - Method in interface net.maizegenetics.taxa.tree.Node
Set the length SE of the branch attaching this node to its parent.
setBranchLengthSE(value) - Method in class net.maizegenetics.taxa.tree.SimpleNode
Set the length SE of the branch attaching this node to its parent.
setBreakpointBaseName(bkptBase) - Method in class net.maizegenetics.analysis.imputation.WritePopulationAlignmentPlugin
 
setByFactor(byFactor) - Method in class net.maizegenetics.analysis.numericaltransform.TransformDataPlugin
 
setCalculatePEV(calculatePEV) - Method in class net.maizegenetics.stats.EMMA.EMMAforDoubleMatrix
 
setChartMode(chartMode) - Method in class net.maizegenetics.analysis.chart.ChartDisplayPlugin
 
setChecked(row, col, value) - Method in class net.maizegenetics.matrixalgebra.Matrix.BlasDoubleMatrix
 
setChecked(row, col, value) - Method in class net.maizegenetics.matrixalgebra.Matrix.ColtDoubleMatrix
 
setChecked(row, col, value) - Method in interface net.maizegenetics.matrixalgebra.Matrix.DoubleMatrix
Sets the matrix value at row, col. The coordinates are checked to make sure they fall in the matrix.
setChecked(row, col, value) - Method in class net.maizegenetics.matrixalgebra.Matrix.EJMLDoubleMatrix
 
setCheckSubPops(checkSubPops) - Method in class net.maizegenetics.analysis.imputation.CallParentAllelesPlugin
 
setChild(n, node) - Method in interface net.maizegenetics.taxa.tree.Node
set child node
setChild(n, node) - Method in class net.maizegenetics.taxa.tree.SimpleNode
set child node
setChromoPosition(index, chromosome, strand, positionMin, positionMax) - Method in class net.maizegenetics.dna.map.TagsOnPhysicalMap
 
setChromoPosition(index, chromosome, strand, positionMin, positionMax) - Method in class net.maizegenetics.dna.map.TagsOnPhysicalMapV3
 
setChromoPosition(index, chromosome, strand, positionMin, positionMax) - Method in class net.maizegenetics.dna.map.TagsOnPhysMapHDF5
 
setChromoPosition(index, chromosome, strand, positionMin, positionMax) - Method in interface net.maizegenetics.dna.map.TOPMInterface
Sets chromosome, strand, start position, and end position for given tag.
setChromosomalView(chromosomalView) - Method in class net.maizegenetics.analysis.popgen.LinkageDiseqDisplayPlugin
 
setChromosomesToSeparate(chrs) - Method in class net.maizegenetics.analysis.data.SeparatePlugin
 
setCitation(citation) - Method in class net.maizegenetics.pipeline.TasselPipelineStepsDialog
 
setColor(color) - Method in class net.maizegenetics.gui.AbstractGenotypeTableMask
 
setColor(color) - Method in interface net.maizegenetics.gui.GenotypeTableMask
 
setColumnNameType(type) - Method in class net.maizegenetics.gui.AlignmentTableModel
 
setColumnTypes(types) - Method in class net.maizegenetics.analysis.association.MLMPlugin
 
setColumnTypes(types) - Method in class net.maizegenetics.analysis.association.WeightedMLMPlugin
 
setCompressionType(type) - Method in class net.maizegenetics.analysis.association.MLMPlugin
 
setCompressionType(type) - Method in class net.maizegenetics.analysis.association.WeightedMLMPlugin
 
setConfigParameters() - Method in class net.maizegenetics.plugindef.AbstractPlugin
 
setCount(x, y, value) - Method in class net.maizegenetics.taxa.distance.DistanceMatrixBuilder
 
setcssDmin(css) - Method in class net.maizegenetics.stats.linearmodels.SweepFast
 
setCustomCompression(value) - Method in class net.maizegenetics.analysis.association.MLMPlugin
 
setCustomCompression(value) - Method in class net.maizegenetics.analysis.association.WeightedMLMPlugin
 
setData(dist, input_border, dim, lc) - Method in class net.maizegenetics.analysis.gbs.neobio.OutMatrix
Sets this interface's data to represent an OUT matrix for a block. This method is typically executed once for each block being aligned.
setDcoP(index, dcoP) - Method in class net.maizegenetics.dna.map.TagsOnPhysicalMap
 
setDefault(type) - Static method in class net.maizegenetics.matrixalgebra.Matrix.DoubleMatrixFactory
 
setDeleteHetsInBreakpoints(hetsToMissing) - Method in class net.maizegenetics.analysis.imputation.WritePopulationAlignmentPlugin
 
setDelimiter(theDelimiter) - Method in class net.maizegenetics.analysis.chart.TableDisplayPlugin
 
setDepthRangeForTaxon(taxon, siteOffset, values) - Method in class net.maizegenetics.dna.snp.byte2d.Byte2DBuilder
Set values for range of sites and alleles for a taxon simultaneously.
setDepthRangeForTaxon(taxon, siteOffset, depths) - Method in class net.maizegenetics.dna.snp.score.AlleleDepthBuilder
Set depth for range of sites and alleles for a taxon simultaneously. First dimension of depths is number of alleles (6 for Nucleotide) and second dimension is sites.
setDivergence(index, divergence) - Method in class net.maizegenetics.dna.map.TagsOnPhysicalMap
 
setDivergence(index, divergence) - Method in class net.maizegenetics.dna.map.TagsOnPhysicalMapV3
 
setDivergence(index, divergence) - Method in class net.maizegenetics.dna.map.TagsOnPhysMapHDF5
 
setDivergence(index, divergence) - Method in interface net.maizegenetics.dna.map.TOPMInterface
Set Divergence for given tag
setDminFromA() - Method in class net.maizegenetics.stats.linearmodels.SweepFast
 
setDoSlidingHaps(doSlidingHaps) - Method in class net.maizegenetics.analysis.filter.FilterAlignmentPlugin
 
setEmissionProbability(probabilityMatrix) - Method in class net.maizegenetics.analysis.imputation.EmissionProbability
 
setEnd(end) - Method in class net.maizegenetics.analysis.filter.FilterAlignmentPlugin
 
setEndPos(end) - Method in class net.maizegenetics.analysis.filter.FilterAlignmentPlugin
 
setEnterlimit(enterlimit) - Method in class net.maizegenetics.analysis.modelfitter.StepwiseOLSModelFitter
 
setEnterLimit(enterLimit) - Method in class net.maizegenetics.stats.linearmodels.LinearModelForStepwiseRegression
 
setEnterlimits(enterlimits) - Method in class net.maizegenetics.analysis.modelfitter.StepwiseOLSModelFitter
 
setErrBar(errBar) - Method in class net.maizegenetics.analysis.chart.ChartDisplayPlugin
 
setExitlimit(exitlimit) - Method in class net.maizegenetics.analysis.modelfitter.StepwiseOLSModelFitter
 
setExitLimit(exitLimit) - Method in class net.maizegenetics.stats.linearmodels.LinearModelForStepwiseRegression
 
setExitlimits(exitlimits) - Method in class net.maizegenetics.analysis.modelfitter.StepwiseOLSModelFitter
 
setExtractIndels(extractIndels) - Method in class net.maizegenetics.analysis.filter.FilterAlignmentPlugin
 
setFactors(namelist) - Method in class net.maizegenetics.analysis.numericaltransform.TransformDataPlugin
 
setFamilyList(familyList) - Method in class net.maizegenetics.analysis.imputation.CallParentAllelesPlugin
 
setFastPointReadCountForTagTaxon(tagIndex, taxaIndex, value) - Method in class net.maizegenetics.dna.tag.TagsByTaxaByteFileMap
 
setFastReadCountForAdjacentTagTaxonSet(tagIndex, firstTaxaIndex, values) - Method in class net.maizegenetics.dna.tag.TagsByTaxaByteFileMap
 
setFillGapsInAlignment(fillGapsInAlignment) - Method in class net.maizegenetics.analysis.imputation.ViterbiAlgorithmPlugin
 
setFilterBitSet(newFilterBitSet) - Method in interface net.maizegenetics.dna.map.GVCFGenomeSequence
 
setFilterMinorSNPs(filterMinorSNPs) - Method in class net.maizegenetics.analysis.filter.FilterAlignmentPlugin
 
setFilterOutput(filterOutput) - Method in class net.maizegenetics.analysis.association.MLMPlugin
 
setFilterOutput(filterOutput) - Method in class net.maizegenetics.analysis.association.WeightedMLMPlugin
 
setFinalIterMarker(myFinalIterMarker) - Method in class net.maizegenetics.analysis.association.MLMPlugin
 
setFinalIterMarker(myFinalIterMarker) - Method in class net.maizegenetics.analysis.association.WeightedMLMPlugin
 
setGenotype(genotype) - Method in class net.maizegenetics.analysis.imputation.SelfedHaplotypeFinder
 
setGenotypeTable(genotype) - Method in class net.maizegenetics.analysis.imputation.PhaseHighCoverage
 
setGlobalMax(max) - Method in class net.maizegenetics.taxa.IdentifierSynonymizer
 
setGraphSize(graphX, graphY) - Method in class net.maizegenetics.analysis.popgen.LinkageDisequilibriumComponent
 
setGwasResults(gwasResultsIn) - Method in class net.maizegenetics.dna.pd.SiteAnnotation
 
setHaplotypeMap(parentHaplotypeFilename) - Method in class net.maizegenetics.analysis.imputation.ImputeCrossProgeny
 
setHetsTo(value) - Method in interface net.maizegenetics.util.SuperByteMatrix
Changes all heterozygous values to give value.
setHetsTo(value) - Method in class net.maizegenetics.util.SuperByteMatrixMultiple
 
setHetsTo(value) - Method in class net.maizegenetics.util.SuperByteMatrixSingle
 
setHetsTo(value) - Method in class net.maizegenetics.util.SuperByteMatrixSingleValue
 
setHetsTo(value) - Method in class net.maizegenetics.util.SuperByteMatrixTranspose
 
setHetTreatment(treatment) - Method in class net.maizegenetics.analysis.popgen.LinkageDisequilibriumPlugin
 
setHorizontalPageSize(horizontalSize) - Method in class net.maizegenetics.gui.AlignmentTableModel
 
setID(id) - Method in class net.maizegenetics.analysis.modelfitter.AddPlusDomModelEffect
 
setID(id) - Method in class net.maizegenetics.stats.linearmodels.CovariateModelEffect
 
setID(id) - Method in class net.maizegenetics.stats.linearmodels.FactorModelEffect
 
setID(id) - Method in interface net.maizegenetics.stats.linearmodels.ModelEffect
 
setID(id) - Method in class net.maizegenetics.stats.linearmodels.NestedCovariateModelEffect
 
setIdentifier(id) - Method in interface net.maizegenetics.taxa.tree.Node
Set identifier for this node.
setIdentifier(id) - Method in class net.maizegenetics.taxa.tree.SimpleNode
Set identifier for this node.
setIfPAV(index, value) - Method in class net.maizegenetics.dna.map.TagsOnGeneticMap
Set PAV value of tag
setImageSize(width, height) - Method in class net.maizegenetics.analysis.chart.AbstractDisplayPlugin
 
setImputedGenotypeOutFilename(imputedGenotypeOutFilename) - Method in class net.maizegenetics.analysis.imputation.ImputeCrossProgeny
 
setIncludeAnnotations(include) - Method in class net.maizegenetics.analysis.data.ExportMultiplePlugin
 
setIncludeDepth(include) - Method in class net.maizegenetics.analysis.data.ExportMultiplePlugin
 
setIncludeList(includeList) - Method in class net.maizegenetics.analysis.filter.FilterTraitsPlugin
 
setIndex(index) - Method in class net.maizegenetics.stats.linearmodels.BasicLevel
 
setInitialTransitionCounts(chr) - Method in class net.maizegenetics.analysis.imputation.TransitionProbabilityWithVariableRecombination
 
setInput(filename) - Method in class net.maizegenetics.analysis.gbs.TextToBinaryPlugin
 
setInputFiles(files) - Method in class net.maizegenetics.analysis.data.MergeAlignmentsSameSitesPlugin
 
setIsAccumulateResults(accumulate) - Method in class net.maizegenetics.analysis.popgen.LinkageDisequilibriumPlugin
 
setIsRandom(isRandom) - Method in class net.maizegenetics.analysis.filter.FilterSubsetPlugin
 
setKeyFileStringToInt(inputKeyFile) - Static method in class net.maizegenetics.analysis.gbs.v2.DiscoverySNPCallerPluginV2
 
setLDType(type) - Method in class net.maizegenetics.analysis.popgen.LinkageDisequilibriumPlugin
 
setLocus(locus) - Method in class net.maizegenetics.analysis.distance.DistanceMatrixRangesPlugin
 
setLocus(locus) - Method in class net.maizegenetics.analysis.filter.FilterAlignmentPlugin
 
setLocusStr(name) - Method in class net.maizegenetics.analysis.filter.FilterAlignmentPlugin
 
setLogFile(logname) - Method in class net.maizegenetics.analysis.imputation.CallParentAllelesPlugin
 
setLogTransform(logTransform) - Method in class net.maizegenetics.analysis.numericaltransform.TransformDataPlugin
 
setLong(wordNum, bits) - Method in interface net.maizegenetics.util.BitSet
Expert: sets specified word with given bits.
setLong(wordNum, bits) - Method in class net.maizegenetics.util.OpenBitSet
Expert: sets specified word with given bits.
setLong(wordNum, bits) - Method in class net.maizegenetics.util.UnmodifiableBitSet
 
SetLowDepthGenosToMissingPlugin - Class in net.maizegenetics.analysis.data
Set genotypes below a minimum depth to missing. Set each genotype in the input genotypes to missing if the underlying allelic depth is below a user- specified minimum. Input: GenotypeTable stored as a Datum within a DataSet Output: GenotypeTable stored as a Datum within a DataSet
SetLowDepthGenosToMissingPlugin() - Constructor for class net.maizegenetics.analysis.data.SetLowDepthGenosToMissingPlugin
 
SetLowDepthGenosToMissingPlugin(parentFrame, isInteractive) - Constructor for class net.maizegenetics.analysis.data.SetLowDepthGenosToMissingPlugin
 
setLowerCorner(lowerCorner) - Method in class net.maizegenetics.analysis.popgen.LinkageDiseqDisplayPlugin
 
setLowerCorner(ldMeasure) - Method in class net.maizegenetics.analysis.popgen.LinkageDisequilibriumComponent
This determines what is displayed in the lower left corner. Options are: P_VALUE, DPRIME, and RSQUARE
setMainText(text) - Method in class net.maizegenetics.tassel.TASSELMainFrame
 
setMapP(index, mapP) - Method in class net.maizegenetics.dna.map.TagsOnPhysicalMap
 
setMapP(index, mapP) - Method in class net.maizegenetics.dna.map.TagsOnPhysicalMap
 
setMapP(index, mapP) - Method in class net.maizegenetics.dna.map.TagsOnPhysicalMapV3
 
setMapP(index, mapP) - Method in class net.maizegenetics.dna.map.TagsOnPhysicalMapV3
 
setMapP(index, mapP) - Method in class net.maizegenetics.dna.map.TagsOnPhysMapHDF5
 
setMapP(index, mapP) - Method in class net.maizegenetics.dna.map.TagsOnPhysMapHDF5
 
setMapP(index, mapP) - Method in interface net.maizegenetics.dna.map.TOPMInterface
Set MapP for given tag
setMapP(index, mapP) - Method in interface net.maizegenetics.dna.map.TOPMInterface
 
setMappingNum(mappingNum) - Method in class net.maizegenetics.dna.map.TagsOnPhysicalMapV3
Set mappingNum attribute in HDF5
setMappingRank(mappingRank) - Method in class net.maizegenetics.dna.map.TagMappingInfoV3
 
setMappingSource(mappingSource) - Method in class net.maizegenetics.dna.map.TagMappingInfoV3
 
setMaskBitSet(newMaskBitSet) - Method in interface net.maizegenetics.dna.map.GVCFGenomeSequence
 
setMasks(masks) - Method in class net.maizegenetics.gui.AlignmentTableCellRenderer
 
setMasks(masks) - Method in class net.maizegenetics.tassel.SeqViewerPanel
 
setMatrix(tcontig) - Method in class net.maizegenetics.stats.statistics.ContigencyTable
sets the data for the contigency table, must be set before other methods are called. If tcontig has a greater count than maxSize, then the contig is set to null
setMaxDifference(maxDifference) - Method in class net.maizegenetics.analysis.imputation.CallParentAllelesPlugin
 
setMaxFreq(maxFreq) - Method in class net.maizegenetics.analysis.filter.FilterAlignmentPlugin
 
setMaxHetDev(maxHetDev) - Method in class net.maizegenetics.analysis.imputation.CallParentAllelesPlugin
 
setMaximumNumOfIteration(max) - Method in class net.maizegenetics.analysis.association.MLMPlugin
 
setMaximumNumOfIteration(max) - Method in class net.maizegenetics.analysis.association.WeightedMLMPlugin
 
setMaxMafForMono(maxMafForMono) - Method in class net.maizegenetics.analysis.imputation.WritePopulationAlignmentPlugin
 
setMaxMissing(maxMissing) - Method in class net.maizegenetics.analysis.imputation.CallParentAllelesPlugin
 
setMaxNumberOfMarkers(maxNumberOfMarkers) - Method in class net.maizegenetics.analysis.modelfitter.StepwiseOLSModelFitter
 
setMaxP(maxp) - Method in class net.maizegenetics.analysis.association.FixedEffectLMPlugin
 
setMaxp(maxp) - Method in class net.maizegenetics.analysis.association.MLMPlugin
 
setMaxp(maxp) - Method in class net.maizegenetics.analysis.association.WeightedMLMPlugin
 
setMergeAlignments(mergeAlignments) - Method in class net.maizegenetics.analysis.imputation.WritePopulationAlignmentPlugin
 
setMethodByRows(rowSetMethod) - Method in interface net.maizegenetics.dna.tag.TagsByTaxa
 
setMethodByRows(rowSetMethod) - Method in class net.maizegenetics.dna.tag.TagsByTaxaByte
 
setMethodByRows(rowSetMethod) - Method in class net.maizegenetics.dna.tag.TagsByTaxaByteFileMap
 
setMethodByRows(rowSetMethod) - Method in class net.maizegenetics.dna.tag.TagsByTaxaByteFileMapSeq
 
setMethodByRows(rowSetMethod) - Method in class net.maizegenetics.dna.tag.TagsByTaxaByteHDF5TagGroups
 
setMethodByRows(rowSetMethod) - Method in class net.maizegenetics.dna.tag.TagsByTaxaByteHDF5TaxaGroups
 
setMethodByRows(rowSetMethod) - Method in class net.maizegenetics.dna.tag.TagsByTaxaShort
 
setMinCount(minCount) - Method in class net.maizegenetics.analysis.filter.FilterAlignmentPlugin
 
setMinDepth(mindepth) - Method in class net.maizegenetics.analysis.imputation.RephaseParents
 
setMinFreq(minFreq) - Method in class net.maizegenetics.analysis.filter.FilterAlignmentPlugin
 
setMinMinorAlleleFrequency(minMinorAlleleFrequency) - Method in class net.maizegenetics.analysis.imputation.CallParentAllelesPlugin
 
setMinRforSnps(minRforSnps) - Method in class net.maizegenetics.analysis.imputation.CallParentAllelesPlugin
 
setMinSnpCoverage(minSnpCoverage) - Method in class net.maizegenetics.analysis.imputation.WritePopulationAlignmentPlugin
 
setMinStartPosition(newMinStartPosition) - Method in class net.maizegenetics.dna.map.TagLocus
 
setMinUsedClusterSize(minUsedClusterSize) - Method in class net.maizegenetics.analysis.imputation.CallParentAllelesPlugin
 
setModelSS(modelss) - Method in class net.maizegenetics.stats.linearmodels.PartitionedLinearModel
 
setModelType(modelType) - Method in class net.maizegenetics.analysis.modelfitter.StepwiseOLSModelFitter
 
setMultimaps(index, multimaps) - Method in class net.maizegenetics.dna.map.TagsOnPhysicalMap
 
setMultimaps(index, multimaps) - Method in class net.maizegenetics.dna.map.TagsOnPhysicalMapV3
 
setMultimaps(index, multimaps) - Method in class net.maizegenetics.dna.map.TagsOnPhysMapHDF5
 
setMyBase(myBase) - Method in class net.maizegenetics.analysis.numericaltransform.TransformDataPlugin
 
setMyGenotype(myGenotype) - Method in class net.maizegenetics.analysis.imputation.ImputeCrossProgeny
 
setMyMatrix(p) - Method in class net.maizegenetics.matrixalgebra.Matrix.EJMLDoubleMatrix
 
setName() - Method in class net.maizegenetics.analysis.gobii.HapBreakpoints_IFLFilePlugin
Name to be given to this set of breakpoints. This name will be stored in the breakpointSet table.
setName(value) - Method in class net.maizegenetics.analysis.gobii.HapBreakpoints_IFLFilePlugin
Set Breakpoint Set Name. Name to be given to this set of breakpoints. This name will be stored in the breakpointSet table.
setName(s) - Method in class net.maizegenetics.plugindef.Datum
 
setNested(isNested) - Method in class net.maizegenetics.analysis.modelfitter.StepwiseOLSModelFitter
 
setNestingEffectIndex(nestingFactorIndex) - Method in class net.maizegenetics.analysis.modelfitter.StepwiseOLSModelFitter
 
setNext(next) - Method in class net.maizegenetics.analysis.gbs.neobio.Factor
Sets this factor's next pointer to point to the specified factor. Although the next factor has typically a serial number equal to this factor's serial number plus 1, no attempt is made to guarantee this rule. This allows special constructs or a different order in the factorisation.
setNext(value) - Method in class net.maizegenetics.dna.snp.MaskMatrixBuilder
 
setNode(node) - Method in class net.maizegenetics.analysis.imputation.TransitionProbability
 
setNode(node) - Method in class net.maizegenetics.analysis.imputation.TransitionProbabilityWithVariableRecombination
 
setNodeHeight(value) - Method in interface net.maizegenetics.taxa.tree.Node
Set the height of this node relative to the most recent node.
setNodeHeight(value, adjustChildBranchLengths) - Method in interface net.maizegenetics.taxa.tree.Node
Set the height of this node relative to the most recent node.
setNodeHeight(value) - Method in class net.maizegenetics.taxa.tree.SimpleNode
Set the height of this node relative to the most recent node.
setNodeHeight(value, adjustChildBranchLengths) - Method in class net.maizegenetics.taxa.tree.SimpleNode
Set the height of this node relative to the most recent node.
setNodeToGroup(aNode, group, groups) - Method in class net.maizegenetics.taxa.tree.TreeClusters
 
setNoteText(text) - Method in class net.maizegenetics.tassel.TASSELMainFrame
 
setNumAccumulateIntervals(numIntervals) - Method in class net.maizegenetics.analysis.popgen.LinkageDisequilibriumPlugin
 
setNumber(number) - Method in interface net.maizegenetics.taxa.tree.Node
set the index of this node
setNumber(n) - Method in class net.maizegenetics.taxa.tree.SimpleNode
 
setNumberOfGroups(numberOfGroups) - Method in class net.maizegenetics.analysis.association.CompressedDoubleMatrix
This sets the number of groups and calculates the output matrices. It must be run to set the number of groups before retrieving the compressed and adjustment matrices.
setNumberOfPermutations(nperm) - Method in class net.maizegenetics.analysis.association.FixedEffectLMPlugin
 
setNumberOfPermutations(numberOfPermutations) - Method in class net.maizegenetics.analysis.modelfitter.StepwiseOLSModelFitter
 
setNumWords(nWords) - Method in interface net.maizegenetics.util.BitSet
Expert: sets the number of longs in the array that are in use
setNumWords(nWords) - Method in class net.maizegenetics.util.OpenBitSet
Expert: sets the number of longs in the array that are in use
setNumWords(nWords) - Method in class net.maizegenetics.util.UnmodifiableBitSet
 
setOpenFiles(openFiles) - Method in class net.maizegenetics.analysis.data.FileLoadPlugin
 
setOpenFiles(openFile) - Method in class net.maizegenetics.analysis.data.FileLoadPlugin
 
setOpenFiles(openFiles) - Method in class net.maizegenetics.analysis.data.FileLoadPlugin
 
setOutformat(theOutformat) - Method in class net.maizegenetics.analysis.chart.AbstractDisplayPlugin
 
setOuthapsAllProgeny(filename) - Method in class net.maizegenetics.analysis.imputation.PhaseHighCoverage
 
setOutput(filename) - Method in class net.maizegenetics.analysis.gbs.TextToBinaryPlugin
 
setOutputDiploid(outputDiploid) - Method in class net.maizegenetics.analysis.imputation.WritePopulationAlignmentPlugin
 
setOutputFile(name) - Method in class net.maizegenetics.analysis.association.FixedEffectLMPlugin
 
setOutputFile(filename) - Method in class net.maizegenetics.analysis.data.MergeAlignmentsSameSitesPlugin
 
setOutputName(outputName) - Method in class net.maizegenetics.analysis.association.MLMPlugin
 
setOutputName(outputName) - Method in class net.maizegenetics.analysis.association.WeightedMLMPlugin
 
setOverallDescription(description) - Method in class net.maizegenetics.pipeline.TasselPipelineStepsDialog
 
setOverlap(overlap) - Method in class net.maizegenetics.analysis.imputation.CallParentAllelesPlugin
 
setParameter(param, value) - Method in class net.maizegenetics.plugindef.AbstractPlugin
 
setParameter(key, value) - Method in class net.maizegenetics.plugindef.AbstractPlugin
 
setParameter(key, value) - Method in class net.maizegenetics.plugindef.AbstractPlugin
 
setParameter(param, value) - Method in interface net.maizegenetics.plugindef.Plugin
Sets parameter value for a given plugin
setParameter(key, value) - Method in interface net.maizegenetics.plugindef.Plugin
Sets parameter value for given parameter key.
setParameter(key, value) - Method in interface net.maizegenetics.plugindef.Plugin
Sets parameter value for given parameter key.
setParameter(param, n) - Method in class net.maizegenetics.taxa.tree.MultiParameterized
 
setParameter(param, n) - Method in class net.maizegenetics.taxa.tree.Parameterized.Null
 
setParameter(param, n) - Method in class net.maizegenetics.taxa.tree.Parameterized.ParameterizedBase
 
setParameter(param, n) - Method in class net.maizegenetics.taxa.tree.Parameterized.ParameterizedUser
 
setParameter(param, n) - Method in interface net.maizegenetics.taxa.tree.Parameterized
set model parameter
setParameterizedBase(base) - Method in class net.maizegenetics.taxa.tree.Parameterized.ParameterizedUser
Set's the base parameterized object...
setParameters(args) - Method in class net.maizegenetics.analysis.data.ExtractHapmapSubsetPlugin
 
setParameters(args) - Method in class net.maizegenetics.analysis.data.MergeHDF5GenotypesSameSitesPlugin
 
setParameters(args) - Method in class net.maizegenetics.analysis.distance.KinshipPlugin
 
setParameters(args) - Method in class net.maizegenetics.analysis.gbs.AnnotateTOPMwSAMPlugin
 
setParameters(args) - Method in class net.maizegenetics.analysis.gbs.CompareGenosBetweenHapMapFilesPlugin
 
setParameters(args) - Method in class net.maizegenetics.analysis.gbs.ContigPETagCountPlugin
 
setParameters(args) - Method in class net.maizegenetics.analysis.gbs.FastqToPETagCountPlugin
 
setParameters(args) - Method in class net.maizegenetics.analysis.gbs.FastqToTBTPlugin
 
setParameters(args) - Method in class net.maizegenetics.analysis.gbs.KeepSpecifiedReadsinFastqPlugin
 
setParameters(args) - Method in class net.maizegenetics.analysis.gbs.KeepSpecifiedSitesInTOPMPlugin
 
setParameters(args) - Method in class net.maizegenetics.analysis.gbs.KmerToTagCountPlugin
 
setParameters(args) - Method in class net.maizegenetics.analysis.gbs.KmerToTBTPlugin
 
setParameters(args) - Method in class net.maizegenetics.analysis.gbs.MergeDuplicateSNPsPlugin
 
setParameters(args) - Method in class net.maizegenetics.analysis.gbs.MergeMultipleTOPMPlugin
 
setParameters(args) - Method in class net.maizegenetics.analysis.gbs.MergePETagCountPlugin
 
setParameters(args) - Method in class net.maizegenetics.analysis.gbs.MergeTagsByTaxaFilesByRowPlugin
 
setParameters(args) - Method in class net.maizegenetics.analysis.gbs.MergeTagsByTaxaFilesPlugin
 
setParameters(args) - Method in class net.maizegenetics.analysis.gbs.pana.PanAAddPosToTagMapPlugin
 
setParameters(args) - Method in class net.maizegenetics.analysis.gbs.pana.PanABuildPivotTBTPlugin
 
setParameters(args) - Method in class net.maizegenetics.analysis.gbs.pana.PanABuildTagBlockPosPlugin
 
setParameters(args) - Method in class net.maizegenetics.analysis.gbs.pana.PanABuildTagGWASMapPlugin
 
setParameters(args) - Method in class net.maizegenetics.analysis.gbs.pana.PanABuildTrainingSetPlugin
 
setParameters(args) - Method in class net.maizegenetics.analysis.gbs.pana.PanAFilteringTagMapPlugin
 
setParameters(args) - Method in class net.maizegenetics.analysis.gbs.pana.PanAH5ToAnchorPlugin
 
setParameters(args) - Method in class net.maizegenetics.analysis.gbs.pana.PanAMergeMappingResultPlugin
 
setParameters(args) - Method in class net.maizegenetics.analysis.gbs.pana.PanAModelTrainingPlugin
 
setParameters(args) - Method in class net.maizegenetics.analysis.gbs.pana.PanAPredictionPlugin
 
setParameters(args) - Method in class net.maizegenetics.analysis.gbs.pana.PanAReadDigestPlugin
 
setParameters(args) - Method in class net.maizegenetics.analysis.gbs.pana.PanAReadToKmerPlugin
 
setParameters(args) - Method in class net.maizegenetics.analysis.gbs.pana.PanASamToMultiPositionTOPMPlugin
 
setParameters(args) - Method in class net.maizegenetics.analysis.gbs.pana.PanASplitTagBlockPosPlugin
 
setParameters(args) - Method in class net.maizegenetics.analysis.gbs.pana.PanASplitTBTPlugin
 
setParameters(args) - Method in class net.maizegenetics.analysis.gbs.pana.PanATagGWASMappingPlugin
 
setParameters(args) - Method in class net.maizegenetics.analysis.gbs.pana.PanATagMapToFastaPlugin
 
setParameters(args) - Method in class net.maizegenetics.analysis.gbs.QseqToPETagCountPlugin
 
setParameters(args) - Method in class net.maizegenetics.analysis.gbs.QseqToTagCountPlugin
 
setParameters(args) - Method in class net.maizegenetics.analysis.gbs.QseqToTBTPlugin
 
setParameters(args) - Method in class net.maizegenetics.analysis.gbs.SAMWGMapConverterPlugin
 
setParameters(args) - Method in class net.maizegenetics.analysis.gbs.TagAgainstAnchorPlugin
 
setParameters(args) - Method in class net.maizegenetics.analysis.gbs.TextToBinaryPlugin
 
setParameters(args) - Method in class net.maizegenetics.analysis.gbs.TOPMSummaryPlugin
 
setParameters(args) - Method in class net.maizegenetics.analysis.imputation.CallParentAllelesPlugin
 
setParameters(args) - Method in class net.maizegenetics.analysis.imputation.FindMergeHaplotypesPlugin
 
setParameters(args) - Method in class net.maizegenetics.analysis.imputation.ViterbiAlgorithmPlugin
 
setParameters(args) - Method in class net.maizegenetics.analysis.imputation.WritePopulationAlignmentPlugin
 
setParameters(args) - Method in class net.maizegenetics.analysis.numericaltransform.TransformDataPlugin
 
setParameters(args) - Method in class net.maizegenetics.plugindef.AbstractPlugin
 
setParameters(args) - Method in interface net.maizegenetics.plugindef.Plugin
Allows self-describing Plugins to use args to set parameters specific to itself.
setParameterSE(paramSE, n) - Method in class net.maizegenetics.taxa.tree.MultiParameterized
 
setParameterSE(paramSE, n) - Method in class net.maizegenetics.taxa.tree.Parameterized.Null
 
setParameterSE(paramSE, n) - Method in class net.maizegenetics.taxa.tree.Parameterized.ParameterizedBase
 
setParameterSE(paramSE, n) - Method in class net.maizegenetics.taxa.tree.Parameterized.ParameterizedUser
 
setParameterSE(paramSE, n) - Method in interface net.maizegenetics.taxa.tree.Parameterized
set standard errors for model parameter
setParametersToDefault() - Method in class net.maizegenetics.plugindef.AbstractPlugin
 
setParametersToDefault() - Method in interface net.maizegenetics.plugindef.Plugin
Sets all parameter values to default.
setParent(node) - Method in interface net.maizegenetics.taxa.tree.Node
Set the parent node of this node.
setParent(node) - Method in class net.maizegenetics.taxa.tree.SimpleNode
Set the parent node of this node.
setParentage(parentageFilename) - Method in class net.maizegenetics.analysis.imputation.ImputeCrossProgeny
 
setParentage(filename) - Method in class net.maizegenetics.analysis.imputation.PhaseHighCoverage
 
setParentCallInputFilename(parentCallFilename) - Method in class net.maizegenetics.analysis.imputation.ImputeCrossProgeny
 
setParentcallOutFilename(parentcallOutFilename) - Method in class net.maizegenetics.analysis.imputation.ImputeCrossProgeny
 
setPedfileName(pedfileName) - Method in class net.maizegenetics.analysis.imputation.CallParentAllelesPlugin
 
setPermutationNumber(permutationNumber) - Method in class net.maizegenetics.analysis.popgen.LinkageDisequilibriumPlugin
 
setPermute(permute) - Method in class net.maizegenetics.analysis.association.FixedEffectLMPlugin
 
setPersistPreferences(persist) - Static method in class net.maizegenetics.prefs.TasselPrefs
Whether to Persist Preferences. Preference changes should be persisted when executing GUI and set only temporarily from Command Line Flags. Also getting preferences should use stored values when executing GUI. And should use default values (if not temporarily set) when executing from Command Line.
setPhasedParentOutFilename(phasedParentOutFilename) - Method in class net.maizegenetics.analysis.imputation.ImputeCrossProgeny
 
setPhysicalPositions(positions) - Method in class net.maizegenetics.analysis.distance.DistanceMatrixRangesPlugin
 
setPhysicalPositions(positions) - Method in class net.maizegenetics.analysis.distance.DistanceMatrixRangesPlugin
 
setPlotList(plotList) - Method in class net.maizegenetics.analysis.imputation.ImputeCrossProgeny
 
setPositions(positions) - Method in class net.maizegenetics.analysis.imputation.TransitionProbability
 
setPower(power) - Method in class net.maizegenetics.analysis.numericaltransform.TransformDataPlugin
 
setPowerTransform(powerTransform) - Method in class net.maizegenetics.analysis.numericaltransform.TransformDataPlugin
 
setPredictedDistance(predictedDistance) - Method in class net.maizegenetics.dna.map.TagGWASMapInfo
 
setProbHeterozygous(probHeterozygous) - Method in class net.maizegenetics.analysis.imputation.ViterbiAlgorithmPlugin
 
setR2Count(p) - Method in class net.maizegenetics.analysis.data.MeanR2FromLDPlugin.AccumulateR2
 
setR2Total(p) - Method in class net.maizegenetics.analysis.data.MeanR2FromLDPlugin.AccumulateR2
 
setRandom(random) - Method in class net.maizegenetics.stats.linearmodels.BasicLevel
 
setRandomSeed(seed) - Method in class net.maizegenetics.analysis.association.AbstractFixedEffectLM
This method is used mainly for testing in order to generate reproducible permutation results. If the seed is not set, the current time is used to initialize the random number generator.
setRandomSeed(seed) - Method in class net.maizegenetics.analysis.modelfitter.ResamplingGWASPlugin
Initializes the random number generator with a seed. Primarily used for testing to generate reproducible results.
setRapidAnalysis(rapidAnalysis) - Method in class net.maizegenetics.analysis.popgen.LinkageDisequilibriumPlugin
 
setReadCountForTagTaxon(tagIndex, taxaIndex, value) - Method in interface net.maizegenetics.dna.tag.TagsByTaxa
Set the read depth for a specific tag and taxon. Overwrite the depth that was previously there.
setReadCountForTagTaxon(tagIndex, taxaIndex, value) - Method in class net.maizegenetics.dna.tag.TagsByTaxaByte
 
setReadCountForTagTaxon(tagIndex, taxaIndex, value) - Method in class net.maizegenetics.dna.tag.TagsByTaxaByteFileMap
 
setReadCountForTagTaxon(tagIndex, taxaIndex, value) - Method in class net.maizegenetics.dna.tag.TagsByTaxaByteFileMapSeq
 
setReadCountForTagTaxon(tagIndex, taxaIndex, value) - Method in class net.maizegenetics.dna.tag.TagsByTaxaByteHDF5TagGroups
 
setReadCountForTagTaxon(tagIndex, taxaIndex, value) - Method in class net.maizegenetics.dna.tag.TagsByTaxaByteHDF5TaxaGroups
 
setReadCountForTagTaxon(tagIndex, taxaIndex, value) - Method in class net.maizegenetics.dna.tag.TagsByTaxaShort
 
setReadCountForTaxa(readIndex, taxaIndex, value) - Method in class net.maizegenetics.dna.tag.ReadsByTaxa
 
setRegression(regression) - Method in class net.maizegenetics.analysis.chart.ChartDisplayPlugin
 
setRenderingType(type) - Method in class net.maizegenetics.gui.AlignmentTableCellRenderer
 
setRenderingType(type) - Method in class net.maizegenetics.gui.AlignmentTableModel
 
setRestricted(restricted) - Method in class net.maizegenetics.stats.linearmodels.FactorModelEffect
 
setRoot(r) - Method in class net.maizegenetics.taxa.tree.SimpleTree
Set a new node as root node.
setRoot(root) - Method in interface net.maizegenetics.taxa.tree.Tree
This method constructs a tree from the given root node.
setSaveFile(theSaveFile) - Method in class net.maizegenetics.analysis.chart.AbstractDisplayPlugin
 
setSaveFile(theSaveFile) - Method in class net.maizegenetics.analysis.chart.AbstractDisplayPlugin
 
setSaveFile(saveFile) - Method in class net.maizegenetics.analysis.data.ExportPlugin
Deprecated. 
setSaveFiles(saveFiles) - Method in class net.maizegenetics.analysis.data.ExportMultiplePlugin
 
setScaleOfView(chromosomalScale) - Method in class net.maizegenetics.analysis.popgen.LinkageDisequilibriumComponent
This sets the scale of the LD view, either sites are organized by chromosomes if chromosomalScale is true, otherwise they are organized by genes
setScore(newScore) - Method in class net.maizegenetics.analysis.clustering.HaplotypeCluster
Sets the score of this haplotype to the new score.
setScoringScheme(scoring) - Method in class net.maizegenetics.analysis.gbs.neobio.PairwiseAlignmentAlgorithm
Sets the scoring scheme to be used for the next alignments. Any alignment or score already computed is lost. If the scoring scheme supports partial matches, this PairwiseAlignmentAlgorithm is set not to use the MATCH_TAG tag because in this case the score tag line be confusing. If the scoring scheme does not support partial matches, then the use of the MATCH_TAG tag is enabled.
setSeed(seed) - Static method in class net.maizegenetics.stats.linearmodels.BasicShuffler
 
setSeed(seed) - Method in class net.maizegenetics.stats.math.MersenneTwisterFast
Initalize the pseudo random number generator. The Mersenne Twister only uses an integer for its seed; It's best that you don't pass in a long that's bigger than an int.
setSelectionPath(theDatum) - Method in class net.maizegenetics.tassel.DataTreePanel
 
setSequence(array) - Method in interface net.maizegenetics.taxa.tree.Node
Sets the sequence using an array of bytes.
setSequence(s) - Method in class net.maizegenetics.taxa.tree.SimpleNode
Sets the sequence at this node, in the form of an array of bytes.
setSeries1(series1) - Method in class net.maizegenetics.analysis.chart.ChartDisplayPlugin
 
setSeries2(series2) - Method in class net.maizegenetics.analysis.chart.ChartDisplayPlugin
 
setSeries3(series3) - Method in class net.maizegenetics.analysis.chart.ChartDisplayPlugin
 
setShowLabels(includeLabels) - Method in class net.maizegenetics.analysis.popgen.LinkageDiseqDisplayPlugin
 
setShowLabels(includeLabels) - Method in class net.maizegenetics.analysis.popgen.LinkageDisequilibriumComponent
 
setShown(search) - Method in class net.maizegenetics.gui.AbstractAvailableListModel
 
setShowSchematic(includeBlockSchematic) - Method in class net.maizegenetics.analysis.popgen.LinkageDisequilibriumComponent
This sets whether a schematic is displayed. If true a schematic of genes or chromosomes is displayed, otherwise no schematic is displayed
setSiteNamesToCovariates(mySitesToCovariates) - Method in class net.maizegenetics.analysis.filter.FilterSiteNamePlugin
Deprecated.
 
setSiteNamesToFactors(mySitesToFactors) - Method in class net.maizegenetics.analysis.filter.FilterSiteNamePlugin
Deprecated.
 
setSiteNamesToKeep(sitesToKeep) - Method in class net.maizegenetics.analysis.filter.FilterSiteNamePlugin
Deprecated.
 
setSiteNamesToRemove(sitesToRemove) - Method in class net.maizegenetics.analysis.filter.FilterSiteNamePlugin
Deprecated.
 
setSitesToCovariatesIndex(index) - Method in class net.maizegenetics.analysis.filter.FilterSiteNamePlugin
Deprecated.
 
setSitesToFactorsIndex(index) - Method in class net.maizegenetics.analysis.filter.FilterSiteNamePlugin
Deprecated.
 
setSitesToKeep(sitesToKeep) - Method in class net.maizegenetics.analysis.filter.FilterSiteNamePlugin
Deprecated.
 
setSiteSubset(subset_val) - Method in class net.maizegenetics.analysis.filter.FilterSubsetPlugin
 
setSource(parameters, lowerLimits, upperLimits, defaultValues) - Method in class net.maizegenetics.taxa.tree.Parameterized.ParameterizedBase
Set's the base arrays...
setSource(parameters, lowerLimits, upperLimits, defaultValues, parametersSE) - Method in class net.maizegenetics.taxa.tree.Parameterized.ParameterizedBase
Set's the base arrays...
setStandardize(standardize) - Method in class net.maizegenetics.analysis.numericaltransform.TransformDataPlugin
 
setStart(start) - Method in class net.maizegenetics.analysis.filter.FilterAlignmentPlugin
 
setStartPos(start) - Method in class net.maizegenetics.analysis.filter.FilterAlignmentPlugin
 
setStateProbability(probTrueState) - Method in class net.maizegenetics.analysis.imputation.ViterbiAlgorithm
 
setStateProbability(probTrueState) - Method in class net.maizegenetics.analysis.imputation.ViterbiAlgorithmVariableStateNumber
 
setStepSize(stepSize) - Method in class net.maizegenetics.analysis.filter.FilterAlignmentPlugin
 
setTableReport(theTable, seriesCategory, seriesY) - Method in class net.maizegenetics.analysis.chart.TableReportBoxWhiskerCatDataset
 
setTableReport(theTable) - Method in class net.maizegenetics.analysis.chart.TableReportManhattanDataset
 
setTableReport(theTable, seriesCategory) - Method in class net.maizegenetics.analysis.chart.TableReportPieDataset
 
setTableReport(theTable) - Method in class net.maizegenetics.analysis.chart.TableReportQQDataset
 
setTableReport(theTable, seriesCategory, seriesY) - Method in class net.maizegenetics.analysis.chart.TableReportStatCategoryDataset
 
setTableReport(theTable, seriesX, seriesY1, seriesY2) - Method in class net.maizegenetics.analysis.chart.TableReportXYDataset
 
setTag(sequence, length, count, index) - Method in class net.maizegenetics.dna.tag.TagCounts
 
setTagAlignmentBest(tag, position, isBest) - Method in interface net.maizegenetics.dna.tag.RepGenDataWriter
 
setTagAlignmentBest(tag, position, isBest) - Method in class net.maizegenetics.dna.tag.RepGenSQLite
 
setTagAlignmentBest(tag, position, isBest) - Method in class net.maizegenetics.dna.tag.TagDataSQLite
 
setTagAlignmentBest(tag, position, isBest) - Method in interface net.maizegenetics.dna.tag.TagDataWriter
 
setTagLenException() - Method in class net.maizegenetics.analysis.gbs.repgen.RepGenLoadSeqToDBPlugin
 
setTagLenException() - Method in class net.maizegenetics.analysis.gbs.repgen.RGBSProductionSNPCallerPlugin
 
setTagLenException() - Method in class net.maizegenetics.analysis.gbs.v2.GBSSeqToTagDBPlugin
 
setTagLenException() - Method in class net.maizegenetics.analysis.gbs.v2.ProductionSNPCallerPluginV2
 
setTagLenException() - Method in class net.maizegenetics.analysis.rna.RNADeMultiplexProductionPlugin
 
setTagLenException() - Static method in class net.maizegenetics.analysis.rna.RNADeMultiPlexSeqToDBPlugin
 
setTaxaSubset(subset_val) - Method in class net.maizegenetics.analysis.filter.FilterSubsetPlugin
 
setTaxon(taxon) - Method in class net.maizegenetics.analysis.distance.DistanceMatrixRangesPlugin
 
setTestMarkers(testMarkers) - Method in class net.maizegenetics.analysis.association.CompressedMLMusingDoubleMatrix
 
setTestSite(site) - Method in class net.maizegenetics.analysis.popgen.LinkageDisequilibriumPlugin
 
setTestSiteName(siteName) - Method in class net.maizegenetics.analysis.popgen.LinkageDisequilibriumPlugin
 
setTheFileType(theFileType) - Method in class net.maizegenetics.analysis.data.FileLoadPlugin
 
setThreaded(threaded) - Method in class net.maizegenetics.plugindef.AbstractPlugin
 
setThreaded(threaded) - Method in interface net.maizegenetics.plugindef.Plugin
Set whether this plugin is threaded.
setTolerance(tolerance) - Method in class net.maizegenetics.matrixalgebra.decomposition.BlasSingularValueDecomposition
 
SetToNGenotypeMergeRule - Class in net.maizegenetics.dna.snp.genotypecall
 
setTraits(namelist) - Method in class net.maizegenetics.analysis.numericaltransform.TransformDataPlugin
 
setTraitsToTransform(traitsToTransform) - Method in class net.maizegenetics.analysis.numericaltransform.TransformDataPlugin
 
setTransitionCounts(transitionCounts, chromosomeLength, numberOfTaxa) - Method in class net.maizegenetics.analysis.imputation.TransitionProbability
 
setTransitionCounts(transitionCounts, chromosomeLength, numberOfTaxa) - Method in class net.maizegenetics.analysis.imputation.TransitionProbabilityWithVariableRecombination
 
setTransitionProbability(probabilityMatrix) - Method in class net.maizegenetics.analysis.imputation.TransitionProbability
Use this function to set the transition probability matrix when it is to be used without specifying nodes for getTransitionProbability
setType(type) - Method in class net.maizegenetics.analysis.gbs.TextToBinaryPlugin
 
setTypeChangeList(typeChangeList) - Method in class net.maizegenetics.analysis.filter.FilterTraitsPlugin
 
setUnits(units) - Method in class net.maizegenetics.taxa.tree.SimpleTree
Sets the units that this tree is expressed in.
setup(ps, baseLookup, baseParameter) - Static method in class net.maizegenetics.taxa.tree.MultiParameterized
 
setupDebugLogfile(logFileName) - Static method in class net.maizegenetics.util.LoggingUtils
Sends all logging messages (including log4j) to specified file. The logging level will be DEBUG.
setupDebugLogging() - Static method in class net.maizegenetics.util.LoggingUtils
Sends all logging messages (including log4j) to standard out. The logging level will be DEBUG.
setupDebugLogging(stream) - Static method in class net.maizegenetics.util.LoggingUtils
Sends all logging messages (including log4j) to specified PrintStream. The logging level will be DEBUG. This is used to direct logging messages to the GUI.
setupLogfile(logFileName) - Static method in class net.maizegenetics.util.LoggingUtils
Sends all logging messages (including log4j) to specified file. The logging level will be INFO, unless executed by the GUI and the user preference has been set level to DEBUG.
setupLogging() - Static method in class net.maizegenetics.util.LoggingUtils
Sends all logging messages (including log4j) to standard out. The logging level will be INFO, unless executed by the GUI and the user preference has been set level to DEBUG.
setupLogging(stream) - Static method in class net.maizegenetics.util.LoggingUtils
Sends all logging messages (including log4j) to specified PrintStream. The logging level will be INFO, unless executed by the GUI and the user preference has been set level to DEBUG. This is used to direct logging messages to the GUI.
setupLoggingOff() - Static method in class net.maizegenetics.util.LoggingUtils
Turns off logging
setUpperCorner(upperCorner) - Method in class net.maizegenetics.analysis.popgen.LinkageDiseqDisplayPlugin
 
setUpperCorner(ldMeasure) - Method in class net.maizegenetics.analysis.popgen.LinkageDisequilibriumComponent
This determines what is displayed in the upper right corner. Options are: P_VALUE, DPRIME, and RSQUARE
setupStdOutLogging() - Static method in class net.maizegenetics.util.LoggingUtils
 
setUseAllSiteTypes(useAllSiteTypes) - Method in class net.maizegenetics.analysis.filter.FilterAlignmentPlugin
 
setUseBCFilter(useBCFilter) - Method in class net.maizegenetics.analysis.imputation.CallParentAllelesPlugin
 
setUseClusterAlgorithm(useClusterAlgorithm) - Method in class net.maizegenetics.analysis.imputation.CallParentAllelesPlugin
 
setUseGenotype(useGenotype) - Method in class net.maizegenetics.analysis.association.MLMPlugin
 
setUseGenotype(useGenotype) - Method in class net.maizegenetics.analysis.association.WeightedMLMPlugin
 
setUseHets(useHets) - Method in class net.maizegenetics.analysis.imputation.CallParentAllelesPlugin
 
setUseMultipleBCFilter(useMultipleBCFilter) - Method in class net.maizegenetics.analysis.imputation.CallParentAllelesPlugin
 
setUseP3D(useP3D) - Method in class net.maizegenetics.analysis.association.MLMPlugin
 
setUseP3D(useP3D) - Method in class net.maizegenetics.analysis.association.WeightedMLMPlugin
 
setUseRefProb(useRefProb) - Method in class net.maizegenetics.analysis.association.MLMPlugin
 
setUseRefProb(useRefProb) - Method in class net.maizegenetics.analysis.association.WeightedMLMPlugin
 
setUseVariableTransition(useVariableTransition) - Method in class net.maizegenetics.analysis.imputation.ViterbiAlgorithmPlugin
 
setUseWindowLD(useWindowLD) - Method in class net.maizegenetics.analysis.imputation.CallParentAllelesPlugin
 
setUTA(A) - Method in class net.maizegenetics.stats.linearmodels.SweepFast
 
setValueAt(aValue, rowIndex, columnIndex) - Method in class net.maizegenetics.gui.AlignmentTableModel
No operation.
setValueAt(aValue, rowIndex, columnIndex) - Method in class net.maizegenetics.gui.TableReportNoPagingTableModel
No operation.
setVarCompEst(value) - Method in class net.maizegenetics.analysis.association.MLMPlugin
 
setVarCompEst(value) - Method in class net.maizegenetics.analysis.association.WeightedMLMPlugin
 
setVariableRecombFilename(variableRecombFilename) - Method in class net.maizegenetics.analysis.imputation.ViterbiAlgorithmPlugin
 
setVariantDef(tagIndex, variantIndex, def) - Method in class net.maizegenetics.dna.map.TagsOnPhysicalMap
 
setVariantDef(tagIndex, variantIndex, def) - Method in class net.maizegenetics.dna.map.TagsOnPhysicalMapV3
 
setVariantDef(tagIndex, variantIndex, def) - Method in class net.maizegenetics.dna.map.TagsOnPhysMapHDF5
 
setVariantDef(tagIndex, variantIndex, def) - Method in interface net.maizegenetics.dna.map.TOPMInterface
Set variant definition at given tag and variant index.
setVariantPosOff(tagIndex, variantIndex, offset) - Method in class net.maizegenetics.dna.map.TagsOnPhysicalMap
 
setVariantPosOff(tagIndex, variantIndex, offset) - Method in class net.maizegenetics.dna.map.TagsOnPhysicalMapV3
 
setVariantPosOff(tagIndex, variantIndex, offset) - Method in class net.maizegenetics.dna.map.TagsOnPhysMapHDF5
 
setVariantPosOff(tagIndex, variantIndex, offset) - Method in interface net.maizegenetics.dna.map.TOPMInterface
Set variant position offset at given tag and variant index.
setWindowSize(windowSize) - Method in class net.maizegenetics.analysis.imputation.CallParentAllelesPlugin
 
setWindowSize(newSize, newX, newY, ldMeasureLower, ldMeasureUpper) - Method in class net.maizegenetics.analysis.popgen.LinkageDisequilibriumComponent
This sets a new viewable size
setWindowSize(windowSize, windowX, windowY) - Method in class net.maizegenetics.analysis.popgen.LinkageDisequilibriumMinimapComponent
resets myWindowSize
setWindowX(newX, ldMeasureLower, ldMeasureUpper) - Method in class net.maizegenetics.analysis.popgen.LinkageDisequilibriumComponent
This sets a new X position
setWindowX(windowX) - Method in class net.maizegenetics.analysis.popgen.LinkageDisequilibriumMinimapComponent
resets myWindowX
setWindowY(newY, ldMeasureLower, ldMeasureUpper) - Method in class net.maizegenetics.analysis.popgen.LinkageDisequilibriumComponent
This sets a new Y position
setWindowY(windowY) - Method in class net.maizegenetics.analysis.popgen.LinkageDisequilibriumMinimapComponent
resets myWindowY
setWinSize(winSize) - Method in class net.maizegenetics.analysis.filter.FilterAlignmentPlugin
 
setWinSize(winSize) - Method in class net.maizegenetics.analysis.popgen.LinkageDisequilibriumPlugin
 
setWriteNucleotides(writeNucleotides) - Method in class net.maizegenetics.analysis.imputation.WritePopulationAlignmentPlugin
 
setWriteOutputToFile(writeOutputToFile) - Method in class net.maizegenetics.analysis.association.MLMPlugin
 
setWriteOutputToFile(writeOutputToFile) - Method in class net.maizegenetics.analysis.association.WeightedMLMPlugin
 
setWriteParentCalls(writeParentCalls) - Method in class net.maizegenetics.analysis.imputation.WritePopulationAlignmentPlugin
 
setXStart() - Method in class net.maizegenetics.analysis.popgen.LinkageDisequilibriumComponent
This sets the X start and end positions
setYStart() - Method in class net.maizegenetics.analysis.popgen.LinkageDisequilibriumComponent
This sets the Y start and end positions
sex(val) - Method in class net.maizegenetics.taxa.Taxon.Builder
Set sex: 0=both, 1=female, 2=male (default=0 Both)
SexKey - Static variable in class net.maizegenetics.taxa.Taxon
Standard key for the sex of the taxon
SHORT_UNIT_NAMES - Variable in interface net.maizegenetics.taxa.tree.Units
 
shortenStrLineLen(str, preferredLen) - Static method in class net.maizegenetics.util.Utils
 
shortenStrLineLen(str, preferredLen, preferredLines) - Static method in class net.maizegenetics.util.Utils
 
ShortReadBarcodeResult - Class in net.maizegenetics.analysis.gbs
Container class for returning the results of parsed barcoded sequencing read. The length of read is in short. Max length is 32767 bp.
ShortReadBarcodeResult(read, length, taxon) - Constructor for class net.maizegenetics.analysis.gbs.ShortReadBarcodeResult
 
ShortReadBarcodeResult(sequence) - Constructor for class net.maizegenetics.analysis.gbs.ShortReadBarcodeResult
Construct object with genomic sequence
showDialog() - Method in class net.maizegenetics.pipeline.TasselPipelineStepsDialog
 
showError(str, parent) - Static method in class net.maizegenetics.gui.DialogUtils
 
showError(e, parent) - Static method in class net.maizegenetics.gui.DialogUtils
 
showErrorCause(e, parent) - Static method in class net.maizegenetics.gui.DialogUtils
 
ShowParameterCachePlugin - Class in net.maizegenetics.tassel
This plugin creates a table report of the key / value pairs stored in the @class ParameterCache
ShowParameterCachePlugin(parentFrame, isInteractive) - Constructor for class net.maizegenetics.tassel.ShowParameterCachePlugin
 
showWarning(str, parent) - Static method in class net.maizegenetics.gui.DialogUtils
 
shrinkToCurrentRows() - Method in class net.maizegenetics.dna.tag.TagCountMutable
 
shuffle(anArray) - Static method in class net.maizegenetics.stats.linearmodels.BasicShuffler
 
shuffle(anArray) - Static method in class net.maizegenetics.stats.linearmodels.BasicShuffler
 
shuffle(anArray) - Static method in class net.maizegenetics.stats.linearmodels.BasicShuffler
 
shuffle(anArray) - Static method in class net.maizegenetics.stats.linearmodels.BasicShuffler
 
shuffle(anArray) - Static method in class net.maizegenetics.stats.linearmodels.BasicShuffler
 
shuffle(anArray) - Static method in class net.maizegenetics.stats.linearmodels.BasicShuffler
 
shuffle(source, randomizer) - Static method in class net.maizegenetics.stats.linearmodels.LinearModelUtils
 
shuffle(columnMatrix, randomizer) - Static method in class net.maizegenetics.stats.linearmodels.LinearModelUtils
 
shuffle(array) - Method in class net.maizegenetics.stats.math.MersenneTwisterFast
Shuffles an array.
shuffle(array) - Method in class net.maizegenetics.stats.math.MersenneTwisterFast
Shuffles an array of objects.
shuffle(array, numberOfShuffles) - Method in class net.maizegenetics.stats.math.MersenneTwisterFast
Shuffles an array by repeatedly choosing two random members and swapping them.
shuffled(l) - Method in class net.maizegenetics.stats.math.MersenneTwisterFast
Generates an array of ints that are shuffled
shuffleDouble() - Static method in class net.maizegenetics.stats.linearmodels.BasicShuffler
 
shuffleSubset(startIndex, length, array) - Method in class net.maizegenetics.stats.math.MersenneTwisterFast
Shuffles an array of objects.
sibling - Variable in class net.maizegenetics.analysis.gbs.neobio.Trie
A pointer to this node's next sibling.
sigSiteEnd - Variable in class net.maizegenetics.dna.map.TagGWASMapInfo
Ending significant site on the best chromosome, inclusive, unknown = Integer.MIN_VALUE
sigSiteNum - Variable in class net.maizegenetics.dna.map.TagGeneticMappingInfo
Number of sites passing P-value threshold
sigSiteRange - Variable in class net.maizegenetics.dna.map.TagGeneticMappingInfo
Range of sites passing P-value threshold, for the first significant site to the last
sigSiteStart - Variable in class net.maizegenetics.dna.map.TagGWASMapInfo
Starting significant site on the best chromosome, unknown = Integer.MIN_VALUE
SimpleAllele - Class in net.maizegenetics.dna.snp
Basic implementation of allele. TODO: Consider whether this should be kept. TODO: Should there be a builder? TODO: Should there simple nucleotide one versus other states. Memory could be an important consideration.
SimpleAllele(myAllele, myPosition) - Constructor for class net.maizegenetics.dna.snp.SimpleAllele
 
SimpleGenotypeSBit - Class in net.maizegenetics.analysis.gbs
Store sBit for tag genetic mapping and LD detection, optimized for really fast calculation
SimpleGenotypeSBit(genotypeH5FileS, sBitFileS) - Constructor for class net.maizegenetics.analysis.gbs.SimpleGenotypeSBit
Convert HDF5 Alignment/Genotype file to SimpleGenotypeSBit
SimpleGenotypeSBit(inputfileS) - Constructor for class net.maizegenetics.analysis.gbs.SimpleGenotypeSBit
Read in HDF5 SimpleGenotypeSBit
SimpleNode - Class in net.maizegenetics.taxa.tree
data structure for a node (includes branch) in a binary/non-binary rooted/unrooted tree
SimpleNode() - Constructor for class net.maizegenetics.taxa.tree.SimpleNode
constructor default node
SimpleNode(name, branchLength) - Constructor for class net.maizegenetics.taxa.tree.SimpleNode
 
SimpleNode(children, branchLength) - Constructor for class net.maizegenetics.taxa.tree.SimpleNode
Constructor
SimpleNode(children) - Constructor for class net.maizegenetics.taxa.tree.SimpleNode
 
SimpleNode(n) - Constructor for class net.maizegenetics.taxa.tree.SimpleNode
constructor used to clone a node and all children
SimpleNode(n, keepIds) - Constructor for class net.maizegenetics.taxa.tree.SimpleNode
 
SimpleNode(n, lm) - Constructor for class net.maizegenetics.taxa.tree.SimpleNode
 
SimpleTableReport - Class in net.maizegenetics.util
Created by IntelliJ IDEA. User: ed Date: Sep 28, 2006 Time: 9:37:46 PM
SimpleTableReport(theName, columnNames, theData) - Constructor for class net.maizegenetics.util.SimpleTableReport
 
SimpleTableReport(tr) - Constructor for class net.maizegenetics.util.SimpleTableReport
 
SimpleTree - Class in net.maizegenetics.taxa.tree
data structure for a binary/non-binary rooted/unrooted trees
SimpleTree() - Constructor for class net.maizegenetics.taxa.tree.SimpleTree
constructor tree consisting solely of root node
SimpleTree(r) - Constructor for class net.maizegenetics.taxa.tree.SimpleTree
constructor taking a root node
SimpleTree(tree) - Constructor for class net.maizegenetics.taxa.tree.SimpleTree
clone constructor
SimpleTree(tree, keepIdentifiers) - Constructor for class net.maizegenetics.taxa.tree.SimpleTree
clone constructor
SimpleTree(tree, lm) - Constructor for class net.maizegenetics.taxa.tree.SimpleTree
clone constructor
SingularValueDecomposition - Interface in net.maizegenetics.matrixalgebra.decomposition
 
singularValueDecompositionDgesdd(jobz, m, n, A, lda, S, U, ldu, VT, ldvt) - Static method in class net.maizegenetics.matrixalgebra.Matrix.BlasDoubleMatrix
 
singularValueDecompositionDgesvd(jobu, jobvt, m, n, A, lda, S, U, ldu, VT, ldvt) - Static method in class net.maizegenetics.matrixalgebra.Matrix.BlasDoubleMatrix
 
site(site) - Method in class net.maizegenetics.dna.snp.Translate
 
site1() - Method in class net.maizegenetics.analysis.popgen.LDResult
 
site2() - Method in class net.maizegenetics.analysis.popgen.LDResult
 
SITE_BLOCK_MASK - Static variable in class net.maizegenetics.dna.snp.genotypecall.AlleleFreqCache
 
SITE_DESC - Static variable in class net.maizegenetics.dna.snp.HapMapHDF5Constants
 
SiteAnnotation - Class in net.maizegenetics.dna.pd
User: dkroon Date: 6/26/13 Time: 2:07 PM
SiteAnnotation(aSite, aChromosome, aPosition) - Constructor for class net.maizegenetics.dna.pd.SiteAnnotation
 
siteCount(value) - Method in class net.maizegenetics.analysis.data.HDF5SummaryPlugin
 
siteCount() - Method in class net.maizegenetics.analysis.data.HDF5SummaryPlugin
 
SITECOV - Static variable in class net.maizegenetics.dna.snp.HapMapHDF5Constants
 
SITECOV - Static variable in class net.maizegenetics.util.Tassel5HDF5Constants
 
siteCoverage(val) - Method in class net.maizegenetics.dna.map.GeneralPosition.Builder
Set site coverage annotation (default=Float.NaN)
siteData - Variable in class net.maizegenetics.analysis.association.AbstractFixedEffectLM
 
siteFilter() - Method in class net.maizegenetics.analysis.filter.FilterSiteBuilderPlugin
True if filtering by site numbers. False if filtering by chromosome and position
siteFilter(value) - Method in class net.maizegenetics.analysis.filter.FilterSiteBuilderPlugin
Set Site Filter. True if filtering by site numbers. False if filtering by chromosome and position
siteFilterType() - Method in class net.maizegenetics.dna.snp.FilterSite
 
SITEHET - Static variable in class net.maizegenetics.dna.snp.HapMapHDF5Constants
 
siteIndex - Variable in class net.maizegenetics.analysis.modelfitter.AbstractAdditiveSite
 
siteList - Variable in class net.maizegenetics.analysis.modelfitter.AbstractForwardRegression
 
siteMask(site) - Method in class net.maizegenetics.dna.snp.AbstractMaskMatrix
 
siteMask(site) - Method in class net.maizegenetics.dna.snp.MaskGenotypeMatrix
 
siteMask(site) - Method in class net.maizegenetics.dna.snp.MaskGenotypeStatsMatrix
 
siteMaxAlleleFreq() - Method in class net.maizegenetics.analysis.filter.FilterSiteBuilderPlugin
Site Maximum Minor Allele Frequency
siteMaxAlleleFreq(value) - Method in class net.maizegenetics.analysis.filter.FilterSiteBuilderPlugin
Set Site Max Allele Freq. Site Maximum Minor Allele Frequency
siteMaxAlleleFreq() - Method in class net.maizegenetics.dna.snp.FilterSite
 
siteMinAlleleFreq() - Method in class net.maizegenetics.analysis.filter.FilterSiteBuilderPlugin
Site Minimum Minor Allele Frequency
siteMinAlleleFreq(value) - Method in class net.maizegenetics.analysis.filter.FilterSiteBuilderPlugin
Set Site Min Allele Freq. Site Minimum Minor Allele Frequency
siteMinAlleleFreq() - Method in class net.maizegenetics.dna.snp.FilterSite
 
siteMinCount() - Method in class net.maizegenetics.analysis.filter.FilterSiteBuilderPlugin
Site Minimum Count of Alleles not Unknown
siteMinCount(value) - Method in class net.maizegenetics.analysis.filter.FilterSiteBuilderPlugin
Set Site Min Count. Site Minimum Count of Alleles not Unknown
siteMinCount() - Method in class net.maizegenetics.dna.snp.FilterSite
 
siteName() - Method in class net.maizegenetics.analysis.modelfitter.AbstractAdditiveSite
 
siteName() - Method in interface net.maizegenetics.analysis.modelfitter.AdditiveSite
 
siteName(site) - Method in interface net.maizegenetics.dna.map.PositionList
Get SNP ID for specified site.
siteName(site) - Method in class net.maizegenetics.dna.snp.CombineGenotypeTable
 
siteName(site) - Method in class net.maizegenetics.dna.snp.CoreGenotypeTable
 
siteName(site) - Method in interface net.maizegenetics.dna.snp.GenotypeTable
Get SNP ID for specified site.
siteName(site) - Method in class net.maizegenetics.dna.snp.MergedGenotypeTable
 
siteName(site) - Method in class net.maizegenetics.dna.snp.TOPMGenotypeTable
 
siteNameList() - Method in class net.maizegenetics.plugindef.PluginParameter.Builder
 
siteNames(value) - Method in class net.maizegenetics.analysis.data.HDF5SummaryPlugin
 
siteNames() - Method in class net.maizegenetics.analysis.data.HDF5SummaryPlugin
 
siteNames() - Method in class net.maizegenetics.dna.snp.FilterSite
 
SiteNamesAvailableListModel - Class in net.maizegenetics.gui
 
SiteNamesAvailableListModel(positions) - Constructor for class net.maizegenetics.gui.SiteNamesAvailableListModel
 
siteNamesList() - Method in class net.maizegenetics.analysis.filter.FilterSiteBuilderPlugin
Site Names List
siteNamesList(value) - Method in class net.maizegenetics.analysis.filter.FilterSiteBuilderPlugin
Set Site Names List. Site Names List
siteNum - Variable in class net.maizegenetics.analysis.gbs.SimpleGenotypeSBit
 
siteNumber() - Method in class net.maizegenetics.analysis.modelfitter.AbstractAdditiveSite
 
siteNumber() - Method in interface net.maizegenetics.analysis.modelfitter.AdditiveSite
 
siteOfPhysicalPosition(physicalPosition, chromosome) - Method in interface net.maizegenetics.dna.map.PositionList
Return site of given physical position in chromosome. If the physical position doesn't exist, (-(insertion point) - 1) is returned. If chromosome is not found, an exception is thrown.
siteOfPhysicalPosition(physicalPosition, chromosome, snpName) - Method in interface net.maizegenetics.dna.map.PositionList
Return site of given physical position / SNP ID in chromosome. If the physical position doesn't exist, (-(insertion point) - 1) is returned. If chromosome is not found, an exception is thrown. This is to support multiple sites with the same physical position but different SNP IDs.
siteOfPhysicalPosition(physicalPosition, locus) - Method in class net.maizegenetics.dna.snp.CombineGenotypeTable
 
siteOfPhysicalPosition(physicalPosition, locus, snpName) - Method in class net.maizegenetics.dna.snp.CombineGenotypeTable
 
siteOfPhysicalPosition(physicalPosition, chromosome) - Method in class net.maizegenetics.dna.snp.CoreGenotypeTable
 
siteOfPhysicalPosition(physicalPosition, chromosome, snpName) - Method in class net.maizegenetics.dna.snp.CoreGenotypeTable
 
siteOfPhysicalPosition(physicalPosition, chromosome) - Method in interface net.maizegenetics.dna.snp.GenotypeTable
Return site of given physical position in chromosome. If the physical position doesn't exist, (-(insertion point) - 1) is returned. If chromosome is not found, an exception is thrown.
siteOfPhysicalPosition(physicalPosition, chromosome, snpName) - Method in interface net.maizegenetics.dna.snp.GenotypeTable
Return site of given physical position / SNP ID in chromosome. If the physical position doesn't exist, (-(insertion point) - 1) is returned. If chromosome is not found, an exception is thrown. This is to support multiple sites with the same physical position but different SNP IDs.
siteOfPhysicalPosition(physicalPosition, chromosome) - Method in class net.maizegenetics.dna.snp.MergedGenotypeTable
 
siteOfPhysicalPosition(physicalPosition, chromosome, snpName) - Method in class net.maizegenetics.dna.snp.MergedGenotypeTable
 
siteOfPhysicalPosition(physicalPosition, chromosome) - Method in class net.maizegenetics.dna.snp.TOPMGenotypeTable
 
siteOfPhysicalPosition(physicalPosition, chromosome, snpName) - Method in class net.maizegenetics.dna.snp.TOPMGenotypeTable
 
siteReport() - Method in class net.maizegenetics.analysis.association.AbstractFixedEffectLM
 
siteReport() - Method in interface net.maizegenetics.analysis.association.FixedEffectLM
 
siteReportBuilder - Variable in class net.maizegenetics.analysis.association.AbstractFixedEffectLM
 
siteReportColumnNames() - Method in class net.maizegenetics.analysis.association.AbstractFixedEffectLM
 
siteReportColumnNames() - Method in class net.maizegenetics.analysis.association.ReferenceProbabilityFELM
 
siteReportFilename - Variable in class net.maizegenetics.analysis.association.AbstractFixedEffectLM
 
siteReportFilename() - Method in class net.maizegenetics.analysis.association.FixedEffectLMPlugin
The name of the file to which these results will be saved.
siteReportFilename(value) - Method in class net.maizegenetics.analysis.association.FixedEffectLMPlugin
Set Statistics File. The name of the file to which these results will be saved.
siteReportFilepath(savefile) - Method in class net.maizegenetics.analysis.association.AbstractFixedEffectLM
 
siteReportFilepath(savefile) - Method in interface net.maizegenetics.analysis.association.FixedEffectLM
 
SiteScore - Interface in net.maizegenetics.dna.snp.score
 
SiteScore.SITE_SCORE_TYPE - Enum in net.maizegenetics.dna.snp.score
 
SiteScoresIO - Class in net.maizegenetics.dna.snp.io
 
siteScoreType() - Method in class net.maizegenetics.dna.snp.byte2d.AbstractByte2D
 
siteScoreType() - Method in interface net.maizegenetics.dna.snp.byte2d.Byte2D
 
siteScoreTypes() - Method in class net.maizegenetics.dna.snp.CombineGenotypeTable
 
siteScoreTypes() - Method in class net.maizegenetics.dna.snp.CoreGenotypeTable
 
siteScoreTypes() - Method in interface net.maizegenetics.dna.snp.GenotypeTable
Return the site scores types that have value for this genotype table.
siteScoreTypes() - Method in class net.maizegenetics.dna.snp.MergedGenotypeTable
 
siteScoreTypes() - Method in class net.maizegenetics.dna.snp.score.AlleleDepth
 
siteScoreTypes() - Method in class net.maizegenetics.dna.snp.score.AlleleProbability
 
siteScoreTypes() - Method in class net.maizegenetics.dna.snp.score.Dosage
 
siteScoreTypes() - Method in class net.maizegenetics.dna.snp.score.ReferenceProbability
 
siteScoreTypes() - Method in interface net.maizegenetics.dna.snp.score.SiteScore
Return the site scores types.
siteScoreTypes() - Method in class net.maizegenetics.dna.snp.TOPMGenotypeTable
 
SiteScoreUtil - Class in net.maizegenetics.dna.snp.score
 
siteStatFilename() - Method in class net.maizegenetics.analysis.association.FixedEffectLMPlugin
Site Stat File
siteStatFilename(value) - Method in class net.maizegenetics.analysis.association.FixedEffectLMPlugin
Set Site Stat File. Site Stat File
siteStats(site) - Method in interface net.maizegenetics.dna.snp.genotypecall.GenotypeCallTable
 
siteStatsFile - Variable in class net.maizegenetics.analysis.association.AbstractFixedEffectLM
 
siteStatsFile(filename) - Method in class net.maizegenetics.analysis.association.AbstractFixedEffectLM
 
siteStatsFile(filename) - Method in interface net.maizegenetics.analysis.association.FixedEffectLM
 
siteStatsOutput() - Method in class net.maizegenetics.analysis.association.FixedEffectLMPlugin
Generate an output dataset with only p-val, F statistic, and number of obs per site for all sites.
siteStatsOutput(value) - Method in class net.maizegenetics.analysis.association.FixedEffectLMPlugin
Set Output Site Stats. Generate an output dataset with only p-val, F statistic, and number of obs per site for all sites.
sitesToKeep() - Method in class net.maizegenetics.analysis.filter.FilterSubsetPlugin
 
siteSubset() - Method in class net.maizegenetics.analysis.filter.FilterSubsetPlugin
 
siteSummary() - Method in class net.maizegenetics.analysis.data.GenotypeSummaryPlugin
Get Site Summary
siteSummary(value) - Method in class net.maizegenetics.analysis.data.GenotypeSummaryPlugin
Set Site Summary. Get Site Summary
siteTableReportRows - Variable in class net.maizegenetics.analysis.association.AbstractFixedEffectLM
 
siteTranslations() - Method in class net.maizegenetics.dna.snp.CombineGenotypeTable
 
siteTranslations() - Method in class net.maizegenetics.dna.snp.CoreGenotypeTable
 
siteTranslations() - Method in interface net.maizegenetics.dna.snp.GenotypeTable
 
siteTranslations() - Method in class net.maizegenetics.dna.snp.MergedGenotypeTable
 
siteTranslations() - Method in class net.maizegenetics.dna.snp.TOPMGenotypeTable
 
siteTranslations() - Method in class net.maizegenetics.dna.snp.Translate
 
size() - Method in class net.maizegenetics.analysis.avro.GenericArrayPositions
 
size() - Method in class net.maizegenetics.analysis.avro.GenericArrayTaxa
 
size() - Method in class net.maizegenetics.analysis.avro.GenericMapAnnotations
 
size() - Method in class net.maizegenetics.dna.map.PositionListBuilder
Returns the size (number of positions) in the current list
size() - Method in class net.maizegenetics.dna.snp.FilterList
 
size() - Method in class net.maizegenetics.dna.snp.genotypecall.ListStats
 
size - Variable in class net.maizegenetics.matrixalgebra.Matrix.BlasDoubleMatrix
 
size() - Method in class net.maizegenetics.phenotype.CategoricalAttribute
 
size() - Method in class net.maizegenetics.phenotype.NumericAttribute
 
size() - Method in interface net.maizegenetics.phenotype.PhenotypeAttribute
 
size() - Method in class net.maizegenetics.phenotype.TaxaAttribute
 
size() - Method in interface net.maizegenetics.util.BitSet
Returns the current capacity of this set. Included for compatibility. This is *not* equal to net.maizegenetics.util.BitSet$cardinality()
size() - Method in class net.maizegenetics.util.db.DefaultDBTuple
 
size() - Method in class net.maizegenetics.util.DirectedGraph
 
size(weighted) - Method in class net.maizegenetics.util.DirectedGraph
 
size() - Method in interface net.maizegenetics.util.Graph
Gets the number of edges in the graph
size(weighted) - Method in interface net.maizegenetics.util.Graph
Gets the sum of edges in the graph
size() - Method in class net.maizegenetics.util.OpenBitSet
Returns the current capacity of this set. Included for compatibility. This is *not* equal to net.maizegenetics.util.OpenBitSet$cardinality()
size() - Method in class net.maizegenetics.util.UndirectedGraph
 
size(weighted) - Method in class net.maizegenetics.util.UndirectedGraph
 
size() - Method in class net.maizegenetics.util.UndirectedGraph.UndirectedSet
 
size() - Method in class net.maizegenetics.util.UnmodifiableBitSet
 
Sizeof - Class in net.maizegenetics.util
 
skipWhiteSpace(in) - Method in class net.maizegenetics.util.FormattedInput
go to first non-whitespace character
slice(inputFileName, sequences) - Static method in class net.maizegenetics.dna.tag.TagsByTaxaUtils
 
smawk - Variable in class net.maizegenetics.analysis.gbs.neobio.CrochemoreLandauZivUkelson
An instance of the Smawk class that implements the SMAWK algorithm to compute the column maxima of a totally monotone matrix. It is used to speed up the computation of the output border of a block.
Smawk - Class in net.maizegenetics.analysis.gbs.neobio
This class implement the SMAWK algorithm to compute column maxima on a totally monotone matrix as described.
SmithWaterman - Class in net.maizegenetics.analysis.gbs.neobio
This class implement the classic local alignment algorithm (with linear gap penalty function) due to T.F.Smith and M.S.Waterman (1981).
SmithWaterman - Class in net.maizegenetics.analysis.gbs
This class implement the classic local alignment algorithm (with linear gap penalty function) due to T.F.Smith and M.S.Waterman (1981).
SmithWaterman() - Constructor for class net.maizegenetics.analysis.gbs.SmithWaterman
 
SmithWaterman(rows, cols) - Constructor for class net.maizegenetics.analysis.gbs.SmithWaterman
 
SmithWaterman(b1, b2) - Constructor for class net.maizegenetics.analysis.gbs.SmithWaterman
 
SMTPClient - Class in net.maizegenetics.util
This class can be used to send email. When the host is "appsmtp.mail.cornell.edu", any machine within the Cornell network can be used to send an email. Reference: https://confluence.cornell.edu/login.action?os_destination=https%3A%2F%2Fconfluence.cornell.edu%2Fdisplay%2Fcitapps%2FHow%2Bto%2Bconfigure%2Bapplications%2Bto%2Bsend%2Bmail%2Bthrough%2Bthe%2BCornell%2Bmail%2Bservers.
SMTPClient(host, toAddresses) - Constructor for class net.maizegenetics.util.SMTPClient
 
SNP - Class in net.maizegenetics.analysis.modelfitter
 
SNP(name, locus, positionInLocus, index) - Constructor for class net.maizegenetics.analysis.modelfitter.SNP
 
SNP() - Constructor for class net.maizegenetics.analysis.modelfitter.SNP
 
SNP_IDS - Static variable in class net.maizegenetics.dna.snp.HapMapHDF5Constants
 
SNP_IDS - Static variable in class net.maizegenetics.util.Tassel5HDF5Constants
 
SNPCutPosTagVerificationPlugin - Class in net.maizegenetics.analysis.gbs.v2
This class allows a user to specify a Cut or SNP position for which they would like data printed. For a Cut Position, the tags associated with that position are printed along with the number of times it appears in each taxa. For a SNP Position, each allele and the tags associated with that allele are printed along with the number of times the tag appears in each taxa. The tag is shown both as it is stored in the db, and as a forward strand. The SNP alignments are based on forward strand.
SNPCutPosTagVerificationPlugin() - Constructor for class net.maizegenetics.analysis.gbs.v2.SNPCutPosTagVerificationPlugin
 
SNPCutPosTagVerificationPlugin(parentFrame) - Constructor for class net.maizegenetics.analysis.gbs.v2.SNPCutPosTagVerificationPlugin
 
SNPCutPosTagVerificationPlugin(parentFrame, isInteractive) - Constructor for class net.maizegenetics.analysis.gbs.v2.SNPCutPosTagVerificationPlugin
 
snpIndex - Variable in class net.maizegenetics.analysis.imputation.PopulationData
 
SNPLogging - Class in net.maizegenetics.analysis.gbs
 
SNPLogging(filename, creator) - Constructor for class net.maizegenetics.analysis.gbs.SNPLogging
 
snpName(val) - Method in class net.maizegenetics.dna.map.GeneralPosition.Builder
Set SNP name (default="S"+Chromosome+"_"+position)
snpPosToIDMap - Variable in class net.maizegenetics.dna.tag.RepGenSQLite
 
snpPosToIDMap - Variable in class net.maizegenetics.dna.tag.TagDataSQLite
 
SNPQualityProfilerPlugin - Class in net.maizegenetics.analysis.gbs.v2
Scores all discovered SNPs for various coverage, depth, and genotypic statistics for a given set of taxa (samples). For each subset of taxa, there are expectations for segregation that can be used to determine whether the SNP is behaving appropriately.
SNPQualityProfilerPlugin() - Constructor for class net.maizegenetics.analysis.gbs.v2.SNPQualityProfilerPlugin
 
SNPQualityProfilerPlugin(parentFrame, isInteractive) - Constructor for class net.maizegenetics.analysis.gbs.v2.SNPQualityProfilerPlugin
 
snpsAsFloatVector(alleles, nsnps) - Static method in class net.maizegenetics.analysis.imputation.ImputationUtils
 
solve() - Method in class net.maizegenetics.analysis.association.AbstractFixedEffectLM
 
solve() - Method in class net.maizegenetics.analysis.association.CompressedMLMusingDoubleMatrix
 
solve() - Method in interface net.maizegenetics.analysis.association.FixedEffectLM
Solves the linear model
solve() - Method in class net.maizegenetics.analysis.association.PhenotypeLM
 
solve() - Method in class net.maizegenetics.analysis.association.RegRidgeEmmaDoubleMatrix
Solve the mixed model for line GEBVs and marker estimates
solve(Y) - Method in class net.maizegenetics.matrixalgebra.Matrix.BlasDoubleMatrix
 
solve(Y) - Method in class net.maizegenetics.matrixalgebra.Matrix.ColtDoubleMatrix
 
solve(Y) - Method in interface net.maizegenetics.matrixalgebra.Matrix.DoubleMatrix
 
solve(Y) - Method in class net.maizegenetics.matrixalgebra.Matrix.EJMLDoubleMatrix
 
solve() - Method in class net.maizegenetics.stats.EMMA.EMMAforDoubleMatrix
 
SolveByOrthogonalizing - Class in net.maizegenetics.stats.linearmodels
 
SolveByOrthogonalizing.Marker - Class in net.maizegenetics.stats.linearmodels
 
solveForR(marker) - Method in class net.maizegenetics.stats.linearmodels.SolveByOrthogonalizing
 
solveForR(pos, values) - Method in class net.maizegenetics.stats.linearmodels.SolveByOrthogonalizing
 
solveForR(pos, add, dom) - Method in class net.maizegenetics.stats.linearmodels.SolveByOrthogonalizing
 
solveLSdgelsd(A, Arows, Acols, B, Bcols, rcond, rank) - Static method in class net.maizegenetics.matrixalgebra.Matrix.BlasDoubleMatrix
 
solveLSdgelsy(A, Arows, Acols, B, Bcols, rcond, rank) - Static method in class net.maizegenetics.matrixalgebra.Matrix.BlasDoubleMatrix
 
solveWithNewData(y) - Method in class net.maizegenetics.stats.EMMA.EMMAforDoubleMatrix
 
son - Variable in class net.maizegenetics.analysis.gbs.neobio.Trie
A pointer to the first of this node's children.
sort() - Method in class net.maizegenetics.dna.map.PETagsOnPhysicalMapV3
Sort the class based on 64 bp tags
sort() - Method in class net.maizegenetics.dna.map.PositionListBuilder
 
sort() - Method in class net.maizegenetics.dna.tag.AbstractPETags
sort PE tags by Long primitive data type value
sort() - Method in class net.maizegenetics.dna.tag.AbstractTags
 
sort() - Method in class net.maizegenetics.dna.tag.AbstractTagsHDF5
 
sort() - Method in class net.maizegenetics.dna.tag.TagCounts
 
sortAlphabetically() - Method in class net.maizegenetics.taxa.TaxaListBuilder
 
sortByOrder() - Method in class net.maizegenetics.dna.tag.UTagPairs
 
sortByPosition() - Method in class net.maizegenetics.dna.map.TagsOnGeneticMap
Sort TOGM by genetic position
sortBySeq() - Method in class net.maizegenetics.dna.tag.UTagPairs
 
sortClusters() - Method in class net.maizegenetics.analysis.clustering.HaplotypeClusterer
Sorts clusters according to HaplotypeCluster sort order.
SortGenotypeFilePlugin - Class in net.maizegenetics.analysis.data
Created by jgw87 on 6/5/14. This plugin takes a Hapmap or VCF genotype file and sorts it according to TASSEL's conventions which rely on the position, locus (chromosome), strand, and SNP name (to facilitate searching).
SortGenotypeFilePlugin(parentFrame, isInteractive) - Constructor for class net.maizegenetics.analysis.data.SortGenotypeFilePlugin
 
SortGenotypeFilePlugin.SupportedFileTypes - Enum in net.maizegenetics.analysis.data
 
sortPositions() - Method in class net.maizegenetics.analysis.data.FileLoadPlugin
Whether to sort genotype positions if that's possible.
sortPositions(value) - Method in class net.maizegenetics.analysis.data.FileLoadPlugin
Set Sort Positions. Whether to sort genotype positions if that's possible.
sortPositions() - Method in class net.maizegenetics.analysis.data.PlinkLoadPlugin
Whether to sort genotype positions.
sortPositions(value) - Method in class net.maizegenetics.analysis.data.PlinkLoadPlugin
Set Sort Positions. Whether to sort genotype positions.
sortPositions(genotypes) - Method in class net.maizegenetics.dna.map.PositionListBuilder
 
sortPositions() - Method in class net.maizegenetics.dna.map.PositionListBuilder
 
sortPositions() - Method in class net.maizegenetics.dna.snp.io.BuilderFromHapMap
Set the builder so that when built it will sort positions.
sortPositions() - Method in class net.maizegenetics.dna.snp.io.BuilderFromPLINK
Set the builder so that when built it will sort the positions.
sortTable(byHaplotype) - Method in class net.maizegenetics.dna.map.TagsOnPhysicalMap
 
sortTable(byHaplotype) - Method in class net.maizegenetics.dna.map.TagsOnPhysicalMapV3
 
sortTaxa() - Method in class net.maizegenetics.dna.snp.GenotypeTableBuilder
Set the builder so that when built it will sort the taxa
sortTaxa() - Method in class net.maizegenetics.dna.snp.io.BuilderFromHapMap
Set the builder so that when built it will sort the taxa alphabetically.
sortTaxa() - Method in class net.maizegenetics.dna.snp.io.BuilderFromPLINK
Set the builder so that when built it will sort the taxa
sortTaxaAlphabetically(genotypes) - Method in class net.maizegenetics.taxa.TaxaListBuilder
 
sortTaxaAlphabetically() - Method in class net.maizegenetics.taxa.TaxaListBuilder
 
SortTaxaAlphabeticallyPlugin - Class in net.maizegenetics.analysis.data
 
SortTaxaAlphabeticallyPlugin(parentFrame, isInteractive) - Constructor for class net.maizegenetics.analysis.data.SortTaxaAlphabeticallyPlugin
 
soundex2(s1, ignoreCase, ignoreWhite, ignorePunc) - Static method in class net.maizegenetics.taxa.IdentifierSynonymizer
 
source_path - Variable in class net.maizegenetics.analysis.gbs.neobio.AlignmentBlock
An array of indexes to the source of the highest scoring path for each entry in the output border.
space(size, c) - Static method in class net.maizegenetics.util.FormattedOutput
returns of string of a given length of a single character.
sparsity(inputFileName, format) - Static method in class net.maizegenetics.dna.tag.TagsByTaxaUtils
Write out only the taxa that match a list of names
SpeciesKey - Static variable in class net.maizegenetics.taxa.Taxon
Standard key for a species of the taxon
spellDown(c) - Method in class net.maizegenetics.analysis.gbs.neobio.Trie
Follows a path from this node to one of its children by spelling the character supplied as an argument. If there is no such a path, null is returned. Otherwise, the reached child node is returned.
spellRight(c) - Method in class net.maizegenetics.analysis.gbs.neobio.Trie
Follows a path from this node to one of its sibling by spelling the character supplied as an argument. If there is no such a path, null is returned. Otherwise, the reached sibling node is returned.
spliterator() - Method in class net.maizegenetics.util.SuperByteMatrixMultiple
 
spliterator() - Method in class net.maizegenetics.util.SuperByteMatrixSingle
 
spliterator() - Method in class net.maizegenetics.util.SuperByteMatrixSingleValue
 
SplitFile_IFLFilePlugin - Class in net.maizegenetics.analysis.gobii
 
SplitFile_IFLFilePlugin(parentFrame, isInteractive) - Constructor for class net.maizegenetics.analysis.gobii.SplitFile_IFLFilePlugin
 
SplitFile_IFLFilePlugin() - Constructor for class net.maizegenetics.analysis.gobii.SplitFile_IFLFilePlugin
 
SplitHDF5ByChromosomePlugin - Class in net.maizegenetics.analysis.data
 
SplitHDF5ByChromosomePlugin() - Constructor for class net.maizegenetics.analysis.data.SplitHDF5ByChromosomePlugin
 
SplitHDF5ByChromosomePlugin(parentFrame, isInteractive) - Constructor for class net.maizegenetics.analysis.data.SplitHDF5ByChromosomePlugin
 
splitIFLFile(infile, outdir, maxSize) - Static method in class net.maizegenetics.analysis.gobii.GOBII_IFLUtils
This method is created to break up very large files that GOBII can't handle. For example: one dataset has 83M+ lines. Takes GOBII overnight just to load the marker_linkage_group or dataset_marker data. Yaw suggests we break it into files of size 10M. So pass in the file, give an output directory, and split the file into smaller files. Each smaller file must retain the header, and it must end with the same table name (e.g. DS_4.marker_linkage_gropu must still
SplitSystem - Class in net.maizegenetics.taxa.tree
data structure for a set of splits
SplitSystem(idGroup, size) - Constructor for class net.maizegenetics.taxa.tree.SplitSystem
 
splitTable(table) - Method in class net.maizegenetics.analysis.chart.XYScatterAndLinePanel
 
splitTagBlockPositionPlugin() - Method in class net.maizegenetics.analysis.gbs.pana.PanAUsageExample
 
splitTBTPlugin() - Method in class net.maizegenetics.analysis.gbs.pana.PanAUsageExample
 
SplitUtils - Class in net.maizegenetics.taxa.tree
utilities for split systems
SQL - Class in net.maizegenetics.util.db
Set of utilities for working with JDBC User: julian3 Date: 2013/11/10 Time: 7:14 PM PROJECT: ${PROJECT} DESCRIPTION: Code Borrowed from http://java.dzone.com/articles/adding-java-8-lambda-goodness Original package can be downloaded from https://github.com/jexenberger/lambda-tuples
SQLAction<T> - Interface in net.maizegenetics.util.db
Created with IntelliJ IDEA. User: julian3 Date: 2013/12/05 Time: 3:28 PM To change this template use File | Settings | File Templates. Description: Code Borrowed from http://java.dzone.com/articles/adding-java-8-lambda-goodness Original package can be downloaded from https://github.com/jexenberger/lambda-tuples
squaredDistance(mat, weighted) - Method in class net.maizegenetics.taxa.distance.DistanceMatrix
compute squared distance to second distance matrix
squaredDistance(mat1, mat2, weighted) - Static method in class net.maizegenetics.taxa.distance.DistanceMatrixUtils
compute squared distance to second distance matrix. If both matrices have the same size it is assumed that the order of the taxa is identical.
src_dataset() - Method in class net.maizegenetics.analysis.gobii.HapBreakpoints_IFLFilePlugin
Name of the dataset from which these breakpoints were created. Must match an existing name in the dataset table.
src_dataset(value) - Method in class net.maizegenetics.analysis.gobii.HapBreakpoints_IFLFilePlugin
Set src_dataset. Name of the dataset from which these breakpoints were created. Must match an existing name in the dataset table,
ssError - Variable in class net.maizegenetics.stats.EMMA.EMMAforDoubleMatrix
 
ssModel - Variable in class net.maizegenetics.stats.EMMA.EMMAforDoubleMatrix
 
SST - Variable in class net.maizegenetics.stats.EMMA.EMMAforDoubleMatrix
 
standardize() - Method in class net.maizegenetics.analysis.numericaltransform.TransformDataDialog
 
standardize(original) - Method in class net.maizegenetics.analysis.numericaltransform.TransformDataPlugin
 
standardize(original, byFactors) - Method in class net.maizegenetics.analysis.numericaltransform.TransformDataPlugin
 
start() - Method in class net.maizegenetics.dna.map.GenomeFeature
 
start(start) - Method in class net.maizegenetics.dna.map.GenomeFeatureBuilder
 
start(start) - Method in class net.maizegenetics.dna.map.GenomeFeatureBuilder
 
start() - Method in class net.maizegenetics.dna.snp.io.ReadBedfile.BedFileRange
Returns start position (inclusive)
startAndEndOfChromosome(chromosome) - Method in interface net.maizegenetics.dna.map.PositionList
Get the first (inclusive) and last (inclusive) site of the specified chromosome in this alignment.
startAsString() - Method in class net.maizegenetics.dna.map.GenomeFeature
 
startBlock - Variable in class net.maizegenetics.analysis.popgen.DonorHypoth
 
startChr() - Method in class net.maizegenetics.analysis.filter.FilterSiteBuilderPlugin
Start Chr
startChr(value) - Method in class net.maizegenetics.analysis.filter.FilterSiteBuilderPlugin
Set Start Chr. Start Chr
startChr() - Method in class net.maizegenetics.dna.snp.FilterSite
 
startChromosome() - Method in class net.maizegenetics.analysis.gbs.DiscoverySNPCallerPlugin
Start Chromosome
startChromosome(value) - Method in class net.maizegenetics.analysis.gbs.DiscoverySNPCallerPlugin
Set Start Chromosome. Start Chromosome
startChromosome() - Method in class net.maizegenetics.analysis.gbs.UTagPairToTOPMPlugin
Chromosome to start numbering at
startChromosome(value) - Method in class net.maizegenetics.analysis.gbs.UTagPairToTOPMPlugin
Set Start chromosome. Chromosome to start numbering at
startChromosome() - Method in class net.maizegenetics.analysis.gbs.v2.DiscoverySNPCallerPluginV2
Start Chromosome
startChromosome(value) - Method in class net.maizegenetics.analysis.gbs.v2.DiscoverySNPCallerPluginV2
Set Start Chromosome. Start Chromosome
startLambda() - Method in class net.maizegenetics.analysis.numericaltransform.BoxCoxTransformationPlugin
Start Lambda
startLambda(value) - Method in class net.maizegenetics.analysis.numericaltransform.BoxCoxTransformationPlugin
Set Start Lambda. Start Lambda
startLine() - Method in class net.maizegenetics.analysis.phg.ParseGVCF.ProcessLines
 
startPos() - Method in class net.maizegenetics.analysis.filter.FilterSiteBuilderPlugin
Start Pos
startPos(value) - Method in class net.maizegenetics.analysis.filter.FilterSiteBuilderPlugin
Set Start Pos. Start Pos
startPos() - Method in class net.maizegenetics.dna.snp.FilterSite
 
startPos - Variable in class net.maizegenetics.plugindef.GenerateRCode.PositionVectors
 
startPosition() - Method in class net.maizegenetics.analysis.phg.ParseGVCF.GVCFLine
Start physical position (inclusive)
startPosition - Variable in class net.maizegenetics.dna.map.TagMappingInfo
Chromosomal position of the barcoded end of the tag
startPosition - Variable in class net.maizegenetics.dna.map.TagMappingInfoV3
Chromosomal position of the barcoded end of the tag, unknown = Integer.MIN_VALUE
startSite() - Method in class net.maizegenetics.analysis.filter.FilterSiteBuilderPlugin
Start Site
startSite(value) - Method in class net.maizegenetics.analysis.filter.FilterSiteBuilderPlugin
Set Start Site. Start Site
startSite - Variable in class net.maizegenetics.analysis.popgen.DonorHypoth
 
startSite() - Method in class net.maizegenetics.analysis.popgen.SequenceDiversityPlugin
Start Site
startSite(value) - Method in class net.maizegenetics.analysis.popgen.SequenceDiversityPlugin
Set Start Site. Start Site
startSite() - Method in class net.maizegenetics.dna.snp.FilterSite
 
state - Variable in exception net.maizegenetics.util.db.DataAccessException
 
stateChanged(e) - Method in class net.maizegenetics.gui.AlignmentTableModel
 
statesFile() - Method in class net.maizegenetics.analysis.imputation.ImputeProgenyStatesPlugin
The output file containing the new progeny states (parentcalls) in hapmap format
statesFile(value) - Method in class net.maizegenetics.analysis.imputation.ImputeProgenyStatesPlugin
Set Progeny States Output File. The output file containing the new progeny states (parentcalls) in hapmap format
statFile() - Method in class net.maizegenetics.analysis.gbs.v2.SNPQualityProfilerPlugin
Name of output file (e.g. GBSv2.db)
statFile(value) - Method in class net.maizegenetics.analysis.gbs.v2.SNPQualityProfilerPlugin
Set GBS DB File. Name of output file (e.g. GBSv2.db)
statNames() - Method in class net.maizegenetics.analysis.gobii.GWAS_IFLPlugin
Comma separated list of column names from which to pull data. These names must match values in the statistics field of the gwas_method table for the specified method name.
statNames(value) - Method in class net.maizegenetics.analysis.gobii.GWAS_IFLPlugin
Set Statistic Names. Comma separated list of column names from which to pull data. These names must match values in the statistics field of the gwas_method table for the specified method name.
Stats - Class in net.maizegenetics.dna.snp.genotypecall
 
STATS_HEADER_CHR - Static variable in class net.maizegenetics.analysis.association.AssociationConstants
 
STATS_HEADER_MARKER - Static variable in class net.maizegenetics.analysis.association.AssociationConstants
 
STATS_HEADER_P_VALUE - Static variable in class net.maizegenetics.analysis.association.AssociationConstants
 
STATS_HEADER_POSITION - Static variable in class net.maizegenetics.analysis.association.AssociationConstants
 
STATS_HEADER_TRAIT - Static variable in class net.maizegenetics.analysis.association.AssociationConstants
 
stepLambda() - Method in class net.maizegenetics.analysis.numericaltransform.BoxCoxTransformationPlugin
Step Lambda
stepLambda(value) - Method in class net.maizegenetics.analysis.numericaltransform.BoxCoxTransformationPlugin
Set Step Lambda. Step Lambda
stepSize() - Method in class net.maizegenetics.analysis.data.FindInversionsPlugin
Step Size
stepSize(value) - Method in class net.maizegenetics.analysis.data.FindInversionsPlugin
Set Step Size. Step Size
stepSize() - Method in class net.maizegenetics.analysis.distance.VCAPScanPlugin
Step Size
stepSize(value) - Method in class net.maizegenetics.analysis.distance.VCAPScanPlugin
Set Step Size. Step Size
stepSize() - Method in class net.maizegenetics.analysis.popgen.SequenceDiversityPlugin
Step Size
stepSize(value) - Method in class net.maizegenetics.analysis.popgen.SequenceDiversityPlugin
Set Step Size. Step Size
StepwiseAddDomModelFitter - Class in net.maizegenetics.analysis.modelfitter
Fits an additive plus dominance model in a stepwise fashion. See StepwiseAdditiveModelFitter for a desription of outputs available.
StepwiseAddDomModelFitter(genopheno, datasetName) - Constructor for class net.maizegenetics.analysis.modelfitter.StepwiseAddDomModelFitter
 
StepwiseAdditiveModelFitter - Class in net.maizegenetics.analysis.modelfitter
A multi-threaded stepwise model fitter for additive only models. To use it first construct an object then call runAnalysis(). After the analysis has run, any of several reports will be available using getters. If a permutation test is requested it is run first. The analysis then fits SNPs consecutively, then rescans the full model to determine if any of the SNPs has a better choice given all the other SNPs in the model. As part of the rescan it calculates a support interval for each of the SNPs. Reports available include the steps taken to fit the model with sequential p-values, an anova with marginal p-values, a report of marker effects, a post-scan anova, post-scan marker effects, and a permutation report. It will also output a list of model residuals by chromosome. For each chromosome, it reports the residuals from a model that includes all effects, except the markers on that chromosome.
StepwiseAdditiveModelFitter(genopheno, datasetName) - Constructor for class net.maizegenetics.analysis.modelfitter.StepwiseAdditiveModelFitter
 
StepwiseAdditiveModelFitterPlugin - Class in net.maizegenetics.analysis.modelfitter
 
StepwiseAdditiveModelFitterPlugin() - Constructor for class net.maizegenetics.analysis.modelfitter.StepwiseAdditiveModelFitterPlugin
 
StepwiseAdditiveModelFitterPlugin(parentFrame, isInteractive) - Constructor for class net.maizegenetics.analysis.modelfitter.StepwiseAdditiveModelFitterPlugin
 
StepwiseOLSModelFitter - Class in net.maizegenetics.analysis.modelfitter
 
StepwiseOLSModelFitter(genoPheno, datasetName) - Constructor for class net.maizegenetics.analysis.modelfitter.StepwiseOLSModelFitter
 
StepwiseOLSModelFitter.MODEL_TYPE - Enum in net.maizegenetics.analysis.modelfitter
 
StepwiseOLSModelFitter.VIF_TYPE - Enum in net.maizegenetics.analysis.modelfitter
 
StepwiseOLSModelFitterPlugin - Class in net.maizegenetics.analysis.modelfitter
Stepwise Ordinary Least Squares model fitter
StepwiseOLSModelFitterPlugin(parentFrame, isInteractive) - Constructor for class net.maizegenetics.analysis.modelfitter.StepwiseOLSModelFitterPlugin
 
StepwiseOLSModelFitterPlugin() - Constructor for class net.maizegenetics.analysis.modelfitter.StepwiseOLSModelFitterPlugin
 
stop() - Method in class net.maizegenetics.dna.map.GenomeFeature
 
stop(stop) - Method in class net.maizegenetics.dna.map.GenomeFeatureBuilder
 
stop(stop) - Method in class net.maizegenetics.dna.map.GenomeFeatureBuilder
 
STOP_DIRECTION - Static variable in class net.maizegenetics.analysis.gbs.neobio.CrochemoreLandauZivUkelson
A constant that indicates that the source of an optimal path has been reached in a block and that the trace back procedure to retrieve a high scoring alignment can stop.
stopAsString() - Method in class net.maizegenetics.dna.map.GenomeFeature
 
strand() - Method in class net.maizegenetics.analysis.gbs.v2.SNPCutPosTagVerificationPlugin
Strand direction
strand(value) - Method in class net.maizegenetics.analysis.gbs.v2.SNPCutPosTagVerificationPlugin
Set strand direction.
strand(val) - Method in class net.maizegenetics.dna.map.GeneralPosition.Builder
Set strand (default=1)
strand(val) - Method in class net.maizegenetics.dna.map.GeneralPosition.Builder
 
strand - Variable in class net.maizegenetics.dna.map.TagMappingInfo
Strand relative to reference genome. 1 = same sense as reference FASTA file. -1 = opposite sense. unknown = Byte.MIN_VALUE
strand - Variable in class net.maizegenetics.dna.map.TagMappingInfoV3
Strand relative to reference genome. 1 = same sense as reference FASTA file. -1 = opposite sense. unknown = Byte.MIN_VALUE
strand - Variable in class net.maizegenetics.plugindef.GenerateRCode.PositionVectors
 
STRAND_MINUS - Static variable in interface net.maizegenetics.dna.map.Position
 
STRAND_MINUS_STR - Static variable in interface net.maizegenetics.dna.map.Position
 
STRAND_PLUS - Static variable in interface net.maizegenetics.dna.map.Position
 
STRAND_PLUS_STR - Static variable in interface net.maizegenetics.dna.map.Position
 
STRAND_UNKNOWN - Static variable in interface net.maizegenetics.dna.map.Position
 
STRAND_UNKNOWN_STR - Static variable in interface net.maizegenetics.dna.map.Position
 
strandB - Variable in class net.maizegenetics.dna.map.AbstractPETagsOnPhysicalMap
 
strandContig - Variable in class net.maizegenetics.dna.map.AbstractPETagsOnPhysicalMap
 
strandF - Variable in class net.maizegenetics.dna.map.AbstractPETagsOnPhysicalMap
 
stream(filename) - Static method in class net.maizegenetics.analysis.phg.ParseGVCF
The returns a list of the GVCF header lines and a stream of the processed data lines. If you want the stream to return the data lines in order found in the file, do not call parallel().
stream() - Method in interface net.maizegenetics.dna.snp.genotypecall.GenotypeCallTable
Returns a Stream over the genotype calls.
stream(taxon) - Method in interface net.maizegenetics.dna.snp.genotypecall.GenotypeCallTable
 
stream(connection, sql, parms) - Static method in class net.maizegenetics.util.db.SQL
 
stream() - Method in interface net.maizegenetics.util.SuperByteMatrix
Returns a Stream over the bytes of this matrix.
stream(row) - Method in interface net.maizegenetics.util.SuperByteMatrix
 
stream() - Method in class net.maizegenetics.util.SuperByteMatrixMultiple
 
stream(row) - Method in class net.maizegenetics.util.SuperByteMatrixMultiple
 
stream() - Method in class net.maizegenetics.util.SuperByteMatrixSingle
 
stream(row) - Method in class net.maizegenetics.util.SuperByteMatrixSingle
 
stream() - Method in class net.maizegenetics.util.SuperByteMatrixSingleValue
 
stream(row) - Method in class net.maizegenetics.util.SuperByteMatrixSingleValue
 
stream() - Method in class net.maizegenetics.util.SuperByteMatrixTranspose
 
stream(row) - Method in class net.maizegenetics.util.SuperByteMatrixTranspose
 
streamBinaryToText(inputFileName, maxRecords) - Static method in class net.maizegenetics.dna.tag.TagsByTaxaUtils
Converts a binary .tbt file to text, using only the memory required for the file buffer.
streamGenotype() - Method in class net.maizegenetics.dna.snp.CombineGenotypeTable
 
streamGenotype(taxon) - Method in class net.maizegenetics.dna.snp.CombineGenotypeTable
 
streamGenotype() - Method in class net.maizegenetics.dna.snp.CoreGenotypeTable
 
streamGenotype(taxon) - Method in class net.maizegenetics.dna.snp.CoreGenotypeTable
 
streamGenotype() - Method in interface net.maizegenetics.dna.snp.GenotypeTable
 
streamGenotype(taxon) - Method in interface net.maizegenetics.dna.snp.GenotypeTable
 
streamGenotype() - Method in class net.maizegenetics.dna.snp.MergedGenotypeTable
 
streamGenotype(taxon) - Method in class net.maizegenetics.dna.snp.MergedGenotypeTable
 
streamGenotype() - Method in class net.maizegenetics.dna.snp.TOPMGenotypeTable
 
streamGenotype(taxon) - Method in class net.maizegenetics.dna.snp.TOPMGenotypeTable
 
streamTextToBinary(inputFileName, outputFileName) - Static method in class net.maizegenetics.dna.tag.TagsByTaxaUtils
Converts a text .tbt file to binary, using only the memory required for the file buffer.
StringNumberComparator - Class in net.maizegenetics.util
Title: TASSEL Description: A java program to deal with diversity Copyright: Copyright (c) 2000 Company: USDA-ARS/NCSU
StringNumberComparator() - Constructor for class net.maizegenetics.util.StringNumberComparator
 
studyName() - Method in class net.maizegenetics.analysis.b4r.GetPhenotypeFromB4RPlugin
Name of the study
studyName(value) - Method in class net.maizegenetics.analysis.b4r.GetPhenotypeFromB4RPlugin
Set Study Name. Name of the study
subHaplotype(size, fromStart) - Method in class net.maizegenetics.analysis.clustering.Haplotype
 
subintervalCount - Variable in class net.maizegenetics.stats.EMMA.EMMAforDoubleMatrix
 
subList(fromIndex, toIndex) - Method in class net.maizegenetics.analysis.avro.GenericArrayPositions
 
subList(fromIndex, toIndex) - Method in class net.maizegenetics.analysis.avro.GenericArrayTaxa
 
subList(fromIndex, toIndex) - Method in class net.maizegenetics.dna.snp.FilterList
 
SubpopulationFinder - Class in net.maizegenetics.analysis.imputation
 
subset(obs, newName) - Method in class net.maizegenetics.phenotype.CategoricalAttribute
 
subset(obs, newName) - Method in class net.maizegenetics.phenotype.NumericAttribute
 
subset(obs, newName) - Method in interface net.maizegenetics.phenotype.PhenotypeAttribute
 
subset(obs, newName) - Method in class net.maizegenetics.phenotype.TaxaAttribute
 
subsetGenotypesToNewFile(t5File, subT5File, subsetTaxa) - Static method in class net.maizegenetics.analysis.data.LowLevelCopyOfHDF5
 
subsets(byFactors) - Method in class net.maizegenetics.analysis.numericaltransform.TransformDataPlugin
 
subsetTaxaListByAnnotation(baseTaxaList, annotation, annoValue) - Static method in class net.maizegenetics.taxa.TaxaListIOUtils
Returns a subsetted taxa list based on annotation value. For example, return all taxa where GermType=Inbred.
subsetTree(tree, taxaList) - Static method in class net.maizegenetics.taxa.tree.NewickUtils
Returns a tree that is a subset of the original containing only the taxa specified.
subsetTree(tree, namesToKeep) - Static method in class net.maizegenetics.taxa.tree.NewickUtils
Returns a tree that is a subset of the original containing only the names specified.
SubsetTreePlugin - Class in net.maizegenetics.analysis.tree
 
SubsetTreePlugin(parentFrame, isInteractive) - Constructor for class net.maizegenetics.analysis.tree.SubsetTreePlugin
 
SubsetTreePlugin() - Constructor for class net.maizegenetics.analysis.tree.SubsetTreePlugin
 
SubsetTreePluginKt - Class in net.maizegenetics.analysis.tree
 
SubtractDistanceMatrixPlugin - Class in net.maizegenetics.analysis.distance
 
SubtractDistanceMatrixPlugin(parentFrame, isInteractive) - Constructor for class net.maizegenetics.analysis.distance.SubtractDistanceMatrixPlugin
 
subtractEndelmanDistance(matrices, superMatrix, listener) - Static method in class net.maizegenetics.analysis.distance.EndelmanDistanceMatrix
 
subtractGCTADistance(matrices, superMatrix, listener) - Static method in class net.maizegenetics.analysis.distance.GCTADistanceMatrix
 
SubtractGenotypesPlugin - Class in net.maizegenetics.analysis.data
 
SubtractGenotypesPlugin(parentFrame, isInteractive) - Constructor for class net.maizegenetics.analysis.data.SubtractGenotypesPlugin
 
SubtractPhenotype - Class in net.maizegenetics.analysis.numericaltransform
 
subtractPhenotype(pheno1, pheno2, useAbsDiff) - Method in class net.maizegenetics.analysis.numericaltransform.SubtractPhenotype
 
SubtractPhenotypeByTaxaPlugin - Class in net.maizegenetics.analysis.numericaltransform
 
SubtractPhenotypeByTaxaPlugin(parentFrame, isInteractive) - Constructor for class net.maizegenetics.analysis.numericaltransform.SubtractPhenotypeByTaxaPlugin
 
SUBTREE_PROBABILITY - Variable in interface net.maizegenetics.taxa.tree.AttributeNode
attribute name for the probability of the subtree defined by an internal node.
subtreeCount(subtree, trees) - Static method in class net.maizegenetics.taxa.tree.RootedTreeUtils
 
subTuple(subset) - Method in interface net.maizegenetics.util.db.DBTuple
 
successful - Variable in class net.maizegenetics.matrixalgebra.decomposition.BlasSingularValueDecomposition
 
successors(n) - Method in class net.maizegenetics.util.DirectedGraph
Gets the successors of the node n
sumCounts(inputFileName, format, progressIndication) - Static method in class net.maizegenetics.dna.tag.TagsByTaxaUtils
Returns a list of taxa in the specified TagsByTaxa file, along with the total count of all tags found in that taxon.
sumOf(integers) - Static method in class net.maizegenetics.analysis.imputation.FILLINImputationUtils
 
sumOf(integers) - Static method in class net.maizegenetics.analysis.imputation.FILLINImputationUtils
 
SuperByteMatrix - Interface in net.maizegenetics.util
 
SuperByteMatrixBuilder - Class in net.maizegenetics.util
 
SuperByteMatrixMultiple - Class in net.maizegenetics.util
 
SuperByteMatrixSingle - Class in net.maizegenetics.util
 
SuperByteMatrixSingleValue - Class in net.maizegenetics.util
 
SuperByteMatrixTranspose - Class in net.maizegenetics.util
 
supplier() - Method in class net.maizegenetics.dna.map.PositionList.PositionListCollector
 
supplier() - Method in class net.maizegenetics.taxa.TaxaList.TaxaListCollector
 
supplier() - Method in class net.maizegenetics.util.BitSet.BitSetListCollector
 
supressSystemOut() - Method in class net.maizegenetics.analysis.imputation.FILLINFindHaplotypesPlugin
Supress system out
supressSystemOut(value) - Method in class net.maizegenetics.analysis.imputation.FILLINFindHaplotypesPlugin
Set Supress system out. Express system out
supressSystemOut() - Method in class net.maizegenetics.analysis.imputation.FILLINImputationPlugin
Supress system out
supressSystemOut(value) - Method in class net.maizegenetics.analysis.imputation.FILLINImputationPlugin
Set Supress system out. Supress system out
swap(index1, index2) - Method in class net.maizegenetics.dna.map.PETagsOnPhysicalMapV3
 
swap(index1, index2) - Method in class net.maizegenetics.dna.map.TagsOnGeneticMap
 
swap(index1, index2) - Method in class net.maizegenetics.dna.map.TagsOnPhysicalMap
 
swap(index1, index2) - Method in class net.maizegenetics.dna.tag.AbstractPETags
Swap two PE tags
swap(index1, index2) - Method in class net.maizegenetics.dna.tag.AbstractTags
 
swap(index1, index2) - Method in class net.maizegenetics.dna.tag.AbstractTagsHDF5
 
swap(index1, index2) - Method in class net.maizegenetics.dna.tag.PETagCounts
 
swap(index1, index2) - Method in class net.maizegenetics.dna.tag.TagCounts
 
swapSynonyms() - Method in class net.maizegenetics.taxa.IdentifierSynonymizer
 
swapTagMappingInfo(index, mapIndex, mapIndex2) - Method in class net.maizegenetics.dna.map.TagsOnPhysMapHDF5
 
SweepFast - Class in net.maizegenetics.stats.linearmodels
 
SweepFast(X, y) - Constructor for class net.maizegenetics.stats.linearmodels.SweepFast
 
SweepFast(XTX, XTy, yty) - Constructor for class net.maizegenetics.stats.linearmodels.SweepFast
 
SweepFast(xtxMatrices, xtyMatrices, yty) - Constructor for class net.maizegenetics.stats.linearmodels.SweepFast
 
SweepFast() - Constructor for class net.maizegenetics.stats.linearmodels.SweepFast
 
SweepFastLinearModel - Class in net.maizegenetics.stats.linearmodels
 
SweepFastLinearModel(effects, data) - Constructor for class net.maizegenetics.stats.linearmodels.SweepFastLinearModel
 
SweepFastLinearModel(effects, data) - Constructor for class net.maizegenetics.stats.linearmodels.SweepFastLinearModel
 
SweepFastLinearModel(effects, xtx, xty, data) - Constructor for class net.maizegenetics.stats.linearmodels.SweepFastLinearModel
 
SweepFastNestedModel - Class in net.maizegenetics.stats.linearmodels
 
SweepFastNestedModel(modelEffects, data) - Constructor for class net.maizegenetics.stats.linearmodels.SweepFastNestedModel
The constructor for this class. It will calculate the SS and df for marker after all other effects in the model except taxa nested in marker. Taxa in marker will then be added to the model and its SS and df calculated. Error SS and df will be the final residual.
sweepSingularColumns() - Method in class net.maizegenetics.stats.linearmodels.SweepFast
 
SymmetricEigenvalueDecomposition - Class in net.maizegenetics.matrixalgebra.decomposition
 
SymmetricEigenvalueDecomposition(matrix) - Constructor for class net.maizegenetics.matrixalgebra.decomposition.SymmetricEigenvalueDecomposition
 
SymmetricMatrixInverterDM - Class in net.maizegenetics.stats.linearmodels
 
SymmetricMatrixInverterDM(symmetricMatrix) - Constructor for class net.maizegenetics.stats.linearmodels.SymmetricMatrixInverterDM
 
synonym(val) - Method in class net.maizegenetics.taxa.Taxon.Builder
Set text definition of pedigree (default=null)
synonymizeKeys(key) - Static method in class net.maizegenetics.dna.map.GenomeFeatureBuilder
Method that takes common synonyms of annotation types and standardizes them according to the following rules: (1) Make lowercase (2) Standardize according to following rules. (Any not on this list are returned as just lowercased) name, id -> id chr, chrom, chromosome -> chromosome stop, end -> stop parentid, parent_id, parent -> parent_id pos, position -> position
SynonymizerPlugin - Class in net.maizegenetics.analysis.data
 
SynonymizerPlugin(parentFrame, isInteractive) - Constructor for class net.maizegenetics.analysis.data.SynonymizerPlugin
Creates a new instance of SynonymizerPlugin
SynonymKey - Static variable in class net.maizegenetics.taxa.Taxon
Standard key for a synonym of the taxon

T

t1t2_pearson() - Method in class net.maizegenetics.analysis.gbs.repgen.TagCorrelationInfo
 
t1t2_spearman() - Method in class net.maizegenetics.analysis.gbs.repgen.TagCorrelationInfo
 
T_ALLELE - Static variable in class net.maizegenetics.dna.snp.NucleotideAlignmentConstants
 
T_DIPLOID_ALLELE - Static variable in class net.maizegenetics.dna.snp.NucleotideAlignmentConstants
 
tab - Static variable in class net.maizegenetics.analysis.imputation.ImputationUtils
 
tab - Static variable in class net.maizegenetics.analysis.imputation.RandomGenotypeImputationPlugin
 
tableChanged(e) - Method in class net.maizegenetics.analysis.filter.FilterTraitsDialog
 
tableChanged(e) - Method in class net.maizegenetics.tassel.SeqViewerPanel
 
TableDisplayPlugin - Class in net.maizegenetics.analysis.chart
 
TableDisplayPlugin(parentFrame, isInteractive) - Constructor for class net.maizegenetics.analysis.chart.TableDisplayPlugin
Creates a new instance of TableDisplayPlugin
TableReport - Interface in net.maizegenetics.util
Interface for classes with data that can be presented in tables
TableReportBoxWhiskerCatDataset - Class in net.maizegenetics.analysis.chart
Title:
TableReportBoxWhiskerCatDataset(theTable, seriesCategory, seriesY) - Constructor for class net.maizegenetics.analysis.chart.TableReportBoxWhiskerCatDataset
 
TableReportBuilder - Class in net.maizegenetics.util
 
TableReportManhattanDataset - Class in net.maizegenetics.analysis.chart
 
TableReportManhattanDataset(theTable, start, end) - Constructor for class net.maizegenetics.analysis.chart.TableReportManhattanDataset
 
TableReportNoPagingTableModel - Class in net.maizegenetics.gui
 
TableReportNoPagingTableModel(table) - Constructor for class net.maizegenetics.gui.TableReportNoPagingTableModel
 
TableReportPanel - Class in net.maizegenetics.tassel
 
TableReportPieDataset - Class in net.maizegenetics.analysis.chart
Title:
TableReportPieDataset(theTable, seriesCategory) - Constructor for class net.maizegenetics.analysis.chart.TableReportPieDataset
 
TableReportQQDataset - Class in net.maizegenetics.analysis.chart
 
TableReportQQDataset(table) - Constructor for class net.maizegenetics.analysis.chart.TableReportQQDataset
 
TableReportQQDataset(table, startIndex, endIndex, countToDisplay) - Constructor for class net.maizegenetics.analysis.chart.TableReportQQDataset
 
TableReportStatCategoryDataset - Class in net.maizegenetics.analysis.chart
Title:
TableReportStatCategoryDataset(theTable, seriesCategory, seriesY) - Constructor for class net.maizegenetics.analysis.chart.TableReportStatCategoryDataset
 
TableReportStatCategoryDataset(theTable, seriesCategory, seriesY, stderr) - Constructor for class net.maizegenetics.analysis.chart.TableReportStatCategoryDataset
 
tableReportToVectors(tableReport) - Static method in class net.maizegenetics.plugindef.GenerateRCode
Temporary place for this experimental method.
TableReportUtils - Class in net.maizegenetics.util
 
TableReportVectors(columnNames, columnType, annotation, dataVector) - Constructor for class net.maizegenetics.plugindef.GenerateRCode.TableReportVectors
 
TableReportXYDataset - Class in net.maizegenetics.analysis.chart
Title:
TableReportXYDataset(theTable, seriesX, seriesY) - Constructor for class net.maizegenetics.analysis.chart.TableReportXYDataset
 
TableReportXYDataset(theTable, seriesX, seriesY1, seriesY2) - Constructor for class net.maizegenetics.analysis.chart.TableReportXYDataset
 
TableRowHeaderListModel - Class in net.maizegenetics.gui
 
TableRowHeaderListModel(list) - Constructor for class net.maizegenetics.gui.TableRowHeaderListModel
TableRowHeaderListModel Constructor.
tag() - Method in class net.maizegenetics.analysis.gbs.repgen.RefTagData
 
tag() - Method in class net.maizegenetics.analysis.rna.FindMatchByWordHash.Match
 
Tag - Interface in net.maizegenetics.dna.tag
Interface for tags (sequences without N) that captures these bit encoded sequence and there length.
tag2() - Method in class net.maizegenetics.analysis.gbs.repgen.AlignmentInfo
 
tag2() - Method in class net.maizegenetics.analysis.gbs.repgen.TagCorrelationInfo
 
tag2chrom() - Method in class net.maizegenetics.analysis.gbs.repgen.AlignmentInfo
 
tag2pos() - Method in class net.maizegenetics.analysis.gbs.repgen.AlignmentInfo
 
TAG_ATTRIBUTES_PATH - Static variable in class net.maizegenetics.util.Tassel5HDF5Constants
 
TAG_COUNT - Static variable in class net.maizegenetics.util.Tassel5HDF5Constants
 
TAG_DIST - Static variable in class net.maizegenetics.util.Tassel5HDF5Constants
 
TAG_DIST_OFFSETS - Static variable in class net.maizegenetics.util.Tassel5HDF5Constants
 
TAG_LENGTH_LONG - Static variable in class net.maizegenetics.util.Tassel5HDF5Constants
 
TAG_LENGTHS - Static variable in class net.maizegenetics.util.Tassel5HDF5Constants
 
TAG_LOCKED - Static variable in class net.maizegenetics.util.Tassel5HDF5Constants
 
TAG_MODULE - Static variable in class net.maizegenetics.util.Tassel5HDF5Constants
 
TAG_SEQ - Static variable in class net.maizegenetics.util.Tassel5HDF5Constants
 
TagAgainstAnchor - Class in net.maizegenetics.analysis.gbs
 
TagAgainstAnchor(hapMapHDF5, tbtHDF5, blockFileS, outfileS, pThresh, minCount, coreNum, chunkSize) - Constructor for class net.maizegenetics.analysis.gbs.TagAgainstAnchor
Constructor to run genetic mapping on one node
TagAgainstAnchor(hapMapHDF5, tbtHDF5, blockFileS, outfileS, pThresh, minCount, coreNum, chunkSize, chunkStartIndex, chunkEndIndex) - Constructor for class net.maizegenetics.analysis.gbs.TagAgainstAnchor
Constructor to run genetic mapping on specific chunk of TBT. This is for "qsub" in clusters.
TagAgainstAnchorHypothesis - Class in net.maizegenetics.analysis.gbs
 
TagAgainstAnchorHypothesis(hapMapHDF5, tbtHDF5, topmFileS, software, testSiteNum, pThresh, minCount, coreNum) - Constructor for class net.maizegenetics.analysis.gbs.TagAgainstAnchorHypothesis
Constructor to run genetic mapping
TagAgainstAnchorPlugin - Class in net.maizegenetics.analysis.gbs
Genetic mapping of GBS tags. Steps: 1. Using -pc and -t option to calculate the number of TBT chunks. 2. When -pc is 0, run the program on cluster. Submit jobs to nodes by specifying chunkStartIndex and chunkEndIndex
TagAgainstAnchorPlugin() - Constructor for class net.maizegenetics.analysis.gbs.TagAgainstAnchorPlugin
 
TagAgainstAnchorPlugin(parentFrame) - Constructor for class net.maizegenetics.analysis.gbs.TagAgainstAnchorPlugin
 
tagBLength - Variable in class net.maizegenetics.dna.tag.AbstractPETags
Length of backward tags
TagBlockPosition - Class in net.maizegenetics.analysis.gbs
Stores physical position of tags. The physical position of tag is used to block the corresponding marker in genetic mapping if the tag is mapping to the marker coming from itself Positions come from TOPM alignment hypothesis or the best position from machine learning prediction
TagBlockPosition(tbtH5FileS, topmFileS, TOPMVersionValue) - Constructor for class net.maizegenetics.analysis.gbs.TagBlockPosition
 
TagBlockPosition(tbtH5FileS, topmH5FileS, software) - Constructor for class net.maizegenetics.analysis.gbs.TagBlockPosition
 
TagBlockPosition(blockFileS) - Constructor for class net.maizegenetics.analysis.gbs.TagBlockPosition
 
TagBuilder - Class in net.maizegenetics.dna.tag
Builder for tags that optimizes the memory footprint. Tags are encoded in long with 2 bits per bp. In GBS, we generally use only record the 64 or 96bp. Custom classes are generated with 32, 64 or 96bp tags (1, 2 or 3 longs) otherwise an array is used.
TagCorrelationInfo - Class in net.maizegenetics.analysis.gbs.repgen
 
TagCorrelationInfo(tag2, t1t2_pearson, t1t2_spearman, pres_abs_pearson, r2) - Constructor for class net.maizegenetics.analysis.gbs.repgen.TagCorrelationInfo
 
tagCount() - Method in class net.maizegenetics.analysis.data.HDF5SummaryPlugin
 
TAGCOUNT - Static variable in class net.maizegenetics.dna.tag.GBSHDF5Constants
 
tagCountFile() - Method in class net.maizegenetics.analysis.gbs.SeqToTBTHDF5Plugin
Tag count file. (Only -t or -m allowed)
tagCountFile(value) - Method in class net.maizegenetics.analysis.gbs.SeqToTBTHDF5Plugin
Set Tag Count File. Tag count file. (Only -t or -m allowed)
TagCountMutable - Class in net.maizegenetics.dna.tag
Resizeable tags count container. Tags sequences are compressed in long, tags lengths are tracked, and read counts are stored. Has basic filtering methods. Read counts can be modified.
TagCountMutable(tagLengthInLong, maxSize) - Constructor for class net.maizegenetics.dna.tag.TagCountMutable
 
TagCountMutable(origTagCount, maxSize) - Constructor for class net.maizegenetics.dna.tag.TagCountMutable
 
TagCounts - Class in net.maizegenetics.dna.tag
Holds tags counts. Tags sequences are compressed in long, tags lengths are tracked, and read counts are stored. Has basic filtering methods. Read counts can be modified. This class is not resizable in terms of new tags - for growing tag count lists use TagCountMutable.java User: ed
TagCounts() - Constructor for class net.maizegenetics.dna.tag.TagCounts
 
TagCounts(tagLengthInLong, maxSize) - Constructor for class net.maizegenetics.dna.tag.TagCounts
 
TagCounts(inFile, binary) - Constructor for class net.maizegenetics.dna.tag.TagCounts
 
TagCountToFastqPlugin - Class in net.maizegenetics.analysis.gbs
 
TagCountToFastqPlugin() - Constructor for class net.maizegenetics.analysis.gbs.TagCountToFastqPlugin
 
TagCountToFastqPlugin(parentFrame) - Constructor for class net.maizegenetics.analysis.gbs.TagCountToFastqPlugin
 
TagCountToFastqPlugin(parentFrame, isInteractive) - Constructor for class net.maizegenetics.analysis.gbs.TagCountToFastqPlugin
 
TagData - Interface in net.maizegenetics.dna.tag
Interface to GBS Tag Data. Replaces TagsCounts, TBT, and TOPM TODO: TAS-476
TagDataSQLite - Class in net.maizegenetics.dna.tag
Defines xxxx TAS-480
TagDataSQLite(filename) - Constructor for class net.maizegenetics.dna.tag.TagDataSQLite
 
TagDataWriter - Interface in net.maizegenetics.dna.tag
Defines writer to modify the GBS tag data store
TagExportToFastqPlugin - Class in net.maizegenetics.analysis.gbs.v2
Converts a TagCounts binary (*.cnt) file (presumably a master tag list) to a fastq file that can be used as input for BWA or bowtie2 (and possibly additional aligners). The same function can be performed with MergeMultipleTagCountPlugin using the -t option and a single Master Tag List file in the input directory, but having a separate plugin to do this reduces confusion and eliminates the risk of merging the master tag list back on itself.
TagExportToFastqPlugin() - Constructor for class net.maizegenetics.analysis.gbs.v2.TagExportToFastqPlugin
 
TagExportToFastqPlugin(parentFrame) - Constructor for class net.maizegenetics.analysis.gbs.v2.TagExportToFastqPlugin
 
TagExportToFastqPlugin(parentFrame, isInteractive) - Constructor for class net.maizegenetics.analysis.gbs.v2.TagExportToFastqPlugin
 
tagFile() - Method in class net.maizegenetics.analysis.gbs.v2.GetTagTaxaDistFromDBPlugin
Input file with list of tags to process. Any number of tab-delimited columns, but must have 1 called Tags.
tagFile(value) - Method in class net.maizegenetics.analysis.gbs.v2.GetTagTaxaDistFromDBPlugin
Set Tag File. Input file with list of tags to process. Any number of tab-delimited columns, but must have 1 called Tags.
tagFLength - Variable in class net.maizegenetics.dna.tag.AbstractPETags
Length of forward tags
TagGeneticMappingInfo - Class in net.maizegenetics.dna.map
Class used to to store genetic mapping for hypothesis and output to H5 format
TagGeneticMappingInfo() - Constructor for class net.maizegenetics.dna.map.TagGeneticMappingInfo
 
TagGeneticMappingInfo(p, chromosome, position, sigSiteNum, sigSiteRange) - Constructor for class net.maizegenetics.dna.map.TagGeneticMappingInfo
 
TagGWASMap - Class in net.maizegenetics.dna.map
Holding tag genetic mapping result from GWAS. It includes attributes and methods for machine learning prediction of mapping accuracy
TagGWASMap(tagGWASMapFileS) - Constructor for class net.maizegenetics.dna.map.TagGWASMap
 
TagGWASMap(gwasMappingResultFileS, tagCountFileS, tagGWASMapFileS) - Constructor for class net.maizegenetics.dna.map.TagGWASMap
 
TagGWASMap(gwasMappingFileS, topmFileS, tagCountFileS, tagGWASMapFileS) - Constructor for class net.maizegenetics.dna.map.TagGWASMap
 
TagGWASMapInfo - Class in net.maizegenetics.dna.map
Stores variables from tag genetic mapping from GWAS. This class is used for I/O of HDF5.
TagGWASMapInfo() - Constructor for class net.maizegenetics.dna.map.TagGWASMapInfo
 
TagGWASMapInfo(readCount, gChr, gPos, gwasPValue, numSigSite, tagTaxaCount, numSigChr, lRatioSB, lRatioMB, numSiteOnBestChrThanSecondBest, sigSiteStart, sigSiteEnd) - Constructor for class net.maizegenetics.dna.map.TagGWASMapInfo
 
TagGWASMapInfo(readCount, pChr, pPos, ifMap, ifRef, ifUnique, gChr, gPos, gwasPValue, numSigSite, tagTaxaCount, numSigChr, lRatioSB, lRatioMB, numSiteOnBestChrThanSecondBest, sigSiteStart, sigSiteEnd) - Constructor for class net.maizegenetics.dna.map.TagGWASMapInfo
 
tagIndex() - Method in class net.maizegenetics.analysis.rna.FindMatchByWordHash.Match
 
tagLength() - Method in class net.maizegenetics.analysis.gbs.SAMConverterPlugin
 
tagLength(value) - Method in class net.maizegenetics.analysis.gbs.SAMConverterPlugin
 
tagLength - Variable in class net.maizegenetics.dna.tag.AbstractTags
 
TAGLENGTH - Static variable in class net.maizegenetics.dna.tag.GBSHDF5Constants
 
tagLength - Variable in class net.maizegenetics.dna.tag.ReadsByTaxa
 
tagLengthInLong - Variable in class net.maizegenetics.dna.map.PETagsOnPhysicalMapV3
 
tagLengthInLong - Variable in class net.maizegenetics.dna.tag.AbstractPETags
Tag length in Long primitive data type
tagLengthInLong - Variable in class net.maizegenetics.dna.tag.AbstractTags
 
TAGLENGTHINLONG - Static variable in class net.maizegenetics.dna.tag.GBSHDF5Constants
 
tagLengthInLong - Variable in class net.maizegenetics.dna.tag.ReadsByTaxa
 
TagLocus - Class in net.maizegenetics.dna.map
Aligns and calls SNPs for all tags at a given locus.
TagLocus(chromosome, strand, startPosition, tagLength, includeRefGenome, fuzzyStartPositions, errorRate) - Constructor for class net.maizegenetics.dna.map.TagLocus
 
TagMappingInfo - Class in net.maizegenetics.dna.map
Container class for information on mapping position.
TagMappingInfo() - Constructor for class net.maizegenetics.dna.map.TagMappingInfo
 
TagMappingInfo(chromosome, strand, startPosition, endPosition, divergence) - Constructor for class net.maizegenetics.dna.map.TagMappingInfo
 
TagMappingInfo(chromosome, strand, startPosition, endPosition, divergence, variantPosOff, variantDef, dcoP, mapP) - Constructor for class net.maizegenetics.dna.map.TagMappingInfo
 
TagMappingInfoV3 - Class in net.maizegenetics.dna.map
Container class for information on mapping position.
TagMappingInfoV3() - Constructor for class net.maizegenetics.dna.map.TagMappingInfoV3
 
TagMappingInfoV3(chromosome, strand, startPosition, endPosition, divergence, perfectMatch, mappingSource, mappingScore) - Constructor for class net.maizegenetics.dna.map.TagMappingInfoV3
 
TagMappingInfoV3(chromosome, strand, startPosition, endPosition, divergence, perfectMatch, mappingSource, mappingScore, variantPosOff, variantDef, dcoP, mapP) - Constructor for class net.maizegenetics.dna.map.TagMappingInfoV3
 
TagMappingInfoV3.Aligner - Enum in net.maizegenetics.dna.map
MappingSource definition
tagMapToFastaPlugin() - Method in class net.maizegenetics.analysis.gbs.pana.PanAUsageExample
 
TagMatchFinder - Class in net.maizegenetics.analysis.gbs
Very simple but fast homology finder. Very similar to BLAT, with long word searches. A in memory index is created from any set of Tags, and this list many then be quickly queried for high homology hits.
TagMatchFinder(theTags) - Constructor for class net.maizegenetics.analysis.gbs.TagMatchFinder
 
tags - Variable in class net.maizegenetics.dna.tag.AbstractTags
 
TAGS - Static variable in class net.maizegenetics.dna.tag.GBSHDF5Constants
 
Tags - Interface in net.maizegenetics.dna.tag
Basic interface for holding sets of sequence tag (these are compressed into 2-bit codings of tags). The length of tag in good sequence is also tracked.
TAGS - Static variable in class net.maizegenetics.util.Tassel5HDF5Constants
 
TAGS_BIN_NUM - Static variable in class net.maizegenetics.util.Tassel5HDF5Constants
 
tagsB - Variable in class net.maizegenetics.dna.tag.AbstractPETags
Backward tags in Long array Columns are sequence, rows are index of sequence. This is faster than the other way
TagsByTaxa - Interface in net.maizegenetics.dna.tag
Tags by Taxa is the interface for tracking the distribution of tags across taxa. It can be thought of as a matrix of nTaxa by nTags. Taxa names are also maintained by this interface.
TagsByTaxa.FilePacking - Enum in net.maizegenetics.dna.tag
Types of file packing used by GBS data structures. Bit compresses all information to presence/absence, while Byte/Short/Int tradeoff memory size with depth of coverage. Text is only used for file storage.
TagsByTaxaByte - Class in net.maizegenetics.dna.tag
A bit implementation of TagByTaxa, so only counts as high as 127 can be maintained.
TagsByTaxaByte() - Constructor for class net.maizegenetics.dna.tag.TagsByTaxaByte
 
TagsByTaxaByte(infile, binary) - Constructor for class net.maizegenetics.dna.tag.TagsByTaxaByte
 
TagsByTaxaByte(taxaNames, theDistinctReads) - Constructor for class net.maizegenetics.dna.tag.TagsByTaxaByte
 
TagsByTaxaByte(tags, tagLength, tagDist, namesForTaxa) - Constructor for class net.maizegenetics.dna.tag.TagsByTaxaByte
 
TagsByTaxaByte(reads, readDist, namesForTaxa) - Constructor for class net.maizegenetics.dna.tag.TagsByTaxaByte
 
TagsByTaxaByteFileMap - Class in net.maizegenetics.dna.tag
A byte implementation of TagByTaxa, maximum depth of tags is 127. This version works directly from a RandomAccessFile, which is slow but can work with very large files. It will need to be transitioned nio2, when Java 7 comes out. If possible, it holds the current row cached in memory, so try to work with the files sequentially.
TagsByTaxaByteFileMap(infile) - Constructor for class net.maizegenetics.dna.tag.TagsByTaxaByteFileMap
 
TagsByTaxaByteFileMap(outFile, taxaNames, theTags) - Constructor for class net.maizegenetics.dna.tag.TagsByTaxaByteFileMap
Creates an empty Byte File Map
TagsByTaxaByteFileMapSeq - Class in net.maizegenetics.dna.tag
A bit implementation of TagByTaxa, so only presence or absence of a tags is known. This version works directly from a RandomAccessFile, which is slow but can work with very large files. It will need to be transitioned nio2, when Java 7 comes out. If possible, it holds the current row cached in memory, so try to work with the files sequentially.
TagsByTaxaByteFileMapSeq(infile) - Constructor for class net.maizegenetics.dna.tag.TagsByTaxaByteFileMapSeq
 
TagsByTaxaByteHDF5TagGroups - Class in net.maizegenetics.dna.tag
Tags by Taxa file based on the HDF5 data structure. This version is optimized for rapid access of taxa within Tag (ie it buffers the taxa counts within one tag).
TagsByTaxaByteHDF5TagGroups(inTags, newHDF5file) - Constructor for class net.maizegenetics.dna.tag.TagsByTaxaByteHDF5TagGroups
 
TagsByTaxaByteHDF5TagGroups(infile) - Constructor for class net.maizegenetics.dna.tag.TagsByTaxaByteHDF5TagGroups
 
TagsByTaxaByteHDF5TaxaGroups - Class in net.maizegenetics.dna.tag
Tags by Taxa file based on the HDF5 data structure. This version is optimized for rapid access of tags within taxa (ie it buffers the tag counts within one taxon). It is good for adding, removing, and combining taxa
TagsByTaxaByteHDF5TaxaGroups(inTags, newHDF5file) - Constructor for class net.maizegenetics.dna.tag.TagsByTaxaByteHDF5TaxaGroups
 
TagsByTaxaByteHDF5TaxaGroups(infile) - Constructor for class net.maizegenetics.dna.tag.TagsByTaxaByteHDF5TaxaGroups
 
TagsByTaxaShort - Class in net.maizegenetics.dna.tag
Tags by taxa that supports depths captured by a short (max 32767)
TagsByTaxaShort() - Constructor for class net.maizegenetics.dna.tag.TagsByTaxaShort
 
TagsByTaxaShort(infile, binary) - Constructor for class net.maizegenetics.dna.tag.TagsByTaxaShort
 
TagsByTaxaShort(taxaNames, theDistinctReads) - Constructor for class net.maizegenetics.dna.tag.TagsByTaxaShort
 
TagsByTaxaShort(reads, readDist, namesForTaxa) - Constructor for class net.maizegenetics.dna.tag.TagsByTaxaShort
 
TagsByTaxaUtils - Class in net.maizegenetics.dna.tag
This class contains methods which process TagsByTaxa files one line at a time, as opposed to the methods in class AbstractTagsByTaxa, which hold an entire file in memory.
tagSeqs() - Method in class net.maizegenetics.analysis.data.HDF5SummaryPlugin
 
tagSequence() - Method in class net.maizegenetics.analysis.gbs.v2.GetTagSequenceFromDBPlugin
Tag sequence user would like to verify exists in DB.
tagSequence(value) - Method in class net.maizegenetics.analysis.gbs.v2.GetTagSequenceFromDBPlugin
Set User tag sequence. This is tag user wants to verify exists in DB.
tagsF - Variable in class net.maizegenetics.dna.tag.AbstractPETags
Forward tags in Long array Columns are sequence, rows are index of sequence. This is faster than the other way
TagsOnGeneticMap - Class in net.maizegenetics.dna.map
Class that hold genetic position of tags, genetic positions are the position of markers associated with tags
TagsOnGeneticMap(infileS, format) - Constructor for class net.maizegenetics.dna.map.TagsOnGeneticMap
Construct TOGM from a file
TagsOnPhysicalMap - Class in net.maizegenetics.dna.map
Holds tag data compressed in long and a physical position. This can have two variations either include redundant positions or only unique positions. If redundant than tags that map to multiple regions should be placed adjacently Default 40 bytes per position. If we have 10,000,000 million positions then this will be at 400M byte data structure. User: ed
TagsOnPhysicalMap() - Constructor for class net.maizegenetics.dna.map.TagsOnPhysicalMap
 
TagsOnPhysicalMap(inFile, binary) - Constructor for class net.maizegenetics.dna.map.TagsOnPhysicalMap
 
TagsOnPhysicalMap(rows) - Constructor for class net.maizegenetics.dna.map.TagsOnPhysicalMap
 
TagsOnPhysicalMap(rows, tagLengthInLong, maxVariants) - Constructor for class net.maizegenetics.dna.map.TagsOnPhysicalMap
 
TagsOnPhysicalMap(readList) - Constructor for class net.maizegenetics.dna.map.TagsOnPhysicalMap
 
TagsOnPhysicalMap(oldTOPM, filterDuplicates) - Constructor for class net.maizegenetics.dna.map.TagsOnPhysicalMap
 
TagsOnPhysicalMap.SAMFormat - Enum in net.maizegenetics.dna.map
 
TagsOnPhysicalMapV3 - Class in net.maizegenetics.dna.map
HDF5 version of TagsOnPhysical Map. This is the preferred version of physical map as it uses less memory, loads faster, and is more flexible with mapping positions.
TagsOnPhysicalMapV3(theHDF5file) - Constructor for class net.maizegenetics.dna.map.TagsOnPhysicalMapV3
Constructor from a HDF5 TOPM file
TagsOnPhysMapHDF5 - Class in net.maizegenetics.dna.map
HDF5 version of TagsOnPhysical Map. This is the preferred version of physical map as it uses less memory, loads faster, and is more flexible with mapping positions.
TagsOnPhysMapHDF5(filename) - Constructor for class net.maizegenetics.dna.map.TagsOnPhysMapHDF5
 
TagsOnPhysMapHDF5(theHDF5file, cacheAllMappingBlocks) - Constructor for class net.maizegenetics.dna.map.TagsOnPhysMapHDF5
 
tagsWCountsGreaterThanMin(minCount) - Method in class net.maizegenetics.dna.tag.TagCounts
 
tagTaxaCount - Variable in class net.maizegenetics.dna.map.TagGWASMapInfo
Number of taxa where tag exist, unknown = Integer.MIN_VALUE
targetFile() - Method in class net.maizegenetics.analysis.imputation.FILLINFindHaplotypesPlugin
Input HapMap file of target genotypes to impute or all genotypes available for target taxon. Accepts all file types supported by TASSEL5.
targetFile(value) - Method in class net.maizegenetics.analysis.imputation.FILLINFindHaplotypesPlugin
Set Target file. Input HapMap file of target genotypes to impute or all genotypes available for target taxon. Accepts all file types supported by TASSEL5.
targetFile() - Method in class net.maizegenetics.analysis.imputation.FILLINImputationPlugin
Input HapMap file of target genotypes to impute. Accepts all file types supported by TASSEL5
targetFile(value) - Method in class net.maizegenetics.analysis.imputation.FILLINImputationPlugin
Set Target file. Input HapMap file of target genotypes to impute. Accepts all file types supported by TASSEL5
targetTaxon - Variable in class net.maizegenetics.analysis.popgen.DonorHypoth
 
targetTBTHDF5File() - Method in class net.maizegenetics.analysis.gbs.ModifyTBTHDF5Plugin
 
targetTBTHDF5File(value) - Method in class net.maizegenetics.analysis.gbs.ModifyTBTHDF5Plugin
 
Tassel5HDF5Constants - Class in net.maizegenetics.util
Definition of attributes and paths for Tassel HDF5 file format.
TASSEL_CONFIG_FILE - Static variable in class net.maizegenetics.prefs.TasselPrefs
 
TASSEL_CONFIG_FILE_DEFAULT - Static variable in class net.maizegenetics.prefs.TasselPrefs
 
TASSEL_LOCALE - Static variable in class net.maizegenetics.prefs.TasselPrefs
 
TASSEL_LOG_DEBUG - Static variable in class net.maizegenetics.prefs.TasselPrefs
 
TASSEL_LOG_DEBUG_DEFAULT - Static variable in class net.maizegenetics.prefs.TasselPrefs
 
TASSEL_LOG_SEND_TO_CONSOLE - Static variable in class net.maizegenetics.prefs.TasselPrefs
 
TASSEL_LOG_SEND_TO_CONSOLE_DEFAULT - Static variable in class net.maizegenetics.prefs.TasselPrefs
 
TASSEL_LOG_X_DIM - Static variable in class net.maizegenetics.prefs.TasselPrefs
 
TASSEL_LOG_X_DIM_DEFAULT - Static variable in class net.maizegenetics.prefs.TasselPrefs
 
TASSEL_LOG_Y_DIM - Static variable in class net.maizegenetics.prefs.TasselPrefs
 
TASSEL_LOG_Y_DIM_DEFAULT - Static variable in class net.maizegenetics.prefs.TasselPrefs
 
TASSEL_MAX_THREADS - Static variable in class net.maizegenetics.prefs.TasselPrefs
 
TASSEL_MAX_THREADS_DEFAULT - Static variable in class net.maizegenetics.prefs.TasselPrefs
 
TASSEL_OPEN_DIR - Static variable in class net.maizegenetics.prefs.TasselPrefs
 
TASSEL_OPEN_DIR_DEFAULT - Static variable in class net.maizegenetics.prefs.TasselPrefs
 
TASSEL_SAVE_DIR - Static variable in class net.maizegenetics.prefs.TasselPrefs
 
TASSEL_SAVE_DIR_DEFAULT - Static variable in class net.maizegenetics.prefs.TasselPrefs
 
TASSEL_TOP - Static variable in class net.maizegenetics.prefs.TasselPrefs
 
TASSEL_X_DIM - Static variable in class net.maizegenetics.prefs.TasselPrefs
 
TASSEL_X_DIM_DEFAULT - Static variable in class net.maizegenetics.prefs.TasselPrefs
 
TASSEL_Y_DIM - Static variable in class net.maizegenetics.prefs.TasselPrefs
 
TASSEL_Y_DIM_DEFAULT - Static variable in class net.maizegenetics.prefs.TasselPrefs
 
TasselLogging - Class in net.maizegenetics.tassel
 
TASSELMainApp - Class in net.maizegenetics.tassel
 
TASSELMainFrame - Class in net.maizegenetics.tassel
TASSELMainFrame
TASSELMainFrame() - Constructor for class net.maizegenetics.tassel.TASSELMainFrame
 
TasselPipeline - Class in net.maizegenetics.pipeline
 
TasselPipeline(args, frame) - Constructor for class net.maizegenetics.pipeline.TasselPipeline
Creates a new instance of TasselPipeline
TasselPipeline(args, frame, interactive, name) - Constructor for class net.maizegenetics.pipeline.TasselPipeline
Creates a new instance of TasselPipeline
TasselPipeline.FLAGS - Enum in net.maizegenetics.pipeline
 
TasselPipelineStepsDialog - Class in net.maizegenetics.pipeline
 
TasselPipelineStepsDialog(mainFrame, name) - Constructor for class net.maizegenetics.pipeline.TasselPipelineStepsDialog
 
TasselPipelineXMLUtil - Class in net.maizegenetics.pipeline
 
TasselPrefs - Class in net.maizegenetics.prefs
 
taxa() - Method in class net.maizegenetics.dna.snp.CombineGenotypeTable
 
taxa() - Method in class net.maizegenetics.dna.snp.CoreGenotypeTable
 
taxa() - Method in interface net.maizegenetics.dna.snp.GenotypeTable
Return taxa list of this genotype table.
TAXA - Static variable in class net.maizegenetics.dna.snp.HapMapHDF5Constants
 
taxa() - Method in class net.maizegenetics.dna.snp.MergedGenotypeTable
 
taxa() - Method in class net.maizegenetics.dna.snp.TOPMGenotypeTable
 
taxa() - Method in class net.maizegenetics.phenotype.CorePhenotype
 
taxa() - Method in class net.maizegenetics.phenotype.FilterPhenotype
 
taxa() - Method in interface net.maizegenetics.phenotype.Phenotype
 
TAXA_ATTRIBUTES_PATH - Static variable in class net.maizegenetics.util.Tassel5HDF5Constants
 
TAXA_DESC - Static variable in class net.maizegenetics.dna.snp.HapMapHDF5Constants
 
TAXA_LIST_NONE - Static variable in class net.maizegenetics.plugindef.AbstractPlugin
 
TAXA_LOCKED - Static variable in class net.maizegenetics.util.Tassel5HDF5Constants
 
TAXA_MODULE - Static variable in class net.maizegenetics.util.Tassel5HDF5Constants
 
TAXA_NUM_TAXA - Static variable in class net.maizegenetics.util.Tassel5HDF5Constants
 
TAXA_ORDER - Static variable in class net.maizegenetics.util.Tassel5HDF5Constants
 
TAXA_SCHEMA - Static variable in class net.maizegenetics.analysis.avro.AvroConstants
 
taxaAttribute() - Method in class net.maizegenetics.phenotype.CorePhenotype
 
taxaAttribute() - Method in class net.maizegenetics.phenotype.FilterPhenotype
 
taxaAttribute() - Method in interface net.maizegenetics.phenotype.Phenotype
 
TaxaAttribute - Class in net.maizegenetics.phenotype
 
TaxaAttribute(taxa, name) - Constructor for class net.maizegenetics.phenotype.TaxaAttribute
 
TaxaAttribute(taxa) - Constructor for class net.maizegenetics.phenotype.TaxaAttribute
 
TaxaAvailableListModel - Class in net.maizegenetics.gui
 
TaxaAvailableListModel(taxa) - Constructor for class net.maizegenetics.gui.TaxaAvailableListModel
 
taxaCount(value) - Method in class net.maizegenetics.analysis.data.HDF5SummaryPlugin
 
taxaCount() - Method in class net.maizegenetics.analysis.data.HDF5SummaryPlugin
 
TAXACOV - Static variable in class net.maizegenetics.dna.snp.HapMapHDF5Constants
 
TAXACOV - Static variable in class net.maizegenetics.util.Tassel5HDF5Constants
 
taxaDepthMap() - Method in interface net.maizegenetics.dna.tag.TaxaDistribution
Multiset version of the taxa depth. This is a convenient data structure, but it is slow to create compared to depths or taxaWithDepths. Do not use this if performance is key.
TaxaDistBuilder - Class in net.maizegenetics.dna.tag
Builder for TaxaDistribution. Deals with the
TaxaDistribution - Interface in net.maizegenetics.dna.tag
This is a specialized multiset for recording the distribution of a single across taxa. HashMap or Multiset or large arrays could be reasonable approaches by they do not scale well with hundreds of taxa scored out of the thousands. Instead this the general implementations use primitive arrays.
taxaEffect() - Method in class net.maizegenetics.analysis.association.AbstractFixedEffectLM
 
taxaEffectNumber - Variable in class net.maizegenetics.analysis.association.AbstractFixedEffectLM
 
taxaFile() - Method in class net.maizegenetics.analysis.gbs.v2.SNPQualityProfilerPlugin
Name of taxa list input file in taxa list format
taxaFile(value) - Method in class net.maizegenetics.analysis.gbs.v2.SNPQualityProfilerPlugin
Set Taxa List File. Name of taxa list input file in taxa list format
TAXAHET - Static variable in class net.maizegenetics.dna.snp.HapMapHDF5Constants
 
TAXAHET - Static variable in class net.maizegenetics.util.Tassel5HDF5Constants
 
taxaIndex - Variable in class net.maizegenetics.analysis.modelfitter.AbstractForwardRegression
 
taxaIndex - Variable in class net.maizegenetics.analysis.modelfitter.GenotypeAdditiveSite
 
taxaInModel - Variable in class net.maizegenetics.analysis.association.PhenotypeLM
 
taxaInModelMap - Variable in class net.maizegenetics.analysis.association.PhenotypeLM
 
taxaList() - Method in class net.maizegenetics.analysis.filter.FilterTaxaBuilderPlugin
Taxa List
taxaList(value) - Method in class net.maizegenetics.analysis.filter.FilterTaxaBuilderPlugin
Set Taxa List.
taxaList(value) - Method in class net.maizegenetics.analysis.filter.FilterTaxaBuilderPlugin
 
taxaList(connection, gids) - Static method in class net.maizegenetics.analysis.gobii.BMSConnection
 
taxaList(postgres, datasetName, bms) - Static method in class net.maizegenetics.analysis.gobii.GOBIIPostgresConnection
 
taxaList() - Method in class net.maizegenetics.dna.snp.FilterTaxa
 
taxaList - Variable in class net.maizegenetics.dna.tag.AbstractTagsByTaxa
 
TaxaList - Interface in net.maizegenetics.taxa
 
TaxaList.TaxaListCollector - Class in net.maizegenetics.taxa
 
TaxaListBuilder - Class in net.maizegenetics.taxa
A builder for creating immutable interface TaxaList instances. Example: TaxaListBuilder tlb=new TaxaListBuilder(); for (int i = 0; i < 10; i++) { Taxon at= new Taxon.Builder("Z"+i+":Line:mays:Zea") .inbreedF(0.99f) .parents("B73","B97") .pedigree("(B73xB97)S6I1") .build(); tlb.add(at); } TaxaList tl=tlb.build();
TaxaListBuilder() - Constructor for class net.maizegenetics.taxa.TaxaListBuilder
 
TaxaListIOUtils - Class in net.maizegenetics.taxa
Utilities for reading and writing IdGroup and PedigreeIdGroups.
taxaListName() - Method in class net.maizegenetics.analysis.gbs.v2.SNPQualityProfilerPlugin
Name of taxa set for database
taxaListName(value) - Method in class net.maizegenetics.analysis.gbs.v2.SNPQualityProfilerPlugin
Set Name for taxa set in DB. Name of taxa set for database
TaxaListTableReport - Class in net.maizegenetics.taxa
 
TaxaListTableReport(taxaList) - Constructor for class net.maizegenetics.taxa.TaxaListTableReport
 
TaxaListUtils - Class in net.maizegenetics.taxa
 
taxaMapFile() - Method in class net.maizegenetics.analysis.gobii.HapBreakpoints_IFLFilePlugin
tab-delimited File containing a TaxaColumn name to be used to map breakFile taxa with a GID. This may be a different file than was used for adding germplasm and marker data.
taxaMapFile(value) - Method in class net.maizegenetics.analysis.gobii.HapBreakpoints_IFLFilePlugin
Set mappingFile. tab-delimited File containing a TaxaColumn name to be used to map breakFile taxa with a GID. This may be a different file than was used for adding germplasm and marker data.
taxaMergeSelection() - Method in class net.maizegenetics.analysis.data.MergeGenotypeTablesPluginV2
Selection for Taxa Merge Rule
taxaMergeSelection(value) - Method in class net.maizegenetics.analysis.data.MergeGenotypeTablesPluginV2
Set Taxa Merge Rule. Selection for Taxa Merge Rule
taxaName() - Method in class net.maizegenetics.analysis.b4r.GetPhenotypeFromB4RPlugin
Name of the taxa
taxaName(value) - Method in class net.maizegenetics.analysis.b4r.GetPhenotypeFromB4RPlugin
Set Taxa Name. Name of the taxa
taxaName(index) - Method in class net.maizegenetics.dna.snp.CombineGenotypeTable
 
taxaName(index) - Method in class net.maizegenetics.dna.snp.CoreGenotypeTable
 
taxaName(index) - Method in interface net.maizegenetics.dna.snp.GenotypeTable
Return taxa name at given index.
taxaName(index) - Method in class net.maizegenetics.dna.snp.MergedGenotypeTable
 
taxaName(index) - Method in class net.maizegenetics.dna.snp.TOPMGenotypeTable
 
taxaName(index) - Method in interface net.maizegenetics.taxa.TaxaList
Return taxa name at given index.
taxaNames(value) - Method in class net.maizegenetics.analysis.data.HDF5SummaryPlugin
 
taxaNames() - Method in class net.maizegenetics.analysis.data.HDF5SummaryPlugin
 
taxaNames - Variable in class net.maizegenetics.analysis.gbs.SimpleGenotypeSBit
 
taxaNames - Variable in class net.maizegenetics.dna.tag.AbstractTagsByTaxa
Deprecated. 
taxaNames - Variable in class net.maizegenetics.dna.tag.ReadsByTaxa
 
taxaNum - Variable in class net.maizegenetics.analysis.gbs.SimpleGenotypeSBit
 
taxaNum - Variable in class net.maizegenetics.dna.tag.AbstractTagsByTaxa
 
taxaNum - Variable in class net.maizegenetics.dna.tag.ReadsByTaxa
 
taxaRedirect(fromNames, toNames) - Static method in class net.maizegenetics.analysis.gbs.MergeTagsByTaxaFilesPlugin
 
taxaRenameKey() - Method in class net.maizegenetics.analysis.data.MergeRenameDeleteTaxaPlugin
Tab-delimited file with original and new taxa names. Taxa with the same new name will be merged. Taxa with the new name "delete" will be removed. Any other columns (and the header line) are ignored.
taxaRenameKey(value) - Method in class net.maizegenetics.analysis.data.MergeRenameDeleteTaxaPlugin
Set Taxa Rename Key. Tab-delimited file with original and new taxa names. Taxa with the same new name will be merged. Taxa with the new name "delete" will be removed. Any other columns (and the header line) are ignored.
taxaSubset() - Method in class net.maizegenetics.analysis.filter.FilterSubsetPlugin
 
taxaSummary() - Method in class net.maizegenetics.analysis.data.GenotypeSummaryPlugin
Get Taxa Summary
taxaSummary(value) - Method in class net.maizegenetics.analysis.data.GenotypeSummaryPlugin
Set Taxa Summary. Get Taxa Summary
TaxaTissueDist - Class in net.maizegenetics.taxa
 
TaxaTissueDist(mtissue, mtaxa) - Constructor for class net.maizegenetics.taxa.TaxaTissueDist
 
taxaToKeep() - Method in class net.maizegenetics.analysis.filter.FilterSubsetPlugin
 
taxaTranslations() - Method in class net.maizegenetics.dna.snp.Translate
 
taxaWithDepths() - Method in interface net.maizegenetics.dna.tag.TaxaDistribution
Two arrays with the list of taxa with the tag (i.e. depth>0) int[0], and the depth of the taxa in the second array int[1]
taxon(taxon) - Method in class net.maizegenetics.dna.snp.Translate
 
taxon(obs) - Method in class net.maizegenetics.phenotype.TaxaAttribute
 
Taxon - Class in net.maizegenetics.taxa
An identifier for some sampled data. This will most often be for example, the accession number of a DNA sequence, or the taxonomic name that the sequence represents, et cetera. The generally used class for defining a taxon. Contains its name, plus a series of optional annotations. Use the builder to create immutable instances.
Taxon(name) - Constructor for class net.maizegenetics.taxa.Taxon
 
Taxon(name, anno) - Constructor for class net.maizegenetics.taxa.Taxon
 
Taxon.Builder - Class in net.maizegenetics.taxa
A builder for creating immutable Taxon instances.
TAXON_SCHEMA - Static variable in class net.maizegenetics.analysis.avro.AvroConstants
 
taxonDonors(taxon, site) - Method in class net.maizegenetics.dna.snp.genotypecall.ProjectionGenotypeCallTable
 
taxonIndex - Variable in class net.maizegenetics.analysis.clustering.Haplotype
The index of the taxon from the originating alignment from which this sequence was taken
taxonMask(taxon) - Method in class net.maizegenetics.dna.snp.AbstractMaskMatrix
 
taxonMask(taxon) - Method in class net.maizegenetics.dna.snp.MaskGenotypeMatrix
 
taxonMask(taxon) - Method in class net.maizegenetics.dna.snp.MaskGenotypeStatsMatrix
 
taxonSite(taxon, site) - Method in class net.maizegenetics.dna.snp.Translate
 
taxonSite(taxon, site) - Method in class net.maizegenetics.dna.snp.TranslateNegative
 
taxonStats(taxon) - Method in interface net.maizegenetics.dna.snp.genotypecall.GenotypeCallTable
 
TBIT - Static variable in class net.maizegenetics.dna.snp.HapMapHDF5Constants
 
tCons(name, value) - Static method in class net.maizegenetics.util.db.DefaultDBTuple
 
tcrossproduct() - Method in class net.maizegenetics.matrixalgebra.Matrix.BlasDoubleMatrix
 
tcrossproduct(dm) - Method in class net.maizegenetics.matrixalgebra.Matrix.BlasDoubleMatrix
 
tcrossproduct() - Method in class net.maizegenetics.matrixalgebra.Matrix.ColtDoubleMatrix
 
tcrossproduct(dm) - Method in class net.maizegenetics.matrixalgebra.Matrix.ColtDoubleMatrix
 
tcrossproduct() - Method in interface net.maizegenetics.matrixalgebra.Matrix.DoubleMatrix
 
tcrossproduct(dm) - Method in interface net.maizegenetics.matrixalgebra.Matrix.DoubleMatrix
 
tcrossproduct() - Method in class net.maizegenetics.matrixalgebra.Matrix.EJMLDoubleMatrix
 
tcrossproduct(dm) - Method in class net.maizegenetics.matrixalgebra.Matrix.EJMLDoubleMatrix
 
TerryPipelines - Class in net.maizegenetics.analysis.gbs
 
testAddedTerm(testedTerm, addedTerm, theModel) - Method in class net.maizegenetics.analysis.modelfitter.StepwiseAddDomModelFitter
 
testAddedTerm(testedTerm, addedTerm, theModel) - Method in class net.maizegenetics.analysis.modelfitter.StepwiseAdditiveModelFitter
 
testMarkerUsingEMMA(result, y, X, K, Z, nAlleles, markerIds) - Method in class net.maizegenetics.analysis.association.CompressedMLMusingDoubleMatrix
 
testMarkerUsingP3D(result, y, X, invV, markerdf, markerIds) - Method in class net.maizegenetics.analysis.association.CompressedMLMusingDoubleMatrix
 
testNewEffect(me) - Method in class net.maizegenetics.stats.linearmodels.LinearModelForStepwiseRegression
 
testNewEffect(covariate) - Method in class net.maizegenetics.stats.linearmodels.LinearModelForStepwiseRegression
 
testNewModelEffect(me) - Method in class net.maizegenetics.stats.linearmodels.PartitionedLinearModel
 
testNewModelEffect(covariate) - Method in class net.maizegenetics.stats.linearmodels.PartitionedLinearModel
 
testPhenotypeForMissingData(pheno) - Method in class net.maizegenetics.analysis.modelfitter.StepwiseAdditiveModelFitter
 
testSites(obsTdist, obsMajor, obsMinor, maf, binomFunc) - Method in class net.maizegenetics.analysis.gbs.TagAgainstAnchor
Test association using binomial test, collecting P-value
testSites(obsTdist, obsMajor, obsMinor, binomFunc) - Static method in class net.maizegenetics.analysis.gbs.TagAgainstAnchor
Test association using binomial test, collecting P-value
testSites(obsTdist, obsMajor, obsMinor, maf, binomFunc) - Method in class net.maizegenetics.analysis.gbs.TagAgainstAnchorHypothesis
Test association using binomial test, collecting P-value
testSites(obsTdist, obsMajor, obsMinor, binomFunc) - Static method in class net.maizegenetics.analysis.gbs.TagAgainstAnchorHypothesis
Test association using binomial test, collecting P-value
testTaxaReplication() - Method in class net.maizegenetics.analysis.association.AbstractFixedEffectLM
 
testTaxaReplication() - Method in class net.maizegenetics.analysis.association.PhenotypeLM
 
TEXT - Static variable in class net.maizegenetics.gui.PrintHeapAction
 
textOutput() - Method in class net.maizegenetics.analysis.gbs.MergeMultipleTagCountPlugin
 
textOutput(value) - Method in class net.maizegenetics.analysis.gbs.MergeMultipleTagCountPlugin
 
textOutputFormat() - Method in class net.maizegenetics.analysis.gbs.SAMConverterPlugin
 
textOutputFormat(value) - Method in class net.maizegenetics.analysis.gbs.SAMConverterPlugin
 
TextToBinaryPlugin - Class in net.maizegenetics.analysis.gbs
 
TextToBinaryPlugin(parentFrame) - Constructor for class net.maizegenetics.analysis.gbs.TextToBinaryPlugin
 
theClusters - Variable in class net.maizegenetics.analysis.association.CompressedDoubleMatrix
 
theEnzyme - Static variable in class net.maizegenetics.analysis.gbs.ParseBarcodeRead
 
ThinSitesByPositionPlugin - Class in net.maizegenetics.analysis.data
Plugin to thin out sites based on their physical position on the chromosome. Expects the user to enter a minimum distance between sites in base pair. Accepts and writes .hmp.txt, .hmp.txt.gz, .vcf, .vcf.gz and .h5 files.
ThinSitesByPositionPlugin() - Constructor for class net.maizegenetics.analysis.data.ThinSitesByPositionPlugin
 
ThinSitesByPositionPlugin(parentFrame, isInteractive) - Constructor for class net.maizegenetics.analysis.data.ThinSitesByPositionPlugin
 
thirdAllele(site) - Method in interface net.maizegenetics.dna.snp.genotypecall.GenotypeCallTable
Return the second minor allele at given site (Third allele state). Gap is included as state. Heterozygous count one for each allele value. Homozygous counts two for the allele value.
thirdAlleleForAllSites() - Method in interface net.maizegenetics.dna.snp.genotypecall.GenotypeCallTable
Returns third (second minor) allele for all sites.
ThreadedPluginListener - Class in net.maizegenetics.plugindef
 
ThreadedPluginListener(pluginListener, event) - Constructor for class net.maizegenetics.plugindef.ThreadedPluginListener
 
tissueNameField - Static variable in class net.maizegenetics.analysis.gbs.v2.GBSUtils
 
tissueNameField - Static variable in class net.maizegenetics.util.ConvertOldFastqToModernFormatPlugin
 
to1DArray() - Method in class net.maizegenetics.matrixalgebra.Matrix.BlasDoubleMatrix
 
to1DArray() - Method in class net.maizegenetics.matrixalgebra.Matrix.ColtDoubleMatrix
 
to1DArray() - Method in interface net.maizegenetics.matrixalgebra.Matrix.DoubleMatrix
 
to1DArray() - Method in class net.maizegenetics.matrixalgebra.Matrix.EJMLDoubleMatrix
 
to_sibling - Variable in class net.maizegenetics.analysis.gbs.neobio.Trie
The character that labels the edge from this node to the sibling pointer by sibling.
to_son - Variable in class net.maizegenetics.analysis.gbs.neobio.Trie
The character that labels the edge from this node to the child node pointer by son.
toArray() - Method in class net.maizegenetics.analysis.avro.GenericArrayPositions
 
toArray(a) - Method in class net.maizegenetics.analysis.avro.GenericArrayPositions
 
toArray() - Method in class net.maizegenetics.analysis.avro.GenericArrayTaxa
 
toArray(a) - Method in class net.maizegenetics.analysis.avro.GenericArrayTaxa
 
toArray() - Method in class net.maizegenetics.dna.snp.FilterList
 
toArray(a) - Method in class net.maizegenetics.dna.snp.FilterList
 
toArray() - Method in class net.maizegenetics.dna.tag.UTagCountMutable
 
toArray() - Method in class net.maizegenetics.matrixalgebra.Matrix.BlasDoubleMatrix
 
toArray() - Method in class net.maizegenetics.matrixalgebra.Matrix.ColtDoubleMatrix
 
toArray() - Method in interface net.maizegenetics.matrixalgebra.Matrix.DoubleMatrix
 
toArray() - Method in class net.maizegenetics.matrixalgebra.Matrix.EJMLDoubleMatrix
 
toArray() - Method in class net.maizegenetics.util.UndirectedGraph.UndirectedSet
 
toBigDecimal(number) - Static method in class net.maizegenetics.util.db.Transformations
 
toBinary() - Method in class net.maizegenetics.analysis.gbs.UTagPairToTOPMPlugin
File to output TOPM in binary format
toBinary(value) - Method in class net.maizegenetics.analysis.gbs.UTagPairToTOPMPlugin
Set To Binary. File to output TOPM in binary format
toBoolean(o) - Static method in class net.maizegenetics.util.db.Transformations
 
toBoolean(o) - Static method in class net.maizegenetics.util.db.Transformations
 
toBoolean(o) - Static method in class net.maizegenetics.util.db.Transformations
 
toCSVString() - Method in interface net.maizegenetics.dna.tag.Tag
 
toFASTA(outfile) - Method in class net.maizegenetics.dna.tag.TagCounts
Convert TagCounts to FASTA file for alignment using Blast
toFASTQ(infile, outfile) - Method in class net.maizegenetics.dna.tag.TagCounts
Reads in a binary tag count file line-by-line and constructs a FASTQ file for alignment.
TOL - Static variable in class net.maizegenetics.stats.linearmodels.SweepFast
 
toNumber(number, target) - Static method in class net.maizegenetics.util.db.Transformations
 
TOP_DIRECTION - Static variable in class net.maizegenetics.analysis.gbs.neobio.CrochemoreLandauZivUkelson
A constant that indicates that the top direction must be followed to reach the source of an optimal path in a block during the trace back procedure to retrieve a high scoring alignment.
toPadString(A) - Static method in class net.maizegenetics.util.BitUtil
 
toPadStringLowSiteToHighSite(A) - Static method in class net.maizegenetics.util.BitUtil
Returns the bits in the same order that we store them for TASSEL
TOPMGenotypeTable - Class in net.maizegenetics.dna.snp
 
TOPMGenotypeTable(topm) - Constructor for class net.maizegenetics.dna.snp.TOPMGenotypeTable
 
TOPMGenotypeTableCellRenderer - Class in net.maizegenetics.gui
 
TOPMGenotypeTableCellRenderer(model, genotypeTable) - Constructor for class net.maizegenetics.gui.TOPMGenotypeTableCellRenderer
 
TOPMInterface - Interface in net.maizegenetics.dna.map
Tags on Physical Map (TOPM) Interface. Define methods for the TOPM classes. The TOPM class holds information relating tags to the physical map, variants (SNPs) called by the tag, and quality of mapping information.
TOPMSummaryPlugin - Class in net.maizegenetics.analysis.gbs
 
TOPMSummaryPlugin(parentFrame) - Constructor for class net.maizegenetics.analysis.gbs.TOPMSummaryPlugin
 
TOPMTableReport - Class in net.maizegenetics.dna.map
 
TOPMTableReport(topm) - Constructor for class net.maizegenetics.dna.map.TOPMTableReport
 
TOPMUtils - Class in net.maizegenetics.dna.map
Utility method for reading and writing TOPM files based on their file name suffixes.
toReadableString(bitSet) - Static method in class net.maizegenetics.util.BitUtil
 
toReverseComplement() - Method in interface net.maizegenetics.dna.tag.Tag
 
toString() - Method in class net.maizegenetics.analysis.clustering.Haplotype
 
toString() - Method in class net.maizegenetics.analysis.clustering.HaplotypeCluster
 
toString() - Method in class net.maizegenetics.analysis.data.CombineDataSetsPlugin
 
toString() - Method in enum net.maizegenetics.analysis.data.FileLoadPlugin.TasselFileType
 
toString() - Method in class net.maizegenetics.analysis.data.MeanR2FromLDPlugin.AccumulateR2
 
toString() - Method in class net.maizegenetics.analysis.gbs.Barcode
 
toString() - Method in class net.maizegenetics.analysis.gbs.neobio.BasicScoringScheme
Returns a String representation of this scoring scheme.
toString() - Method in class net.maizegenetics.analysis.gbs.neobio.CharSequence
Returns a string representation of the sequence.
toString() - Method in class net.maizegenetics.analysis.gbs.neobio.Factor
Returns a string representation of the text represented by this factor. It inspects its chain of ancestors up until as far as the root factor, spelling their new characters out.
toString() - Method in class net.maizegenetics.analysis.gbs.neobio.FactorSequence
Reconstructs the sequence from the list of factors induced by the LZ78 parsing of the text.
toString() - Method in class net.maizegenetics.analysis.gbs.neobio.PairwiseAlignment
Returns a four-line String representation of this alignment in the following order: first gapped sequence, score tag line, second gapped sequence and the score value.
toString() - Method in class net.maizegenetics.analysis.gbs.neobio.ScoringMatrix
Returns a String representation of this scoring matrix.
toString() - Method in class net.maizegenetics.analysis.gbs.ReadBarcodeResult
 
toString() - Method in class net.maizegenetics.analysis.gbs.repgen.AlignmentInfo
 
toString() - Method in class net.maizegenetics.analysis.gbs.ShortReadBarcodeResult
 
toString() - Method in class net.maizegenetics.analysis.modelfitter.SNP
 
toString() - Method in class net.maizegenetics.analysis.phg.ParseGVCF.GVCFLine
 
toString() - Method in class net.maizegenetics.analysis.popgen.DiversityAnalyses
 
toString() - Method in class net.maizegenetics.analysis.popgen.DonorHypoth
 
toString() - Method in class net.maizegenetics.analysis.popgen.LDResult
 
toString() - Method in class net.maizegenetics.analysis.popgen.LinkageDisequilibrium
Returns representation of the LD results as a string
toString() - Method in class net.maizegenetics.analysis.popgen.PolymorphismDistribution
 
toString() - Method in class net.maizegenetics.analysis.rna.FindMatchByWordHash
 
toString() - Method in class net.maizegenetics.dna.map.Chromosome
 
toString() - Method in class net.maizegenetics.dna.map.DonorHaplotypes
 
toString() - Method in class net.maizegenetics.dna.map.GeneralPosition
 
toString() - Method in class net.maizegenetics.dna.map.GenomeFeature
 
toString() - Method in class net.maizegenetics.dna.tag.AbstractTag
 
toString() - Method in class net.maizegenetics.gui.AbstractGenotypeTableMask
 
toString() - Method in class net.maizegenetics.matrixalgebra.Matrix.BlasDoubleMatrix
 
toString() - Method in class net.maizegenetics.matrixalgebra.Matrix.ColtDoubleMatrix
 
toString() - Method in class net.maizegenetics.phenotype.CategoricalAttribute
 
toString() - Method in class net.maizegenetics.phenotype.NumericAttribute
 
toString() - Method in class net.maizegenetics.phenotype.TaxaAttribute
 
toString() - Method in enum net.maizegenetics.pipeline.TasselPipeline.FLAGS
 
toString() - Method in class net.maizegenetics.plugindef.DataSet
 
toString() - Method in class net.maizegenetics.plugindef.Datum
 
toString() - Method in class net.maizegenetics.stats.linearmodels.BasicLevel
 
toString() - Method in class net.maizegenetics.taxa.distance.DistanceMatrix
returns representation of this alignment as a string
toString() - Method in class net.maizegenetics.taxa.IdentifierSynonymizer
 
toString() - Method in class net.maizegenetics.taxa.Taxon
 
toString() - Method in class net.maizegenetics.taxa.tree.CladeSystem
print clade system
toString() - Method in class net.maizegenetics.taxa.tree.MultiParameterized
 
toString() - Method in class net.maizegenetics.taxa.tree.SimpleNode
 
toString() - Method in class net.maizegenetics.taxa.tree.SimpleTree
 
toString() - Method in class net.maizegenetics.taxa.tree.SplitSystem
print split system
toString() - Method in exception net.maizegenetics.util.db.DataAccessException
 
toString() - Method in class net.maizegenetics.util.db.DefaultDBTuple
 
toString() - Method in class net.maizegenetics.util.db.Pair
 
toString() - Method in class net.maizegenetics.util.Tuple
 
toStringTabDelim() - Method in interface net.maizegenetics.util.TableReport
 
toStringWithVCFAnnotation() - Method in class net.maizegenetics.taxa.Taxon
 
totalcfmSSdf - Variable in class net.maizegenetics.analysis.association.AbstractFixedEffectLM
 
totalDepth() - Method in interface net.maizegenetics.dna.tag.TaxaDistribution
Total depth across all taxa of the tag
totalGametesNonMissingForSite(site) - Method in class net.maizegenetics.dna.snp.CombineGenotypeTable
 
totalGametesNonMissingForSite(site) - Method in class net.maizegenetics.dna.snp.CoreGenotypeTable
 
totalGametesNonMissingForSite(alleles) - Static method in class net.maizegenetics.dna.snp.genotypecall.AlleleFreqCache
 
totalGametesNonMissingForSite(site) - Method in interface net.maizegenetics.dna.snp.genotypecall.GenotypeCallTable
Returns total number of non-missing allele values for given site. This can be twice the number of taxa, as diploid values are supported.
totalGametesNonMissingForSite() - Method in class net.maizegenetics.dna.snp.genotypecall.Stats
 
totalGametesNonMissingForSite(site) - Method in interface net.maizegenetics.dna.snp.GenotypeTable
Returns total number of non-missing allele values for given site. This can be twice the number of taxa, as diploid values are supported.
totalGametesNonMissingForSite(site) - Method in class net.maizegenetics.dna.snp.MergedGenotypeTable
 
totalGametesNonMissingForSite(site) - Method in class net.maizegenetics.dna.snp.TOPMGenotypeTable
 
totalGametesNonMissingForTaxon(taxon) - Method in class net.maizegenetics.dna.snp.CombineGenotypeTable
 
totalGametesNonMissingForTaxon(taxon) - Method in class net.maizegenetics.dna.snp.CoreGenotypeTable
 
totalGametesNonMissingForTaxon(taxon) - Method in interface net.maizegenetics.dna.snp.genotypecall.GenotypeCallTable
Returns total number of non-missing allele values for given taxon. This can be twice the number of sites, as diploid values are supported.
totalGametesNonMissingForTaxon(taxon) - Method in interface net.maizegenetics.dna.snp.GenotypeTable
Returns total number of non-missing allele values for given taxon. This can be twice the number of sites, as diploid values are supported.
totalGametesNonMissingForTaxon(taxon) - Method in class net.maizegenetics.dna.snp.MergedGenotypeTable
 
totalGametesNonMissingForTaxon(taxon) - Method in class net.maizegenetics.dna.snp.TOPMGenotypeTable
 
totalNonMissingForSite(site) - Method in class net.maizegenetics.dna.snp.CombineGenotypeTable
 
totalNonMissingForSite(site) - Method in class net.maizegenetics.dna.snp.CoreGenotypeTable
 
totalNonMissingForSite(site) - Method in interface net.maizegenetics.dna.snp.genotypecall.GenotypeCallTable
Returns total number of non-missing taxa for given site. Taxa are considered missing only if both allele values are Unknown (N).
totalNonMissingForSite(site) - Method in interface net.maizegenetics.dna.snp.GenotypeTable
Returns total number of non-missing taxa for given site. Taxa are considered missing only if both allele values are Unknown (N).
totalNonMissingForSite(site) - Method in class net.maizegenetics.dna.snp.MergedGenotypeTable
 
totalNonMissingForSite(site) - Method in class net.maizegenetics.dna.snp.TOPMGenotypeTable
 
totalNonMissingForTaxon(taxon) - Method in class net.maizegenetics.dna.snp.CombineGenotypeTable
 
totalNonMissingForTaxon(taxon) - Method in class net.maizegenetics.dna.snp.CoreGenotypeTable
 
totalNonMissingForTaxon(taxon) - Method in interface net.maizegenetics.dna.snp.genotypecall.GenotypeCallTable
Returns total number of non-missing sites for given taxon. Sites are considered missing only if both allele values are Unknown (N).
totalNonMissingForTaxon(taxon) - Method in interface net.maizegenetics.dna.snp.GenotypeTable
Returns total number of non-missing sites for given taxon. Sites are considered missing only if both allele values are Unknown (N).
totalNonMissingForTaxon(taxon) - Method in class net.maizegenetics.dna.snp.MergedGenotypeTable
 
totalNonMissingForTaxon(taxon) - Method in class net.maizegenetics.dna.snp.TOPMGenotypeTable
 
totalNumberOfTags() - Method in class net.maizegenetics.analysis.rna.FindMatchByWordHash
Total number of tags (reference sequences)
totalSites - Variable in class net.maizegenetics.analysis.popgen.DonorHypoth
 
totalVariance() - Method in class net.maizegenetics.analysis.data.PrincipalComponentsPlugin
The first principal components that together explain this proportion of the total variance will be returned.
totalVariance(value) - Method in class net.maizegenetics.analysis.data.PrincipalComponentsPlugin
Set total variance. The first principal components that together explain this proportion of the total variance will be returned.
toText() - Method in class net.maizegenetics.analysis.gbs.UTagPairToTOPMPlugin
File to output TOPM in text format
toText(value) - Method in class net.maizegenetics.analysis.gbs.UTagPairToTOPMPlugin
Set To Text. File to output TOPM in text format
trace(indent) - Method in class net.maizegenetics.plugindef.AbstractPlugin
 
traitname - Variable in class net.maizegenetics.analysis.modelfitter.AbstractForwardRegression
 
traitsToTransform() - Method in class net.maizegenetics.analysis.numericaltransform.TransformDataDialog
 
trancateTag() - Method in class net.maizegenetics.dna.map.PETagsOnPhysicalMapV3
Full length PE tags are truncated to certain size (2 longs in GBS Build V3.0)
transform(instance) - Method in interface net.maizegenetics.util.db.TypeTransformer
 
Transformations - Class in net.maizegenetics.util.db
A Utility class for various type transformations User: julian3 Date: 2013/11/13 Time: 7:20 AM PROJECT: lambda tuples DESCRIPTION: Code Borrowed from http://java.dzone.com/articles/adding-java-8-lambda-goodness Original package can be downloaded from https://github.com/jexenberger/lambda-tuples
transformAttribute(myAttribute) - Method in class net.maizegenetics.analysis.numericaltransform.TransformDataPlugin
 
TransformDataDialog - Class in net.maizegenetics.analysis.numericaltransform
 
TransformDataDialog(parentFrame, dataAttributes, factorAttributes) - Constructor for class net.maizegenetics.analysis.numericaltransform.TransformDataDialog
 
TransformDataPlugin - Class in net.maizegenetics.analysis.numericaltransform
 
TransformDataPlugin(parentFrame, isInteractive) - Constructor for class net.maizegenetics.analysis.numericaltransform.TransformDataPlugin
 
TransformDataPlugin.BASE - Enum in net.maizegenetics.analysis.numericaltransform
 
TransformerService - Class in net.maizegenetics.util.db
Service for type transformation User: julian3 Date: 2013/11/13 Time: 9:41 AM PROJECT: ${PROJECT} DESCRIPTION: Code Borrowed from http://java.dzone.com/articles/adding-java-8-lambda-goodness Original package can be downloaded from https://github.com/jexenberger/lambda-tuples
transformToAlleleProbability(myGenotype) - Static method in class net.maizegenetics.analysis.numericaltransform.NumericalGenotypePlugin
 
transformTraits(myPhenotype, myData) - Method in class net.maizegenetics.analysis.numericaltransform.TransformDataPlugin
 
transition(transition) - Method in class net.maizegenetics.analysis.imputation.BackwardForwardAlgorithm
 
transition(transition) - Method in class net.maizegenetics.analysis.imputation.BackwardForwardVariableStateNumber
 
TransitionProbability - Class in net.maizegenetics.analysis.imputation
 
TransitionProbabilityWithVariableRecombination - Class in net.maizegenetics.analysis.imputation
 
TransitionProbabilityWithVariableRecombination(chromosome) - Constructor for class net.maizegenetics.analysis.imputation.TransitionProbabilityWithVariableRecombination
 
Translate - Class in net.maizegenetics.dna.snp
This translates filtered taxa and sites. Also indicates masking, but this implementation has no mask.
translate(index) - Method in class net.maizegenetics.dna.snp.TranslateIndex
Translates index to base index. This class has no translation.
translate(index) - Method in class net.maizegenetics.dna.snp.TranslateIndexRange
 
translate(index) - Method in class net.maizegenetics.dna.snp.TranslateIndexRedirect
Translates index to base index.
TranslateBuilder - Class in net.maizegenetics.dna.snp
 
TranslateIndex - Class in net.maizegenetics.dna.snp
No translation to index.
TranslateIndexBuilder - Class in net.maizegenetics.dna.snp
 
TranslateIndexRange - Class in net.maizegenetics.dna.snp
 
TranslateIndexRedirect - Class in net.maizegenetics.dna.snp
Translation redirects index to corresponding index in base genotype table.
TranslateIndexRedirectUnordered - Class in net.maizegenetics.dna.snp
 
TranslateNegative - Class in net.maizegenetics.dna.snp
 
translateSite(site) - Method in class net.maizegenetics.dna.snp.CombineGenotypeTable
Returns which genotypeTable to use.
translateSitesBackToOriginal(sites, translation) - Static method in class net.maizegenetics.analysis.imputation.NucleotideImputationUtils
 
translateToRealIndices(shownIndices) - Method in class net.maizegenetics.gui.AbstractAvailableListModel
 
transpose() - Method in class net.maizegenetics.matrixalgebra.Matrix.BlasDoubleMatrix
 
transpose() - Method in class net.maizegenetics.matrixalgebra.Matrix.ColtDoubleMatrix
 
transpose() - Method in interface net.maizegenetics.matrixalgebra.Matrix.DoubleMatrix
 
transpose() - Method in class net.maizegenetics.matrixalgebra.Matrix.EJMLDoubleMatrix
 
transpose(matrix, numDataRows, numRows, numColumns, listener) - Static method in class net.maizegenetics.util.BitUtil
This converts taxa optimized Bit Sets to site optimized Bit Sets and vice versa.
transpose(orig) - Static method in class net.maizegenetics.util.BitUtil
Transposes 64 x 64 bit matrix. The below before and after locations. 1 2 4 2 3 4 3 1
transpose() - Method in class net.maizegenetics.util.SuperByteMatrixSingle
 
transposeData(siteInnerLoop) - Method in class net.maizegenetics.dna.snp.genotypecall.CombineGenotypeCallTable
 
transposeData(siteInnerLoop) - Method in class net.maizegenetics.dna.snp.genotypecall.DifferenceGenotypeCallTable
 
transposeData(siteInnerLoop) - Method in interface net.maizegenetics.dna.snp.genotypecall.GenotypeCallTable
Tells this Genotype to transpose it's data to optimize performance for given iteration nesting. If siteInnerLoop is true, performance better when looping through sites inside taxa loop. If false, performance better when looping through taxa inside site loop.
transposeData(siteInnerLoop) - Method in class net.maizegenetics.dna.snp.genotypecall.GOBIIAvroGenotypeCallTable
 
transposeData(siteInnerLoop) - Method in class net.maizegenetics.dna.snp.genotypecall.GOBIIGenotypeCallTable
 
transposeData(siteInnerLoop) - Method in class net.maizegenetics.dna.snp.genotypecall.HybridGenotypeCallTable
 
transposeData(siteInnerLoop) - Method in class net.maizegenetics.dna.snp.genotypecall.LineIndexHapmapGenotypeCallTable
 
transposeData(siteInnerLoop) - Method in class net.maizegenetics.dna.snp.genotypecall.MaskGenotypeCallTable
 
transposeData(siteInnerLoop) - Method in class net.maizegenetics.dna.snp.genotypecall.MergedGenotypeCallTable
 
transposeData(siteInnerLoop) - Method in class net.maizegenetics.dna.snp.genotypecall.ProjectionGenotypeCallTable
 
transposeInPlace() - Method in class net.maizegenetics.matrixalgebra.Matrix.BlasDoubleMatrix
 
traverseBlock(block, source, gapped_seq1, tag_line, gapped_seq2) - Method in class net.maizegenetics.analysis.gbs.neobio.CrochemoreLandauZivUkelson
Traverses a block to retrieve a part of an optimal alignment from the specified source in the output border to an entry in the input border.
traverseBlockCrossingPath(block, gapped_seq1, tag_line, gapped_seq2) - Method in class net.maizegenetics.analysis.gbs.neobio.CrochemoreLandauZivUkelsonLocalAlignment
Traverses a series of block crossing paths to retrieve an optimal alignment. A block-crossing path consists of a (possibly empty) S-path (a path that starts inside a block and ends in its output border), followed by any number of paths that cross a block from its input border to its output border, and ending in an E-path (a path that starts in the input border of a block and ends inside the block).
traverseS_Path(block, gapped_seq1, tag_line, gapped_seq2) - Method in class net.maizegenetics.analysis.gbs.neobio.CrochemoreLandauZivUkelsonLocalAlignment
Traverses an S-path of a block to retrieve a part of an optimal alignment from the new vertex of a block to entry in its input border. This method is essentially similar to the traverseBlock. The only difference is that it uses the information of the S_direction field of the LocalAlignmentBlock class.
Tree - Interface in net.maizegenetics.taxa.tree
Interface for a phylogenetic or genealogical tree.
TreeClusters - Class in net.maizegenetics.taxa.tree
 
TreeClusters(theTree) - Constructor for class net.maizegenetics.taxa.tree.TreeClusters
 
TreeParseException - Exception in net.maizegenetics.taxa.tree
exception thrown by ReadTree
TreeParseException() - Constructor for exception net.maizegenetics.taxa.tree.TreeParseException
 
TreeParseException(msg) - Constructor for exception net.maizegenetics.taxa.tree.TreeParseException
 
TreeUtils - Class in net.maizegenetics.taxa.tree
various utility functions on trees.
Trie - Class in net.maizegenetics.analysis.gbs.neobio
This class implements a trie, or a digital search tree. A trie is a multiway tree (each node can have multiple children) that represents a set of strings.
Trie(data) - Constructor for class net.maizegenetics.analysis.gbs.neobio.Trie
Creates a new trie node with the specified data. This constructor is typically used by the client only once to instantiate the root node. After that, all new nodes are implicitly instantiated by the add method.
trimTrailingZeros() - Method in interface net.maizegenetics.util.BitSet
Lowers numWords, the number of words in use, by checking for trailing zero words.
trimTrailingZeros() - Method in class net.maizegenetics.util.OpenBitSet
Lowers numWords, the number of words in use, by checking for trailing zero words.
trimTrailingZeros() - Method in class net.maizegenetics.util.UnmodifiableBitSet
 
truncateTaxonNames() - Method in class net.maizegenetics.dna.tag.AbstractTagsByTaxa
Truncates each taxon name to everything up to the first colon, and converts all letters to lower case. This causes tag counts from taxa with identical names to be merged.
truncateTaxonNames() - Method in interface net.maizegenetics.dna.tag.TagsByTaxa
Deprecated. 
truSeqIAdaptor1 - Static variable in class net.maizegenetics.dna.read.ReadUtils
Illumina TruSeq index adaptor part 1, before barcode
truSeqIAdaptor2 - Static variable in class net.maizegenetics.dna.read.ReadUtils
Illumina TruSeq index adaptor part 2, after barcode
truSeqUAdaptor - Static variable in class net.maizegenetics.dna.read.ReadUtils
Illumina TruSeq universal adaptor
tryAdvance(action) - Method in class net.maizegenetics.analysis.modelfitter.AddDomPermutationTestSpliterator
 
tryAdvance(action) - Method in class net.maizegenetics.analysis.modelfitter.CovariatePermutationTestSpliterator
 
tryAdvance(action) - Method in class net.maizegenetics.analysis.modelfitter.ForwardStepAddDomSpliterator
 
tryAdvance(action) - Method in class net.maizegenetics.analysis.modelfitter.ForwardStepAdditiveSpliterator
 
tryAdvance(action) - Method in class net.maizegenetics.analysis.modelfitter.ForwardStepNestedAdditiveSpliterator
 
tryAdvance(action) - Method in class net.maizegenetics.analysis.modelfitter.ForwardStepSubsettingAdditiveSpliterator
 
tryAdvance(action) - Method in class net.maizegenetics.analysis.modelfitter.ForwardStepSubsettingNestedAdditiveSpliterator
 
tryAdvance(action) - Method in class net.maizegenetics.analysis.modelfitter.NestedCovariatePermutationTestSpliterator
 
trySplit() - Method in class net.maizegenetics.analysis.modelfitter.CovariatePermutationTestSpliterator
 
trySplit() - Method in class net.maizegenetics.analysis.modelfitter.ForwardStepAddDomSpliterator
 
trySplit() - Method in class net.maizegenetics.analysis.modelfitter.ForwardStepAdditiveSpliterator
 
trySplit() - Method in class net.maizegenetics.analysis.modelfitter.ForwardStepNestedAdditiveSpliterator
 
trySplit() - Method in class net.maizegenetics.analysis.modelfitter.ForwardStepSubsettingAdditiveSpliterator
 
trySplit() - Method in class net.maizegenetics.analysis.modelfitter.ForwardStepSubsettingNestedAdditiveSpliterator
 
trySplit() - Method in class net.maizegenetics.analysis.modelfitter.NestedCovariatePermutationTestSpliterator
 
tuple(list) - Static method in class net.maizegenetics.util.db.DefaultDBTuple
 
Tuple<X,Y> - Class in net.maizegenetics.util
Based on response in http://stackoverflow.com/questions/2670982/using-pairs-or-2-tuples-in-java
Tuple(x, y) - Constructor for class net.maizegenetics.util.Tuple
Instantiates a tuple object, which just holds 2 values
type() - Method in class net.maizegenetics.dna.map.GenomeFeature
 
type(type) - Method in class net.maizegenetics.dna.map.GenomeFeatureBuilder
 
TYPE_C_PATH - Static variable in class net.maizegenetics.analysis.gbs.neobio.CrochemoreLandauZivUkelsonLocalAlignment
A constant that indicates that the high scoring path ending in a given block is a C-path, i.e. one that starts inside the block.
TYPE_CROSSING_PATH - Static variable in class net.maizegenetics.analysis.gbs.neobio.CrochemoreLandauZivUkelsonLocalAlignment
A constant that indicates that the best path ending at a given entry of the output border is a block-crossing path (one that starts outside the block).
TYPE_E_PATH - Static variable in class net.maizegenetics.analysis.gbs.neobio.CrochemoreLandauZivUkelsonLocalAlignment
A constant that indicates that the high scoring path ending in a given block is an E-path, i.e. one that starts at its input border.
TYPE_S_PATH - Static variable in class net.maizegenetics.analysis.gbs.neobio.CrochemoreLandauZivUkelsonLocalAlignment
A constant that indicates that the best path ending at a given entry of the output border is a S-path (one that starts inside the block).
typeListCopy() - Method in class net.maizegenetics.phenotype.CorePhenotype
 
typeListCopy() - Method in class net.maizegenetics.phenotype.FilterPhenotype
 
typeListCopy() - Method in interface net.maizegenetics.phenotype.Phenotype
 
typeNameMap - Static variable in class net.maizegenetics.analysis.association.AbstractFixedEffectLM
 
typesOfRetainedAttributes(attributeTypes) - Method in class net.maizegenetics.phenotype.PhenotypeBuilder
 
TypeTransformer<T,K> - Interface in net.maizegenetics.util.db
Functional interface for transforming instance of one type to another User: julian3 Date: 2013/11/13 Time: 9:42 AM PROJECT: lambda-tuples DESCRIPTION: Code Borrowed from http://java.dzone.com/articles/adding-java-8-lambda-goodness Original package can be downloaded from https://github.com/jexenberger/lambda-tuples

U

U - Variable in class net.maizegenetics.stats.EMMA.EMMAforDoubleMatrix
 
UNDEFINED_ALLELE - Static variable in class net.maizegenetics.dna.snp.NucleotideAlignmentConstants
 
UNDEFINED_ALLELE_STR - Static variable in class net.maizegenetics.dna.snp.NucleotideAlignmentConstants
 
UNDEFINED_DIPLOID_ALLELE - Static variable in class net.maizegenetics.dna.snp.NucleotideAlignmentConstants
 
UndirectedGraph<T> - Class in net.maizegenetics.util
Class used to represent an undirected graph. The design is inspired by the Python networkx library (https://networkx.github.io/)
UndirectedGraph(nodes, adj, wts) - Constructor for class net.maizegenetics.util.UndirectedGraph
Constructs an undirected graph
UndirectedGraph.UndirectedIterator - Class in net.maizegenetics.util
 
UndirectedGraph.UndirectedSet<E> - Class in net.maizegenetics.util
 
UndirectedIterator(it) - Constructor for class net.maizegenetics.util.UndirectedGraph.UndirectedIterator
 
UndirectedSet(c) - Constructor for class net.maizegenetics.util.UndirectedGraph.UndirectedSet
 
UNetworkFilter - Class in net.maizegenetics.analysis.gbs
 
UNetworkFilter(mergedTagCountFileS, etr, tagPairFileS) - Constructor for class net.maizegenetics.analysis.gbs.UNetworkFilter
 
unimpAlign - Static variable in class net.maizegenetics.analysis.imputation.FILLINImputationPlugin
 
union() - Method in class net.maizegenetics.phenotype.GenotypePhenotypeBuilder
Indicates that a union join should be performed. The GenotypeTable and Phenotype will be used as is. If union is not specified, an intersect join will be performed by default
union(other) - Method in interface net.maizegenetics.util.BitSet
this = this OR other
union(other) - Method in class net.maizegenetics.util.OpenBitSet
this = this OR other
union(other) - Method in class net.maizegenetics.util.UnmodifiableBitSet
 
UnionAlignmentPlugin - Class in net.maizegenetics.analysis.data
 
UnionAlignmentPlugin(parentFrame, isInteractive) - Constructor for class net.maizegenetics.analysis.data.UnionAlignmentPlugin
Creates a new instance of UnionAlignmentPlugin
unionCount(a, b) - Static method in class net.maizegenetics.util.OpenBitSet
Returns the popcount or cardinality of the union of the two sets. Neither set is modified.
unionJoin() - Method in class net.maizegenetics.phenotype.PhenotypeBuilder
 
uniqueSites() - Method in class net.maizegenetics.dna.map.TagsOnPhysicalMap
Maps unique sites (i.e. bestChr and position) to the indices of the tags in which they are found.
UNIT_NAMES - Variable in interface net.maizegenetics.taxa.tree.Units
 
units(units) - Method in class net.maizegenetics.plugindef.PluginParameter.Builder
 
units() - Method in class net.maizegenetics.plugindef.PluginParameter
 
Units - Interface in net.maizegenetics.taxa.tree
interface holding unit constants
UnitsProvider - Interface in net.maizegenetics.taxa.tree
interface for classes that can provide the related Units used, (as
UNKNOWN - Static variable in class net.maizegenetics.dna.map.Chromosome
 
UNKNOWN - Variable in interface net.maizegenetics.taxa.tree.Units
 
UNKNOWN_ALLELE - Static variable in interface net.maizegenetics.dna.snp.GenotypeTable
 
UNKNOWN_ALLELE_CHAR - Static variable in interface net.maizegenetics.dna.snp.GenotypeTable
 
UNKNOWN_ALLELE_STR - Static variable in interface net.maizegenetics.dna.snp.GenotypeTable
 
UNKNOWN_COUNT - Static variable in class net.maizegenetics.dna.snp.genotypecall.AlleleFreqCache
 
UNKNOWN_DIPLOID_ALLELE - Static variable in interface net.maizegenetics.dna.snp.GenotypeTable
 
UNKNOWN_DIPLOID_ALLELE_STR - Static variable in interface net.maizegenetics.dna.snp.GenotypeTable
 
UNKNOWN_GAMETE_COUNT - Static variable in class net.maizegenetics.dna.snp.genotypecall.AlleleFreqCache
 
unloadSequences() - Method in class net.maizegenetics.analysis.gbs.neobio.PairwiseAlignmentAlgorithm
Frees pointer to loaded sequences and computed alignments (if any) so that their data can be garbage collected.
unloadSequencesInternal() - Method in class net.maizegenetics.analysis.gbs.neobio.CrochemoreLandauZivUkelson
Frees pointers to loaded sequences and the the block table so that their data can be garbage collected.
unloadSequencesInternal() - Method in class net.maizegenetics.analysis.gbs.neobio.NeedlemanWunsch
Frees pointers to loaded sequences and the dynamic programming matrix so that their data can be garbage collected.
unloadSequencesInternal() - Method in class net.maizegenetics.analysis.gbs.neobio.PairwiseAlignmentAlgorithm
Subclasses must implement this method to unload sequences according to their own storage, freeing pointers to sequences and any intermediate data so that they can be garbage collected. This methid is called by the public unloadSequences method.
unloadSequencesInternal() - Method in class net.maizegenetics.analysis.gbs.neobio.SmithWaterman
Frees pointers to loaded sequences and the dynamic programming matrix so that their data can be garbage collected.
unlockHDF5GenotypeModule(h5w) - Static method in class net.maizegenetics.util.HDF5Utils
 
unlockHDF5TaxaModule(h5w) - Static method in class net.maizegenetics.util.HDF5Utils
 
UnmodifiableBitSet - Class in net.maizegenetics.util
 
unordered() - Method in class net.maizegenetics.dna.snp.TranslateIndexBuilder
 
unorderedTranslation(indicesNewOrder, base) - Static method in class net.maizegenetics.dna.snp.TranslateIndexBuilder
 
unprocessedSequence - Variable in class net.maizegenetics.analysis.gbs.ReadBarcodeResult
Original sequence from sequencer
unprocessedSequence - Variable in class net.maizegenetics.analysis.gbs.ShortReadBarcodeResult
 
updateAlleleCalls(cluster, sites, alleleCalls) - Static method in class net.maizegenetics.analysis.imputation.NucleotideImputationUtils
 
updateDistanceAndHistory(node) - Method in class net.maizegenetics.analysis.imputation.ViterbiAlgorithm
 
updateDistanceAndHistory(node) - Method in class net.maizegenetics.analysis.imputation.ViterbiAlgorithmVariableStateNumber
 
updateLoggingLocation() - Static method in class net.maizegenetics.tassel.TasselLogging
 
updateMainDisplayPanel(panel) - Method in class net.maizegenetics.tassel.TASSELMainFrame
 
UpdateMarkerAndDNA_idxes - Class in net.maizegenetics.analysis.gobii
Once I have the datasets fixed, this class should not be needed. What it does: Initially the marker_idx and dnarun_idx columns of the dataset_marker and dataset_dnarun tables respectively were not populated. They are now needed and are populated. Kevin Palis created a couple scripts to handle populating these fields in tables when they were missing. These scripts live with the gobii_ifl_scripts on CBSU, and are called update_marker_idx.py and update_dnarun_idx.py. For GOBII, then are in the rpository at the same level as the gobii_ifl.py scrips. The file below creates an intermediate file that will be worked on by the preprocess_ifile.py script. You can also run the gobii_ifl.py script instead if you uncomment the "return" statement that occurs after the preprocess_ifile.py script has been called. Here is the order: 1. Run this class to create the needed files (DS_X.mh5i and DS_X.sh5i) 2. sftp these files to cbsudc01.tc.cornell into /workdir/lcj34/postgresFiles/update_idxes_files dir 3. Run the file through gobii_ifl.scripts (change the script to return after the preprocess_ifl.py step !!) python gobii_ifl.py -c postgresql://lcj34:@localhost:5432/gobii_maize2 -i /workdir/lcj34/postgresFiles/update_idxes_files/DS_5.sh5i -o /tmp/ -v 4. Run the /tmp/ppd_* file created in step 3 through the update_dnarun_idx.py or update_marker_idx.py script python update_dnarun_idx.py "postgresql://lcj34:@cbsudc01.tc.cornell.edu/gobii_maize2" /tmp/ppd_DS_5.sh5i 5 5. Verify the db has values for dataset_marker.marker_idx and dataset_dnarun.dnarun_idx for the specified dataset_id. 6. Change the gobii_ifl.py script to re-comment the "return" after the preprocess_ifl call
updateMinP(missingObsBeforeSite) - Method in class net.maizegenetics.analysis.association.AbstractFixedEffectLM
 
updateMissingWithKinship(missing, phenotypeTaxa) - Method in class net.maizegenetics.analysis.association.CompressedMLMusingDoubleMatrix
 
updatePopulationDataAlleles(parentHaplotypes, positions, start, length) - Method in class net.maizegenetics.analysis.imputation.BiparentalHaplotypeFinder
 
updateProgress(percent) - Method in class net.maizegenetics.analysis.association.FixedEffectLMPlugin
 
updateProgress(progress) - Method in class net.maizegenetics.analysis.association.MLMPlugin
 
updateProgress(progress) - Method in class net.maizegenetics.analysis.association.WeightedMLMPlugin
 
updateReportsWithPermutationP() - Method in class net.maizegenetics.analysis.association.AbstractFixedEffectLM
 
UpdateSNPPositionQualityPlugin - Class in net.maizegenetics.analysis.gbs.v2
This plugin takes as input: tab-delimited txt file with columns CHROM, POS, QUALITYSCORE dbFile: a GBSv2 database with snppositions recorded A PositionList of positions with quality scores is sent to the database where the snpposition table is updated with a qualityScore value for the specified chromosome and position.
UpdateSNPPositionQualityPlugin() - Constructor for class net.maizegenetics.analysis.gbs.v2.UpdateSNPPositionQualityPlugin
 
UpdateSNPPositionQualityPlugin(parentFrame) - Constructor for class net.maizegenetics.analysis.gbs.v2.UpdateSNPPositionQualityPlugin
 
UpdateSNPPositionQualityPlugin(parentFrame, isInteractive) - Constructor for class net.maizegenetics.analysis.gbs.v2.UpdateSNPPositionQualityPlugin
 
updateStateObsCounts(counts, hap0, hap1, states, progenyName) - Method in class net.maizegenetics.analysis.imputation.ImputeCrossProgeny
 
updateSynonym(rowNumber, newName) - Method in class net.maizegenetics.taxa.IdentifierSynonymizer
 
UpdateTOPMWithGeneticMapping - Class in net.maizegenetics.dna.map
Update a physical map with genetic mapping information. The genetic mapping results would normally be derived from a run of TagCallerAgainstAnchorMT.
UpdateTOPMWithGeneticMapping(sTOPM, sMappings, sOutFile) - Constructor for class net.maizegenetics.dna.map.UpdateTOPMWithGeneticMapping
 
UPGMATree - Class in net.maizegenetics.taxa.tree
constructs a UPGMA tree from pairwise distances
UPGMATree(m) - Constructor for class net.maizegenetics.taxa.tree.UPGMATree
constructor UPGMA tree
upperlimit - Variable in class net.maizegenetics.stats.EMMA.EMMAforDoubleMatrix
 
usage() - Method in class net.maizegenetics.analysis.ListPlugins
 
usageParameters() - Method in class net.maizegenetics.plugindef.AbstractPlugin
 
use_match_tag - Variable in class net.maizegenetics.analysis.gbs.neobio.PairwiseAlignmentAlgorithm
Indicates if the MATCH_TAG tag should be used or not. If it is true, the alignment algorithm should write the MATCH_TAG tag in the score tag line of the alignment whenever a match occurs between characters of the two sequences. If it is false the matching character should be written instead. This flag is updated whenever a scoring scheme is set to this PairwiseAlignmentAlgorithm by the setScoringScheme method.
useAbsoluteDifference() - Method in class net.maizegenetics.analysis.numericaltransform.SubtractPhenotypeByTaxaPlugin
Use Abs Diff
useAbsoluteDifference(value) - Method in class net.maizegenetics.analysis.numericaltransform.SubtractPhenotypeByTaxaPlugin
Set Use Abs Diff. Use Abs Diff
useAlleleProbabilities(use) - Method in class net.maizegenetics.analysis.association.CompressedMLMusingDoubleMatrix
 
useAlleleProbabilities() - Method in class net.maizegenetics.analysis.association.MLMPlugin
 
useAlleleProbabilities() - Method in class net.maizegenetics.analysis.association.WeightedMLMPlugin
 
useByteFormat() - Method in class net.maizegenetics.analysis.gbs.DiscoverySNPCallerPlugin
Use byte format TagsByTaxa file (*.tbt.byte)
useByteFormat(value) - Method in class net.maizegenetics.analysis.gbs.DiscoverySNPCallerPlugin
Set Use Byte Format. Use byte format TagsByTaxa file (*.tbt.byte)
useFilterValues(filter) - Method in class net.maizegenetics.analysis.filter.FilterSiteBuilderPlugin
 
useFilterValues(filter) - Method in class net.maizegenetics.analysis.filter.FilterTaxaBuilderPlugin
 
useGenotypeCalls(use) - Method in class net.maizegenetics.analysis.association.CompressedMLMusingDoubleMatrix
 
useGenotypeCalls() - Method in class net.maizegenetics.analysis.association.MLMPlugin
 
useGenotypeCalls() - Method in class net.maizegenetics.analysis.association.WeightedMLMPlugin
 
useMatchTag() - Method in class net.maizegenetics.analysis.gbs.neobio.PairwiseAlignmentAlgorithm
Tells wether the MATCH_TAG tag should be used or not. If it returns true, the alignment algorithm should write the MATCH_TAG tag in the score tag line of the alignment produced whenever a match occurs between characters of the two sequences. If it returns false the matching character should be written instead. The value returned is conditioned by the use_match_tag flag, which is updated whenever a scoring scheme is set to this PairwiseAlignmentAlgorithm by the setScoringScheme method.
useP3D - Variable in class net.maizegenetics.analysis.association.MLMPlugin
 
useP3D - Variable in class net.maizegenetics.analysis.association.WeightedMLMPlugin
 
UseParentHaplotypes - Class in net.maizegenetics.analysis.imputation
 
UseParentHaplotypes(family) - Constructor for class net.maizegenetics.analysis.imputation.UseParentHaplotypes
 
usePermutations() - Method in class net.maizegenetics.analysis.modelfitter.StepwiseAdditiveModelFitterPlugin
Should permutations be used to set the enter and exit limits for stepwise regression? A permutation test will be used to determine the enter limit. The exit limit will be set to 2 times the enter limit.
usePermutations(value) - Method in class net.maizegenetics.analysis.modelfitter.StepwiseAdditiveModelFitterPlugin
Set Use permutations. Should permutations be used to set the enter and exit limits for stepwise regression? A permutation test will be used to determine the enter limit. The exit limit will be set to 2 times the enter limit.
user() - Method in class net.maizegenetics.analysis.gobii.GOBIIPlugin
User Name
user(value) - Method in class net.maizegenetics.analysis.gobii.GOBIIPlugin
Set User. User Name
useRandomSeed - Variable in class net.maizegenetics.analysis.association.AbstractFixedEffectLM
 
useReferenceProbability(use) - Method in class net.maizegenetics.analysis.association.CompressedMLMusingDoubleMatrix
 
useReferenceProbability() - Method in class net.maizegenetics.analysis.association.MLMPlugin
 
useReferenceProbability() - Method in class net.maizegenetics.analysis.association.WeightedMLMPlugin
 
useReferenceProbability - Variable in class net.maizegenetics.analysis.modelfitter.StepwiseAdditiveModelFitter
 
useReferenceProbability(useRefProb) - Method in class net.maizegenetics.analysis.modelfitter.StepwiseAdditiveModelFitter
 
useResiduals() - Method in class net.maizegenetics.analysis.modelfitter.ResamplingGWASPlugin
Should new terms be tested using residuals from the prior model? The analysis runs faster using this option. (Default = true)
useResiduals(value) - Method in class net.maizegenetics.analysis.modelfitter.ResamplingGWASPlugin
Set Use residuals. Should new terms be tested using residuals from the prior model? The analysis runs faster using this option. (Default = true)
useResiduals(useResid) - Method in class net.maizegenetics.analysis.modelfitter.StepwiseAdditiveModelFitter
 
useResiduals() - Method in class net.maizegenetics.analysis.modelfitter.StepwiseAdditiveModelFitterPlugin
Should the each new term be tested using residuals from the previous model instead of fitting a complete model each time?
useResiduals(value) - Method in class net.maizegenetics.analysis.modelfitter.StepwiseAdditiveModelFitterPlugin
Set Fit using residuals. Should the each new term be tested using residuals from the previous model instead of fitting a complete model each time?
useSubpopulations - Variable in class net.maizegenetics.analysis.imputation.PopulationData
 
useTaxon(name, excludelist) - Static method in class net.maizegenetics.analysis.imputation.ImputationUtils
 
UTAFromDoubleMatrix(A) - Static method in class net.maizegenetics.stats.linearmodels.SweepFast
 
UTagCountMutable - Class in net.maizegenetics.dna.tag
 
UTagCountMutable(tagLengthInLong, maxSize) - Constructor for class net.maizegenetics.dna.tag.UTagCountMutable
 
UTagCountToTagPairPlugin - Class in net.maizegenetics.analysis.gbs
 
UTagCountToTagPairPlugin() - Constructor for class net.maizegenetics.analysis.gbs.UTagCountToTagPairPlugin
 
UTagCountToTagPairPlugin(parentFrame, isInteractive) - Constructor for class net.maizegenetics.analysis.gbs.UTagCountToTagPairPlugin
 
UTagPairFinder - Class in net.maizegenetics.analysis.gbs
 
UTagPairFinder(tc) - Constructor for class net.maizegenetics.analysis.gbs.UTagPairFinder
 
UTagPairs - Class in net.maizegenetics.dna.tag
 
UTagPairs(infileS) - Constructor for class net.maizegenetics.dna.tag.UTagPairs
 
UTagPairToTOPMPlugin - Class in net.maizegenetics.analysis.gbs
 
UTagPairToTOPMPlugin() - Constructor for class net.maizegenetics.analysis.gbs.UTagPairToTOPMPlugin
 
UTagPairToTOPMPlugin(parentFrame, isInteractive) - Constructor for class net.maizegenetics.analysis.gbs.UTagPairToTOPMPlugin
 
Utils - Class in net.maizegenetics.util
 

V

val(name) - Method in interface net.maizegenetics.util.db.DBTuple
 
val(index) - Method in interface net.maizegenetics.util.db.DBTuple
 
val(index, type) - Method in interface net.maizegenetics.util.db.DBTuple
 
val(name, type) - Method in interface net.maizegenetics.util.db.DBTuple
 
val(name) - Method in class net.maizegenetics.util.db.DefaultDBTuple
 
val(index) - Method in class net.maizegenetics.util.db.DefaultDBTuple
 
val(index, type) - Method in class net.maizegenetics.util.db.DefaultDBTuple
 
val(name, type) - Method in class net.maizegenetics.util.db.DefaultDBTuple
 
validateOrdering() - Method in class net.maizegenetics.dna.map.PositionListBuilder
Returns whether List is already ordered. Important to check this if genotype and sites are separately built, as the PositionArrayList must be sorted, and will be with build.
value(taxon, site, scoreType) - Method in class net.maizegenetics.dna.snp.score.AlleleDepth
Returns the depth of nucleotide (scoreType) at given taxon and site. Depth values are stored in bytes and translated to integer using AlleleDepthUtil.depthByteToInt().
value(taxon, site, scoreType) - Method in class net.maizegenetics.dna.snp.score.AlleleProbability
 
value(taxon, site) - Method in class net.maizegenetics.dna.snp.score.Dosage
 
value(taxon, site, scoreType) - Method in class net.maizegenetics.dna.snp.score.FilterAlleleDepth
Returns the depth of nucleotide (scoreType) at given taxon and site. Depth values are stored in bytes and translated to integer using AlleleDepthUtil.depthByteToInt().
value(taxon, site, scoreType) - Method in class net.maizegenetics.dna.snp.score.FilterAlleleProbability
 
value(taxon, site) - Method in class net.maizegenetics.dna.snp.score.FilterDosage
 
value(taxon, site) - Method in class net.maizegenetics.dna.snp.score.FilterReferenceProbability
 
value(taxon, site, scoreType) - Method in class net.maizegenetics.dna.snp.score.HDF5AlleleDepth
Returns the depth of nucleotide (scoreType) at given taxon and site. Depth values are stored in bytes and translated to integer using AlleleDepthUtil.depthByteToInt().
value(taxon, site, scoreType) - Method in class net.maizegenetics.dna.snp.score.MaskAlleleDepth
 
value(taxon, site, scoreType) - Method in class net.maizegenetics.dna.snp.score.MaskAlleleProbability
 
value(taxon, site) - Method in class net.maizegenetics.dna.snp.score.MaskDosage
 
value(taxon, site) - Method in class net.maizegenetics.dna.snp.score.MaskReferenceProbability
 
value(taxon, site) - Method in class net.maizegenetics.dna.snp.score.ReferenceProbability
 
value(obs) - Method in class net.maizegenetics.phenotype.CategoricalAttribute
 
value(obs, attrnum) - Method in class net.maizegenetics.phenotype.CorePhenotype
 
value(obs, attrnum) - Method in class net.maizegenetics.phenotype.FilterPhenotype
 
value(obs) - Method in class net.maizegenetics.phenotype.NumericAttribute
 
value(obs, attrnum) - Method in interface net.maizegenetics.phenotype.Phenotype
 
value(obs) - Method in interface net.maizegenetics.phenotype.PhenotypeAttribute
 
value(obs) - Method in class net.maizegenetics.phenotype.TaxaAttribute
 
value(plugin, parameter) - Static method in class net.maizegenetics.plugindef.ParameterCache
 
value(plugin, parameter) - Static method in class net.maizegenetics.plugindef.ParameterCache
Returns the value if any for the given plugin and parameter. Value for PluginClassName.parameter will be returned if it exists. If not, value for parameter will be returned. Otherwise, an empty optional.
value(key) - Static method in class net.maizegenetics.plugindef.ParameterCache
Returns the value if any for the given key.
value() - Method in class net.maizegenetics.plugindef.PluginParameter
 
valueAt(row, col) - Method in interface net.maizegenetics.analysis.gbs.neobio.Matrix
Returns the value at an specified row and column.
valueAt(row, col) - Method in class net.maizegenetics.analysis.gbs.neobio.OutMatrix
Returns the value at a given position of the matrix. In general it returns the value of DIST[col][row] + input_border[row]. However, special cases occur for its upper right and lower left triangular parts.
valueAt(r, c) - Method in class net.maizegenetics.analysis.gbs.neobio.Smawk
This is a helper method to simplify the call to the valueAt method of the matrix. It returns the value at row r, column c.
valueByte(taxon, site, scoreType) - Method in class net.maizegenetics.dna.snp.score.AlleleDepth
Returns the depth (byte representation) of nucleotide (scoreType) at given taxon and site. Depth values are stored in bytes and translated to integer using AlleleDepthUtil.depthByteToInt().
valueByte(taxon, site, scoreType) - Method in class net.maizegenetics.dna.snp.score.FilterAlleleDepth
Returns the depth (byte representation) of nucleotide (scoreType) at given taxon and site. Depth values are stored in bytes and translated to integer using AlleleDepthUtil.depthByteToInt().
valueByte(taxon, site, scoreType) - Method in class net.maizegenetics.dna.snp.score.FilterHDF5AlleleDepth
Returns the depth (byte representation) of nucleotide (scoreType) at given taxon and site. Depth values are stored in bytes and translated to integer using AlleleDepthUtil.depthByteToInt().
valueByte(taxon, site, scoreType) - Method in class net.maizegenetics.dna.snp.score.HDF5AlleleDepth
Returns the depth (byte representation) of nucleotide (scoreType) at given taxon and site. Depth values are stored in bytes and translated to integer using AlleleDepthUtil.depthByteToInt().
valueByte(taxon, site, scoreType) - Method in class net.maizegenetics.dna.snp.score.MaskAlleleDepth
 
valueForAllele(taxon, site) - Method in interface net.maizegenetics.dna.snp.byte2d.Byte2D
 
valueForAllele(taxon, site) - Method in class net.maizegenetics.dna.snp.byte2d.HDF5Byte2D
 
valueForAllele(taxon, site) - Method in class net.maizegenetics.dna.snp.byte2d.MemoryByte2D
 
values() - Method in class net.maizegenetics.analysis.avro.GenericMapAnnotations
 
values(taxon, site) - Method in class net.maizegenetics.dna.snp.score.AlleleDepth
Returns the depth values of all nucleotides at given taxon and site. Depth values are stored in bytes and translated to integer using AlleleDepthUtil.depthByteToInt().
values(taxon) - Method in class net.maizegenetics.dna.snp.score.AlleleDepth
Returns depth values of all nucleotides and sites for given taxon. The first dimension of returned array is nucleotides (ALLELE_DEPTH_TYPES) and second dimension is sites.
values(taxon, site) - Method in class net.maizegenetics.dna.snp.score.HDF5AlleleDepth
Returns the depth values of all nucleotides at given taxon and site. Depth values are stored in bytes and translated to integer using AlleleDepthUtil.depthByteToInt().
valuesByte(taxon, site) - Method in class net.maizegenetics.dna.snp.score.AlleleDepth
Returns the depth values (byte representation) of all nucleotides at given taxon and site. Depth values are stored in bytes and translated to integer using AlleleDepthUtil.depthByteToInt().
valuesByte(taxon, site) - Method in class net.maizegenetics.dna.snp.score.FilterAlleleDepth
Returns the depth values (byte representation) of all nucleotides at given taxon and site. Depth values are stored in bytes and translated to integer using AlleleDepthUtil.depthByteToInt().
valuesByte(taxon, site) - Method in class net.maizegenetics.dna.snp.score.FilterHDF5AlleleDepth
Returns the depth values (byte representation) of all nucleotides at given taxon and site. Depth values are stored in bytes and translated to integer using AlleleDepthUtil.depthByteToInt().
valuesByte(taxon, site) - Method in class net.maizegenetics.dna.snp.score.HDF5AlleleDepth
Returns the depth values (byte representation) of all nucleotides at given taxon and site. Depth values are stored in bytes and translated to integer using AlleleDepthUtil.depthByteToInt().
valuesForAllSites(taxon) - Method in class net.maizegenetics.dna.snp.byte2d.AbstractByte2D
 
valuesForAllSites(taxon) - Method in interface net.maizegenetics.dna.snp.byte2d.Byte2D
 
valuesForAllTaxa(site) - Method in class net.maizegenetics.dna.snp.byte2d.AbstractByte2D
 
valuesForAllTaxa(site) - Method in interface net.maizegenetics.dna.snp.byte2d.Byte2D
 
valuesForSiteByte(site) - Method in class net.maizegenetics.dna.snp.score.AlleleDepth
Returns depth values (byte representation) of all nucleotides and taxa for given site. The first dimension of returned array is nucleotides (ALLELE_DEPTH_TYPES) and second dimension is taxa.
valuesForSiteByte(site) - Method in class net.maizegenetics.dna.snp.score.FilterAlleleDepth
Returns depth values (byte representation) of all nucleotides and taxa for given site. The first dimension of returned array is nucleotides (ALLELE_DEPTH_TYPES) and second dimension is taxa.
valuesForTaxonByte(taxon) - Method in class net.maizegenetics.dna.snp.score.AlleleDepth
Returns depth values (byte representation) of all nucleotides and sites for given taxon. The first dimension of returned array is nucleotides (ALLELE_DEPTH_TYPES) and second dimension is sites.
valuesForTaxonByte(taxon) - Method in class net.maizegenetics.dna.snp.score.FilterAlleleDepth
Returns depth values (byte representation) of all nucleotides and sites for given taxon. The first dimension of returned array is nucleotides (ALLELE_DEPTH_TYPES) and second dimension is sites.
valuesForTaxonByte(taxon) - Method in class net.maizegenetics.dna.snp.score.FilterHDF5AlleleDepth
Returns depth values (byte representation) of all nucleotides and sites for given taxon. The first dimension of returned array is nucleotides (ALLELE_DEPTH_TYPES) and second dimension is sites.
valuesForTaxonByte(taxon) - Method in class net.maizegenetics.dna.snp.score.HDF5AlleleDepth
Returns depth values (byte representation) of all nucleotides and sites for given taxon. The first dimension of returned array is nucleotides (ALLELE_DEPTH_TYPES) and second dimension is sites.
valueType() - Method in class net.maizegenetics.plugindef.PluginParameter
 
variableName() - Method in class net.maizegenetics.analysis.b4r.GetPhenotypeFromB4RPlugin
Name of the variable
variableName(value) - Method in class net.maizegenetics.analysis.b4r.GetPhenotypeFromB4RPlugin
Set Variable Name. Name of the variable
variance(n) - Static method in class net.maizegenetics.stats.statistics.ApproxFastChiSquareDistribution
variance of the chi-square distribution
variance(n) - Static method in class net.maizegenetics.stats.statistics.ChiSquareDistribution
variance of the chi-square distribution
variance(lambda) - Static method in class net.maizegenetics.stats.statistics.ExponentialDistribution
variance of the exponential distribution
variance(shape, scale) - Static method in class net.maizegenetics.stats.statistics.GammaDistribution
variance of the Gamma distribution
variance(m, sd) - Static method in class net.maizegenetics.stats.statistics.NormalDistribution
variance
variance(k, m) - Static method in class net.maizegenetics.stats.statistics.ParetoDistribution
variance of the Pareto distribution
VARIANTDEF - Static variable in class net.maizegenetics.dna.tag.GBSHDF5Constants
 
variantDefs - Variable in class net.maizegenetics.dna.map.AbstractTagsOnPhysicalMap
 
variantOffsets - Variable in class net.maizegenetics.dna.map.AbstractTagsOnPhysicalMap
 
VARIANTPOSOFF - Static variable in class net.maizegenetics.dna.tag.GBSHDF5Constants
 
variantsDefined(tagIndex) - Method in class net.maizegenetics.dna.map.TagsOnPhysicalMap
 
varRandomEffect - Variable in class net.maizegenetics.stats.EMMA.EMMAforDoubleMatrix
 
varResidual - Variable in class net.maizegenetics.stats.EMMA.EMMAforDoubleMatrix
 
VCAPScanPlugin - Class in net.maizegenetics.analysis.distance
 
VCAPScanPlugin(parentFrame, isInteractive) - Constructor for class net.maizegenetics.analysis.distance.VCAPScanPlugin
 
VCAPScanPlugin.SCAN_METHOD - Enum in net.maizegenetics.analysis.distance
 
VCF_DEFAULT_MAX_NUM_ALLELES - Static variable in class net.maizegenetics.dna.snp.io.VCFUtil
 
VCFUtil - Class in net.maizegenetics.dna.snp.io
 
vector1 - Variable in class net.maizegenetics.stats.linearmodels.SolveByOrthogonalizing.Marker
 
vector1() - Method in class net.maizegenetics.stats.linearmodels.SolveByOrthogonalizing.Marker
 
vector2 - Variable in class net.maizegenetics.stats.linearmodels.SolveByOrthogonalizing.Marker
 
vector2() - Method in class net.maizegenetics.stats.linearmodels.SolveByOrthogonalizing.Marker
 
version - Static variable in class net.maizegenetics.tassel.TASSELMainFrame
 
versionDate - Static variable in class net.maizegenetics.tassel.TASSELMainFrame
 
VerticalLabelUI - Class in net.maizegenetics.gui
 
virtualOffset(index) - Method in class net.maizegenetics.dna.snp.io.LineIndex
 
ViterbiAlgorithm - Class in net.maizegenetics.analysis.imputation
 
ViterbiAlgorithm(observations, transitionMatrix, obsGivenTrue, pTrue) - Constructor for class net.maizegenetics.analysis.imputation.ViterbiAlgorithm
 
ViterbiAlgorithmPlugin - Class in net.maizegenetics.analysis.imputation
 
ViterbiAlgorithmPlugin(parentFrame) - Constructor for class net.maizegenetics.analysis.imputation.ViterbiAlgorithmPlugin
 
ViterbiAlgorithmVariableStateNumber - Class in net.maizegenetics.analysis.imputation
 
ViterbiAlgorithmVariableStateNumber(observations, transitionMatrix, obsGivenTrue, pTrue) - Constructor for class net.maizegenetics.analysis.imputation.ViterbiAlgorithmVariableStateNumber
 

W

wasCancelled() - Method in class net.maizegenetics.analysis.numericaltransform.TransformDataDialog
 
wasCancelled() - Method in class net.maizegenetics.plugindef.AbstractPlugin
 
wasCancelled() - Method in interface net.maizegenetics.plugindef.Plugin
 
wasRestrictOutputChecked() - Method in class net.maizegenetics.gui.ReportDestinationDialog
 
wasSuccessful() - Method in class net.maizegenetics.matrixalgebra.decomposition.BlasSingularValueDecomposition
 
wasUseFileChecked() - Method in class net.maizegenetics.gui.ReportDestinationDialog
 
weight() - Method in class net.maizegenetics.analysis.distance.HMatrixPlugin
Weight
weight(value) - Method in class net.maizegenetics.analysis.distance.HMatrixPlugin
Set Weight. Weight
WeightedMLMPlugin - Class in net.maizegenetics.analysis.association
 
WeightedMLMPlugin(parentFrame, isInteractive) - Constructor for class net.maizegenetics.analysis.association.WeightedMLMPlugin
 
WeightedMLMPlugin.CompressionType - Enum in net.maizegenetics.analysis.association
 
weightList - Variable in class net.maizegenetics.analysis.association.WeightedMLMPlugin
 
WHICH_ALLELE - Enum in net.maizegenetics.dna
This defines the possible alleles.
whichIdNumber(name) - Method in class net.maizegenetics.taxa.distance.DistanceMatrix
 
whichIdNumber(id) - Method in class net.maizegenetics.taxa.distance.DistanceMatrix
 
whichIdNumber(t) - Method in class net.maizegenetics.taxa.tree.SimpleTree
 
whichIdNumber(t) - Method in interface net.maizegenetics.taxa.tree.Tree
 
whichObservations(level) - Method in class net.maizegenetics.phenotype.CategoricalAttribute
 
whichObservations(factorName) - Method in class net.maizegenetics.phenotype.CategoricalAttribute
 
whichSitesArePolymorphic(a, maxMissing, minMinorAlleleCount) - Static method in class net.maizegenetics.analysis.imputation.NucleotideImputationUtils
 
whichSitesArePolymorphic(a, maxMissing, minMaf) - Static method in class net.maizegenetics.analysis.imputation.NucleotideImputationUtils
 
whichSitesSegregateCorrectly(a, maxMissing, ratio) - Static method in class net.maizegenetics.analysis.imputation.NucleotideImputationUtils
 
whichSnpsAreFromSameTag(geno, minRsq) - Static method in class net.maizegenetics.analysis.imputation.NucleotideImputationUtils
 
whichSnpsAreFromSameTag(geno, polybits) - Static method in class net.maizegenetics.analysis.imputation.NucleotideImputationUtils
 
wholeMatrix() - Method in class net.maizegenetics.analysis.distance.SubtractDistanceMatrixPlugin
The filename of the whole matrix which will be used to subtract input sub-matrices.
wholeMatrix(value) - Method in class net.maizegenetics.analysis.distance.SubtractDistanceMatrixPlugin
Set Whole Matrix. The filename of the whole matrix which will be used to subtract input sub-matrices.
wholeMatrix(matrix) - Method in class net.maizegenetics.analysis.distance.SubtractDistanceMatrixPlugin
 
wholeMatrix() - Method in class net.maizegenetics.analysis.distance.VCAPScanPlugin
Whole Matrix
wholeMatrix(value) - Method in class net.maizegenetics.analysis.distance.VCAPScanPlugin
Set Whole Matrix. Whole Matrix
window - Variable in class net.maizegenetics.analysis.imputation.BiparentalHaplotypeFinder
The size of the window in which to evaluate haplotypes
window() - Method in class net.maizegenetics.analysis.imputation.FSFHapImputationPlugin
filter out sites with less than minimumMinorAlleleFrequency
window(value) - Method in class net.maizegenetics.analysis.imputation.FSFHapImputationPlugin
Set Window. filter out sites with less than minimumMinorAlleleFrequency
windowLD() - Method in class net.maizegenetics.analysis.imputation.FSFHapImputationPlugin
use the windowLD algorithm
windowLD(value) - Method in class net.maizegenetics.analysis.imputation.FSFHapImputationPlugin
Set Window L D. use the windowLD algorithm
windowSize() - Method in class net.maizegenetics.analysis.data.FindInversionsPlugin
Window Size
windowSize(value) - Method in class net.maizegenetics.analysis.data.FindInversionsPlugin
Set Window Size. Window Size
windowSize() - Method in class net.maizegenetics.analysis.popgen.SequenceDiversityPlugin
Window Size
windowSize(value) - Method in class net.maizegenetics.analysis.popgen.SequenceDiversityPlugin
Set Window Size. Window Size
windowUnit() - Method in class net.maizegenetics.analysis.data.FindInversionsPlugin
Window Unit
windowUnit(value) - Method in class net.maizegenetics.analysis.data.FindInversionsPlugin
Set Window Unit. Window Unit
WithinPopulationPermuter - Class in net.maizegenetics.stats.linearmodels
 
WithinPopulationPermuter(originalData, popEffect) - Constructor for class net.maizegenetics.stats.linearmodels.WithinPopulationPermuter
 
withReplacement() - Method in class net.maizegenetics.analysis.modelfitter.ResamplingGWASPlugin
Should the sample be formed by sampling with replacement? (Default = false)
withReplacement(value) - Method in class net.maizegenetics.analysis.modelfitter.ResamplingGWASPlugin
Set With Replacement. Should the sample be formed by sampling with replacement? (Default = false)
wordLength - Static variable in class net.maizegenetics.analysis.gbs.TagMatchFinder
 
wordLength(wordLength) - Method in class net.maizegenetics.analysis.rna.FindMatchByWordHash.Builder
 
wordNum - Variable in class net.maizegenetics.analysis.gbs.SimpleGenotypeSBit
 
wordSizeMatching() - Method in class net.maizegenetics.analysis.rna.RNADeMultiplexProductionPlugin
Word size used to find matches with reference sequences
wordSizeMatching(value) - Method in class net.maizegenetics.analysis.rna.RNADeMultiplexProductionPlugin
Set Word size used by match. Word size used to find matches with reference sequences
WorkflowPlugin - Class in net.maizegenetics.analysis.workflow
 
write(genotype, filename) - Static method in class net.maizegenetics.analysis.avro.ExportAvro
 
write(phenotype, filename) - Static method in class net.maizegenetics.phenotype.PhenotypeUtils
 
write(filename, tree, includeBranchLengths) - Static method in class net.maizegenetics.taxa.tree.NewickUtils
Writes give tree to Newick formatted file. http://evolution.genetics.washington.edu/phylip/newicktree.html
writeAlignmentToSerialGZ(sba, outFile) - Static method in class net.maizegenetics.dna.snp.ExportUtils
 
writeArgsAsXML(filename, args) - Static method in class net.maizegenetics.pipeline.TasselPipelineXMLUtil
 
writeBestMappingDataSets(bestStrand, bestChr, bestStartPos, bestEndPos, bestDivergence, bestMapP, bestDcoP, multimaps, bestEvidence, bestMapIndex) - Method in class net.maizegenetics.dna.map.TagsOnPhysicalMapV3
Write best mapping positions from all hypotheses to HDF5 datasets, including strand, chr, pos and number of multimaps
writeBinaryFile(outputFileS) - Method in class net.maizegenetics.analysis.gbs.SimpleGenotypeSBit
 
writeBinaryFile(outFile) - Method in class net.maizegenetics.dna.map.AbstractTagsOnPhysicalMap
 
writeBinaryFile(outFile, binary) - Method in class net.maizegenetics.dna.map.AbstractTagsOnPhysicalMap
 
writeBinaryFile(outFile, minResolution, requirePhysPosition, requireDCOMap, minDCOP, binary) - Method in class net.maizegenetics.dna.map.AbstractTagsOnPhysicalMap
TODO need to add LocusList to test, whether to include in output, move this to abstract
writeBinaryFile(outfileS) - Method in class net.maizegenetics.dna.map.PETagsOnPhysicalMapV3
Write to a file
writeBinaryFileForChromosomalRegion(outFile, targetChr, minPos, maxPos) - Method in class net.maizegenetics.dna.map.AbstractTagsOnPhysicalMap
Outputs a new binary topm containing only tags with start positions that lie within the specified chromosomal region (inclusive). To obtain the whole chromosome, set minPos to Integer.MIN_VALUE and maxPos to Integer.MAX_VALUE TODO : generalize to other types of topm (HDF5, text)?
writeBlock(blockIndex) - Method in class net.maizegenetics.dna.map.TagGWASMap
 
writeBlock(blockIndex) - Method in class net.maizegenetics.dna.tag.AbstractTagsHDF5
Write current block to HDF5 file
writeBreakpointFile(imputedGenotypes, outFilename) - Method in class net.maizegenetics.analysis.imputation.ImputeCrossProgeny
 
writeBreakpoints() - Method in class net.maizegenetics.analysis.imputation.ImputeProgenyStatesPlugin
Write breakpoint file from imputed genotypes and parentage.
writeBreakpoints(value) - Method in class net.maizegenetics.analysis.imputation.ImputeProgenyStatesPlugin
Set Write Breakpoints. Write breakpoint file from imputed genotypes and parentage.
writeByte(value) - Method in class net.maizegenetics.analysis.monetdb.LittleEndianDataOutputStream
 
writeChars(data) - Method in class net.maizegenetics.analysis.monetdb.LittleEndianDataOutputStream
 
writeChrom9Bits(peakPositions) - Static method in class net.maizegenetics.analysis.gbs.repgen.RepGenAlignerPlugin
 
writeChrom9Bits(peakPositions) - Static method in class net.maizegenetics.analysis.gbs.repgen.RepGenPhase2AlignerPlugin
 
writeCluster(outfileS, binary) - Method in class net.maizegenetics.analysis.gbs.Clusters
 
writeDepth(genotypeTable, filename) - Static method in class net.maizegenetics.dna.snp.io.SiteScoresIO
 
WriteDistanceMatrix - Class in net.maizegenetics.taxa.distance
 
writeDistFile(outfileS, format) - Method in class net.maizegenetics.dna.map.PETagsOnPhysicalMap
 
writeDistFile(outfileS, format) - Method in class net.maizegenetics.dna.map.TagsOnGeneticMap
Write TagsOnGeneticMap file
writeDistFile(outfileS, ifOut, format) - Method in class net.maizegenetics.dna.map.TagsOnGeneticMap
Write TagsOnGeneticMap file
writeDistFile(outFile, numberType, minCount) - Method in class net.maizegenetics.dna.tag.AbstractTagsByTaxa
 
writeDistFile(outfileS, format, minCount) - Method in class net.maizegenetics.dna.tag.PETagCounts
Write PETagCounts file
writeDistFile(outFile, binary, minCount) - Method in class net.maizegenetics.dna.tag.ReadsByTaxa
 
writeDistFile(outFile, fileType, minCount) - Method in interface net.maizegenetics.dna.tag.TagsByTaxa
Write the TagsByTaxa object to a file in one of the FilePacking formats. MinCount is useful for excluding the low depth tags (many of these are sequencing errors).
writeDistFile(newHDF5file, tagIndex) - Method in class net.maizegenetics.dna.tag.TagsByTaxaByteHDF5TagGroups
 
writeEntry(a, site, tagLocusStart, strand, test, status, value, cuttoff) - Method in class net.maizegenetics.analysis.gbs.SNPLogging
 
writeEntry(chr, position, alleles, tagLocusStart, strand, test, status, value, cuttoff) - Method in class net.maizegenetics.analysis.gbs.SNPLogging
 
writeFastA(rbt, outFastAS) - Method in class net.maizegenetics.analysis.gbs.Clusters
 
writeFASTA(fileName) - Method in interface net.maizegenetics.dna.map.GVCFGenomeSequence
 
writeFastA(outfileS) - Method in class net.maizegenetics.dna.map.TagsOnGeneticMap
Output FASTA file of TOGM
writeFasta(outfileS) - Method in class net.maizegenetics.dna.read.FastqChunk
 
writeFasta(gt, out) - Static method in class net.maizegenetics.dna.snp.ExportUtils
Simple method to export a GenotypeTable to a fasta file.
writeFastaNoGaps(gt, out) - Static method in class net.maizegenetics.dna.snp.ExportUtils
Simple method to export a GenotypeTable to a fasta file while removing Gap characters.
writeFastQ(outfileS) - Method in class net.maizegenetics.dna.map.TagsOnGeneticMap
Output FASTQ file of TOGM
writeFastq(outputFileS, format) - Method in class net.maizegenetics.dna.read.FastqChunk
Write Fastq file
writeFiles() - Method in class net.maizegenetics.analysis.modelfitter.StepwiseAdditiveModelFitterPlugin
Should the requested output be written to files?
writeFiles(value) - Method in class net.maizegenetics.analysis.modelfitter.StepwiseAdditiveModelFitterPlugin
Set Write to files. Should the requested output be written to files?
writeFloat(value) - Method in class net.maizegenetics.analysis.monetdb.LittleEndianDataOutputStream
 
writeGamma(outputFile, formatString) - Method in class net.maizegenetics.analysis.imputation.BackwardForwardAlgorithm
 
writeGamma(outputFile) - Method in class net.maizegenetics.analysis.imputation.BackwardForwardAlgorithm
 
writeGenotypeHDF5(a, newHDF5file) - Static method in class net.maizegenetics.dna.snp.ExportUtils
 
writeGenotypeHDF5(a, newHDF5file, keepDepth) - Static method in class net.maizegenetics.dna.snp.ExportUtils
 
writeGenotypeHDF5(a, newHDF5file, exportTaxa, keepDepth) - Static method in class net.maizegenetics.dna.snp.ExportUtils
Exports a alignment into the Byte HDF5 format.
writeH5File(outputFileS) - Method in class net.maizegenetics.analysis.gbs.SimpleGenotypeSBit
 
writeHapMap(rbt, outfileS, coverRate) - Method in class net.maizegenetics.analysis.gbs.Clusters
 
writeHDF5Annotation(writer, path, annotations) - Static method in class net.maizegenetics.util.HDF5Utils
 
writeHDF5Block(objectPath, myWriter, blockSize, block, val) - Static method in class net.maizegenetics.util.HDF5Utils
 
writeHDF5EntireArray(objectPath, myWriter, objMaxLength, blockSize, val) - Static method in class net.maizegenetics.util.HDF5Utils
 
writeHDF5GenotypesAlleleStates(h5w, aEncodings) - Static method in class net.maizegenetics.util.HDF5Utils
 
writeHDF5GenotypesCalls(h5w, taxon, calls) - Static method in class net.maizegenetics.util.HDF5Utils
 
writeHDF5GenotypesDepth(h5w, taxon, depth) - Static method in class net.maizegenetics.util.HDF5Utils
 
writeHDF5GenotypeSiteScores(writer, taxon, siteScoreType, values) - Static method in class net.maizegenetics.util.HDF5Utils
 
writeHDF5GenotypesMaxNumAlleles(h5w, maxNumAlleles) - Static method in class net.maizegenetics.util.HDF5Utils
 
writeHDF5GenotypesNumTaxa(h5w, numTaxa) - Static method in class net.maizegenetics.util.HDF5Utils
 
writeHDF5GenotypesRetainRareAlleles(h5w, retainRareAlleles) - Static method in class net.maizegenetics.util.HDF5Utils
 
writeHDF5GenotypesScoreType(h5w, scoreType) - Static method in class net.maizegenetics.util.HDF5Utils
 
writeHDF5PositionNumSite(h5w, numSites) - Static method in class net.maizegenetics.util.HDF5Utils
 
writeHDF5TaxaNumTaxa(h5w, numTaxa) - Static method in class net.maizegenetics.util.HDF5Utils
 
writeInt(value) - Method in class net.maizegenetics.analysis.monetdb.LittleEndianDataOutputStream
 
writeLocationLookupToFile(filename) - Method in class net.maizegenetics.dna.map.GenomeFeatureMap
Write just the location lookup to a tab-delimited file. This is mostly to check that your locations loaded properly, as there is no way to read them back in.
writeLong(value) - Method in class net.maizegenetics.analysis.monetdb.LittleEndianDataOutputStream
 
writeMapAsBinaryFile(filename) - Method in class net.maizegenetics.dna.map.GenomeFeatureMap
Write the map data as a precompiled binary that can be read back in by class GenomeFeatureMapBuilder). Unlike JSON or flatfile format, this file is not human-readable and is simply a a representation of the Java data structures saved onto a disk. This makes it very compact and fast to read back in. This is the preferred format for long-term storage of a class GenomeFeatureMap since there is (almost) no risk of someone accidentally modifying the file.
writeMapAsFlatFile(filename) - Method in class net.maizegenetics.dna.map.GenomeFeatureMap
Write the map data as a flat, tab-delimited file (which can be read in by class GenomeFeatureMapBuilder). The writer first compiles a set of all attribute types across the map and sets these as the columns (in alphabetical order). Attributes that don't apply to a given feature are output as "NA". This can end up being very wasteful if you have some attributes that only apply to a small percentage of features; in that case, a JSON or binary file is probably a better choice.
writeMapAsJsonFile(filename) - Method in class net.maizegenetics.dna.map.GenomeFeatureMap
Write the map data as a JSON file (which can be read in by class GenomeFeatureMapBuilder). Core attributes (unique ID, chromosome, start, stop, and parent ID) are output to all features. Any additional attributes are output only for those features that have them. Attributes are output in alphabetical order. Since the attribute name has to be output for every feature, this can waste space if all your features have the same attributes. In that case a tab-delimited flat file or precompiled binary file is probably a better choice.
writeMergedPEFastq(fastqR1FileS, fastqR2FileS, fastqContigFileS, format) - Method in class net.maizegenetics.dna.read.PEFastqChunk
Write PE read and Pcontig read, when there is a Pcontig, PE read will not be output
writePeakPositions(chrom, peak, peakPositions) - Static method in class net.maizegenetics.analysis.gbs.repgen.RepGenAlignerPlugin
 
writePeakPositions(chrom, peak, peakPositions) - Static method in class net.maizegenetics.analysis.gbs.repgen.RepGenPhase2AlignerPlugin
 
writePEFastq(fastqR1FileS, fastqR2FileS, format) - Method in class net.maizegenetics.dna.read.PEFastqChunk
Write original PE sequence
writePlink(phenotype, filename) - Static method in class net.maizegenetics.phenotype.PhenotypeUtils
 
WritePopulationAlignmentPlugin - Class in net.maizegenetics.analysis.imputation
 
WritePopulationAlignmentPlugin(parentFrame) - Constructor for class net.maizegenetics.analysis.imputation.WritePopulationAlignmentPlugin
 
writeReadCountFile(outFile, binary) - Method in class net.maizegenetics.dna.tag.AbstractTagsByTaxa
Writes a tag count file in binary (true) or text (false) format, containing the tag sequences from this TBT file.
writeReadCountFile(outFile, binary, minCount) - Method in class net.maizegenetics.dna.tag.ReadsByTaxa
 
writeReferenceProbability(genotypeTable, filename) - Static method in class net.maizegenetics.dna.snp.io.SiteScoresIO
 
writeShort(value) - Method in class net.maizegenetics.analysis.monetdb.LittleEndianDataOutputStream
 
writeSubTOPM(outputFileS, tagIndex) - Method in class net.maizegenetics.dna.map.TagsOnPhysicalMapV3
 
writeTagBlockPosition(blockFileS, selectIndex) - Method in class net.maizegenetics.analysis.gbs.TagBlockPosition
 
writeTagBlockPosition(blockFileS) - Method in class net.maizegenetics.analysis.gbs.TagBlockPosition
 
writeTagCountFile(outFile, binary, minCount) - Method in class net.maizegenetics.dna.tag.TagCounts
 
writeTagDistributionBucket(h5w, bucket, tags, length, encodedTaxaDist, maxTaxa, tagDistOffset) - Static method in class net.maizegenetics.util.HDF5Utils
 
writeTagGeneticMappingInfoDataSets(dataSetNames, tgmiChunk, chunkIndex) - Method in class net.maizegenetics.dna.map.TagsOnPhysicalMapV3
Write TGMI buffer/chunk to HDF5 datasets
writeTagGeneticMappingInfoGWDataSet(dataSetName, tgmiChunk, chunkIndex) - Method in class net.maizegenetics.dna.map.TagsOnPhysicalMapV3
Write whole genome genetic mapping TGMI buffer/chunk to HDF5 datasets
writeTagMappingInfoDataSets(dataSetNames, tmiChunk, chunkIndex) - Method in class net.maizegenetics.dna.map.TagsOnPhysicalMapV3
Write TMI buffer/chunk to HDF5 datasets, which is used to annotate the TOPM with multiple alignment hypothesis
writeTagPair(tc, outfileS) - Method in class net.maizegenetics.analysis.gbs.UNetworkFilter
 
writeTagPair(outfileS) - Method in class net.maizegenetics.dna.tag.UTagPairs
 
writeTextFile(outfile) - Method in class net.maizegenetics.dna.map.AbstractTagsOnPhysicalMap
 
writeTextFile(outfile) - Method in interface net.maizegenetics.dna.map.TOPMInterface
 
writeTextMap(tagCountFileS, outputFileS) - Method in class net.maizegenetics.dna.map.TagsOnPhysicalMapV3
Write text format map and genetic map for methods development
writeToFasta(outfileS) - Method in class net.maizegenetics.dna.tag.AbstractTagsHDF5
 
writeToFile() - Method in class net.maizegenetics.analysis.association.EqtlAssociationPlugin
Should the results be saved to a file rather than stored in memory? It true, the results will be written to a file as each SNP is analyzed in order to reduce memory requirementsand the results will NOT be saved to the data tree. Default = false.
writeToFile(value) - Method in class net.maizegenetics.analysis.association.EqtlAssociationPlugin
Set Write to file. Should the results be saved to a file rather than stored in memory? It true, the results will be written to a file as each SNP is analyzed in order to reduce memory requirementsand the results will NOT be saved to the data tree. Default = false.
writeToFile(chrom, chromMaximaMap, minCount) - Static method in class net.maizegenetics.analysis.gbs.repgen.RepGenAlignerPlugin
 
writeToFile(chrom, chromMaximaMap, minCount) - Static method in class net.maizegenetics.analysis.gbs.repgen.RepGenPhase2AlignerPlugin
 
writeToFile(outfile, pa) - Static method in class net.maizegenetics.dna.snp.io.ProjectionGenotypeIO
Exports the ProjectionGenotypes to a file
writeToFlapjack(genotypes, filename, delimiter) - Static method in class net.maizegenetics.dna.snp.io.FlapjackUtils
Writes given genotype table to Flapjack format
writeToHapmap(alignment, filename) - Static method in class net.maizegenetics.dna.snp.ExportUtils
Write a GenotypeTable to HapMap format with standard settings - unphased single character, tab delimiter, and no progress tracking.
writeToHapmap(alignment, diploid, filename, delimChar, listener) - Static method in class net.maizegenetics.dna.snp.ExportUtils
Write a GenotypeTable to HapMap format.
writeToHapmap(alignment, diploid, filename, delimChar, includeTaxaAnnotations, listener) - Static method in class net.maizegenetics.dna.snp.ExportUtils
 
writeToPlink(alignment, filename, delimChar) - Static method in class net.maizegenetics.dna.snp.ExportUtils
Writes given set of alignments to a set of Plink files
writeTOPM(topm, filename) - Static method in class net.maizegenetics.dna.map.TOPMUtils
 
writeToVCF(gt, filename, keepDepth) - Static method in class net.maizegenetics.dna.snp.ExportUtils
Writes given alignment to a VCF file
writeToVCF(gt, filename, keepDepth, listener) - Static method in class net.maizegenetics.dna.snp.ExportUtils
 

X

X - Variable in class net.maizegenetics.stats.EMMA.EMMAforDoubleMatrix
 
x - Variable in class net.maizegenetics.util.Tuple
 
Xbeta - Variable in class net.maizegenetics.stats.EMMA.EMMAforDoubleMatrix
 
xor(other) - Method in interface net.maizegenetics.util.BitSet
XOR
xor(other) - Method in class net.maizegenetics.util.OpenBitSet
this = this XOR other
xor(other) - Method in class net.maizegenetics.util.UnmodifiableBitSet
 
xorCount(a, b) - Static method in class net.maizegenetics.util.OpenBitSet
Returns the popcount or cardinality of the exclusive-or of the two sets. Neither set is modified.
Xoriginal - Variable in class net.maizegenetics.stats.EMMA.EMMAforDoubleMatrix
 
XTXSweepSetDmin() - Method in class net.maizegenetics.stats.linearmodels.SweepFast
 
XYAndLineToolTipGenerator - Class in net.maizegenetics.analysis.chart
 
XYMultipleYToolTipGenerator - Class in net.maizegenetics.analysis.chart
 
XYMultipleYToolTipGenerator(postionFormat) - Constructor for class net.maizegenetics.analysis.chart.XYMultipleYToolTipGenerator
 
XYScatterAndLinePanel - Class in net.maizegenetics.analysis.chart
 
XYScatterAndLinePanel(plugin, table, countToDisplay, tableIndices, indices) - Constructor for class net.maizegenetics.analysis.chart.XYScatterAndLinePanel
 
XYScatterMultipleYPanel - Class in net.maizegenetics.analysis.chart
 
XYScatterMultipleYPanel(plugin, theTable, start, end) - Constructor for class net.maizegenetics.analysis.chart.XYScatterMultipleYPanel
 
XYScatterPanel - Class in net.maizegenetics.analysis.chart
Title:
XYScatterPanel(theTable) - Constructor for class net.maizegenetics.analysis.chart.XYScatterPanel
 
XYScatterPanel(theTable, seriesX, seriesY1, seriesY2, isRegression) - Constructor for class net.maizegenetics.analysis.chart.XYScatterPanel
 

Y

y - Variable in class net.maizegenetics.analysis.modelfitter.AbstractForwardRegression
 
y - Variable in class net.maizegenetics.analysis.modelfitter.ForwardStepAdditiveSpliterator
 
y - Variable in class net.maizegenetics.analysis.modelfitter.StepwiseAdditiveModelFitter
 
y - Variable in class net.maizegenetics.stats.EMMA.EMMAforDoubleMatrix
 
y - Variable in class net.maizegenetics.util.Tuple
 
YEARS - Variable in interface net.maizegenetics.taxa.tree.Units
 

Z

Z - Variable in class net.maizegenetics.stats.EMMA.EMMAforDoubleMatrix
 
Zoriginal - Variable in class net.maizegenetics.stats.EMMA.EMMAforDoubleMatrix
 
A B C D E F G H I J K L M N O P Q R S T U V W X Y Z 
Skip navigation links